sfrp-1, Pmo_009874 (mRNA) Phagocata morgani

Resumen
Nombresfrp-1
Nombre únicoPmo_009874
TipomRNA
OrganismoPhagocata morgani (P. morgani)
Secuencia de longitud1068
Análisis
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homología
BLAST of sfrp-1 vs. uniprot
Match: gi|61216791|sp|Q863H1|SFRP2_CANFA (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; Flags: Precursor [Canis lupus familiaris])

HSP 1 Score: 148.288 bits (373), Expect = 7.036e-40
Identity = 91/290 (31.38%), Postives = 143/290 (49.31%), Query Frame = 1
Query:   67 IFYLQIACFLGD-----WQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSCV-KSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
            +  L   C LG      + Q    Y    C  IP NL LC  + Y+ M LPN + HE ++E ++ +  WI LV   CH D KKFLCSL+APVC+ ++  + + PC  LC+ VK+ C P M  FGF WP+++EC  FP   N LCI         P+T    K C +C  K+     +    C ++  ++ K++ IT    +  II L  KS+ +   +  S+  L+   +W    LQC C     E   +   +L+M   + G+ ++  + +W++   +F+     +RK 
Sbjct:   10 LLVLASHCCLGSARGLFFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKLGGELVITSVKRWQKGQREFKRISRSIRKL 292          
BLAST of sfrp-1 vs. uniprot
Match: gi|61216828|sp|Q96HF1|SFRP2_HUMAN (RecName: Full=Secreted frizzled-related protein 2; Short=FRP-2; Short=sFRP-2; AltName: Full=Secreted apoptosis-related protein 1; Short=SARP-1; Flags: Precursor)

HSP 1 Score: 147.902 bits (372), Expect = 8.749e-40
Identity = 91/291 (31.27%), Postives = 143/291 (49.14%), Query Frame = 1
Query:   67 IFYLQIACFLGD------WQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSCV-KSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
            + +L   C LG       + Q    Y    C  IP NL LC  + Y+ M LPN + HE ++E ++ +  WI LV   CH D KKFLCSL+APVC+ ++  + + PC  LC+ VK+ C P M  FGF WP+++EC  FP   N LCI         P+T    K C +C  K+     +    C ++  ++ K++ IT    +  II L  KS+ +   +  S+  L+   +W    LQC C     E   +   +L+M     G+ ++  + +W++   +F+     +RK 
Sbjct:   10 LLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293          
BLAST of sfrp-1 vs. uniprot
Match: gi|341942099|sp|Q8C4U3|SFRP1_MOUSE (RecName: Full=Secreted frizzled-related protein 1; Short=sFRP-1; Flags: Precursor)

HSP 1 Score: 148.288 bits (373), Expect = 9.042e-40
Identity = 93/287 (32.40%), Postives = 140/287 (48.78%), Query Frame = 1
Query:   73 YLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI----PSTIHKDKK-----CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYI--------------IDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLR 864
            Y+     +G +Q  +      QC  IP +L LC NVGYK+M+LPN ++HE + E  Q +  W+ L+N NCH   + FLCSL+APVC+     + + PC+ LC +V++SC P M+ FGF WP +++C  FP G   +CI    P+T    K      C  C      E +    C S   +R KI+ +  KK+NG                I   +  R + F  N +         C C +L      L   +LIM   VK Q ++  I KW ++N +F+N +  ++
Sbjct:   36 YVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEG--DVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEV--KKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGA--------DCPCHQL----DNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMK 302          
BLAST of sfrp-1 vs. uniprot
Match: gi|61216765|sp|P97299|SFRP2_MOUSE (RecName: Full=Secreted frizzled-related protein 2; Short=sFRP-2; AltName: Full=Protein SDF5; AltName: Full=Secreted apoptosis-related protein 1; Short=SARP-1; Flags: Precursor)

HSP 1 Score: 147.902 bits (372), Expect = 9.798e-40
Identity = 85/267 (31.84%), Postives = 136/267 (50.94%), Query Frame = 1
Query:  121 GYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSC-VKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
             Y    C  IP NL LC  + Y+ M LPN + HE ++E ++ +  WI LV   CH D KKFLCSL+APVC+ ++  + + PC  LC+ VK+ C P M  FGF WP+++EC  FP   N LCI         P+T    K C +C  K+     +    C ++  ++ K++ IT    +  II L  KS+ +   +  S+  L+   +W    LQC C ++      +   +L+M     G+ ++  + +W++   +F+     +RK 
Sbjct:   34 SYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293          
BLAST of sfrp-1 vs. uniprot
Match: gi|61216861|sp|Q9XSC1|SFRP5_BOVIN (RecName: Full=Secreted frizzled-related protein 5; Short=sFRP-5; Flags: Precursor)

HSP 1 Score: 148.288 bits (373), Expect = 1.013e-39
Identity = 82/256 (32.03%), Postives = 134/256 (52.34%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI-------PSTIHKDKK-CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQ------CNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVL 861
            QC  IP +L LC  VGYKRM LPN ++HE L E  Q +  W+ L+   CH D + FLCSL+APVC+     + + PC+ LC +V+  C P M+ +GF WP ++ C  FP   N LCI       P+T     K C  C    S + +  + C S+ V++ +I+ I  +  +  +I   +K + LK    + + + ++ L       C C +L     +L G +L+M   V GQ ++  + +W ++N + + ++  +
Sbjct:   50 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKRLVLHMKNSAGCPCPQL----DSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFM 296          
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001274 (Asxlregen_comp63361_c0_seq1|m.13574|m.6037)

HSP 1 Score: 383.645 bits (984), Expect = 2.204e-131
Identity = 181/309 (58.58%), Postives = 238/309 (77.02%), Query Frame = 1
Query:   67 IFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIPSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNI-VKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYAKMKNRNKASNKTK 990
            +F   +  F+GDWQ FQ+GY+ +QCY+IPDN TLC NVGY+ M+LPNYIQHE +EE  QHSKVW+GLVN+ CH DIKKF+CSLYAPVCI N + QKVPPC+ELC++VKESCLPSMK++GF+WP IM+CS FP  +NSLCIP T+   KKC  C+K ASYEV+AN+FCLS IVIR KI+RI     N   I L +KS+FLKFQ+N SQ++L++ L+CNCT LKF+ +ALKG+W+IM  I    + +VNFI+KWKR+  +F++S+ +++ FG+ +C+  LP   DG  S+ +RY AY KM N+ K SN+ K
Sbjct:   13 LFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLP---DG-ISLRERYAAYLKMNNQLKYSNERK 317          
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15040524 (dd_smedV4_8832_0_1|m.39951|m.18186)

HSP 1 Score: 186.037 bits (471), Expect = 6.244e-55
Identity = 103/273 (37.73%), Postives = 158/273 (57.88%), Query Frame = 1
Query:  100 DWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIPST-----------IHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELC 885
            +W     GYS+ +C++IP+   LC N+GY +MILPN++QHE ++E +  S  W    +  CH D ++FLCSLYAPVC+ N  ++K+ PCKELCLSVK++C P+M  FG++WP I+ C  FP     LCI  T           + K   CRS   +A    + + +C S  VIR KI R+  + ++ Y++ L +KS+ +K           I + C C  +  +N   KG+WL+M  +  G+  +  +TKWK++N DF+  I  L+KF  ++C
Sbjct:   27 EWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAA---FINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDN-IRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKIC 295          
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15030883 (SmedSxlregen_c55322_g1_i1|m.6956|m.30359)

HSP 1 Score: 153.68 bits (387), Expect = 1.962e-42
Identity = 101/312 (32.37%), Postives = 147/312 (47.12%), Query Frame = 1
Query:   91 FLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY--KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIP------------------------STIHKD-------KKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQS--NQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELCR-----LNLPNN 906
            F  D++   N     QCY    N TLC   G           +++     ++  S +WI L+++ CH D++KFLC++YAP+C+   +  +V PC+ELC SVKE CLP +K++GFEWP+I++C  FP    + CI                          TI  D       K C  C +    E++   FC  ++VIR KI  I  K      I L  KS  +        S ++L   +QC C+ L+      KGKWL+  +I  GQ IV F+TKW+R+   FR+    L K     C+     LN+ NN
Sbjct:   17 FSVDFRVGANRQRLNQCYPKFANHTLCGGAGVLNSMKTFSGLLRNSKSGFSIYQSNIWIILLHTKCHVDLEKFLCTIYAPICLKGHRFTRVFPCEELCASVKEQCLPRLKIYGFEWPSIVDCGKFPLENKASCIQLTDGTGNYLKKSLVKKQREDRSLNQTILSDQEQTLQKKNCPICNRKVPLEILTKNFCKYSLVIRAKIANIFQKPKGAISIRLQHKSNIIHSSHPIRISLANLITEIQCKCSILQNAKSVSKGKWLLFGDIENGQFIVKFLTKWQRKRKKFRSLFRQLMKKPKFFCKNRNKLLNIVNN 328          
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15001054 (Asxlregen_comp62015_c0_seq1|m.11130|m.22104)

HSP 1 Score: 92.8189 bits (229), Expect = 1.339e-20
Identity = 47/125 (37.60%), Postives = 67/125 (53.60%), Query Frame = 1
Query:  148 IPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCIPSTIHKDKKCRS 522
            IP  +++C  +GY    +PN + H  LEE     + +  LV  NC ED++ FLCS+YAP+C+ N    ++P C+ LC+S +E C   M  +GF+WP  M C   P     L       KD K RS
Sbjct:   36 IPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWP-NRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACL------RKDNKTRS 153          
BLAST of sfrp-1 vs. Smed Unigenes AA
Match: SMU15005581 (SmedAsxldir_c106676_g1_i1|m.77561|m.15397)

HSP 1 Score: 88.1965 bits (217), Expect = 5.843e-19
Identity = 47/132 (35.61%), Postives = 71/132 (53.79%), Query Frame = 1
Query:   91 FLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI 486
            F+ + +   + Y+   C KI   +  C  + Y+  I PN++ H   +E       ++ L+   CH  ++ FLCSLY PVC    K   +PPC+ LCL +K+ C P +K F F+WP  M C L+P   N+LCI
Sbjct:   23 FINNIRAVNDPYNQPNCEKI--KVPACQGLLYQMTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVCTIMKK--ALPPCRSLCLQIKKECEPILKKFYFKWPQSMSCDLYP--ENNLCI 148          
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|48475052|ref|NP_003004.1| (secreted frizzled-related protein 2 precursor [Homo sapiens])

HSP 1 Score: 147.902 bits (372), Expect = 3.302e-40
Identity = 91/291 (31.27%), Postives = 143/291 (49.14%), Query Frame = 1
Query:   67 IFYLQIACFLGD------WQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI---------PSTIHKDKKCRSCV-KSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQ---IW----LQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
            + +L   C LG       + Q    Y    C  IP NL LC  + Y+ M LPN + HE ++E ++ +  WI LV   CH D KKFLCSL+APVC+ ++  + + PC  LC+ VK+ C P M  FGF WP+++EC  FP   N LCI         P+T    K C +C  K+     +    C ++  ++ K++ IT    +  II L  KS+ +   +  S+  L+   +W    LQC C     E   +   +L+M     G+ ++  + +W++   +F+     +RK 
Sbjct:   10 LLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKII-LETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCE----EMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKL 293          
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|56117838|ref|NP_003003.3| (secreted frizzled-related protein 1 precursor [Homo sapiens])

HSP 1 Score: 146.747 bits (369), Expect = 1.255e-39
Identity = 93/286 (32.52%), Postives = 139/286 (48.60%), Query Frame = 1
Query:   73 YLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI----PSTIHKDKK-----CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNG------YIIDLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKFGNELC 885
            Y+     +G +Q  +      QC  IP +L LC NVGYK+M+LPN ++HE + E  Q +  W+ L+N NCH   + FLCSL+APVC+     + + PC+ LC +V++SC P M+ FGF WP +++C  FP G   +CI    P+     K      C  C      E +    C S   +R KI+ +  KK+NG            +     K    +    L+    C C +L      L   +LIM   VK Q ++  I KW ++N +F+   N ++K  N  C
Sbjct:   36 YVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEG--DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEV--KKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQL----DNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFK---NFMKKMKNHEC 306          
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|188528609|ref|NP_003006.2| (secreted frizzled-related protein 5 precursor [Homo sapiens])

HSP 1 Score: 140.969 bits (354), Expect = 1.999e-37
Identity = 82/259 (31.66%), Postives = 135/259 (52.12%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI-------PSTIHKDKK-CRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYIIDLSQKSRFLKFQSNQSQSSLQIWLQ------CNCTKLKFENKALKGKWLIMVNIVKGQPIVNFITKWKRRNIDFRNSINVLRKF 870
            QC  IP +L LC  VGYKRM LPN ++HE L E  Q +  W+ L+   CH D + FLCSL+APVC+     + + PC+ LC +V+  C P M+ +GF WP ++ C  FP   N LCI       P+T     K C  C    S + +  + C S+ V++ +I+ I  +  +  +I   +K + LK    + + + ++ L       C C +L     +L G +L+M   V GQ ++  + +W ++N + + ++  +  +
Sbjct:   52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQL----DSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 301          
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 89.7373 bits (221), Expect = 9.137e-19
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  124 YSAEQCYKIPDN-------LTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
            Y+ E+   +PD+       + LC ++ Y + I+PN + H   E+       +  LV   C  ++K FLCS+YAPVC   +  Q +PPC+ LC   ++ C   M  FGF+WP+ ++C  FP  G   LC+
Sbjct:  102 YNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC--TVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCV 228          
BLAST of sfrp-1 vs. RefSeq Human
Match: gi|4503833|ref|NP_003498.1| (frizzled-7 precursor [Homo sapiens])

HSP 1 Score: 85.8853 bits (211), Expect = 1.706e-17
Identity = 43/129 (33.33%), Postives = 66/129 (51.16%), Query Frame = 1
Query:  124 YSAEQCYKIPDN-------LTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
            Y  E+   +PD+       + LC ++ Y + ILPN + H   E+       +  LV   C  +++ FLCS+YAPVC   +  Q +PPC+ LC   ++ C   M  FGF+WP  + C  FP  G   +C+
Sbjct:   35 YHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC--TVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICV 161          
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 81.2629 bits (199), Expect = 1.526e-16
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  151 PDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
            P  +++C N+ Y   I+PN I H   EE       +  LV   C +D++ FLCSLY PVC   +  + +PPC+ LC S +  C   MK + F WP  +ECS FP  G   LC+
Sbjct:   55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC--TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164          
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 81.2629 bits (199), Expect = 1.743e-16
Identity = 44/113 (38.94%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  151 PDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP-SGRNSLCI 486
            P  +++C N+ Y   I+PN I H   EE       +  LV   C +D++ FLCSLY PVC   +  + +PPC+ LC S +  C   MK + F WP  +ECS FP  G   LC+
Sbjct:   55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC--TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164          
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|24640330|ref|NP_511068.2| (frizzled 4, isoform A [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 2.955e-16
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRN--SLCI--PSTIHKDKK 513
            QC  I   + +C  +GY    +PN + +E   +     + +  L+  +C   +K FLC+ Y P+C     +  + PC+ LC SV+  C P ++ FGF WP  ++C  FP   N  ++C+  P  +H+ ++
Sbjct:   45 QCETI--RIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQ 172          
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|45551429|ref|NP_727170.2| (frizzled 4, isoform B [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 2.955e-16
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  136 QCYKIPDNLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRN--SLCI--PSTIHKDKK 513
            QC  I   + +C  +GY    +PN + +E   +     + +  L+  +C   +K FLC+ Y P+C     +  + PC+ LC SV+  C P ++ FGF WP  ++C  FP   N  ++C+  P  +H+ ++
Sbjct:   45 QCETI--RIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQ 172          
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 73.559 bits (179), Expect = 6.332e-14
Identity = 33/102 (32.35%), Postives = 51/102 (50.00%), Query Frame = 1
Query:  157 NLTLCLNVGYKRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIYNMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFP 462
             + +C  +GY     PN + HE  +E       +  LV   C  D+K FLCS+Y P+C+ +   + +P C+ +C   +  C P M+ + FEWP  M C   P
Sbjct:   68 TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYH-KPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP 168          
The following BLAST results are available for this feature:
BLAST of sfrp-1 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|61216791|sp|Q863H1|SFRP2_CANFA7.036e-4031.38RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216828|sp|Q96HF1|SFRP2_HUMAN8.749e-4031.27RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|341942099|sp|Q8C4U3|SFRP1_MOUSE9.042e-4032.40RecName: Full=Secreted frizzled-related protein 1;... [more]
gi|61216765|sp|P97299|SFRP2_MOUSE9.798e-4031.84RecName: Full=Secreted frizzled-related protein 2;... [more]
gi|61216861|sp|Q9XSC1|SFRP5_BOVIN1.013e-3932.03RecName: Full=Secreted frizzled-related protein 5;... [more]
back to top
BLAST of sfrp-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150012742.204e-13158.58Asxlregen_comp63361_c0_seq1|m.13574|m.6037[more]
SMU150405246.244e-5537.73dd_smedV4_8832_0_1|m.39951|m.18186[more]
SMU150308831.962e-4232.37SmedSxlregen_c55322_g1_i1|m.6956|m.30359[more]
SMU150010541.339e-2037.60Asxlregen_comp62015_c0_seq1|m.11130|m.22104[more]
SMU150055815.843e-1935.61SmedAsxldir_c106676_g1_i1|m.77561|m.15397[more]
back to top
BLAST of sfrp-1 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|48475052|ref|NP_003004.1|3.302e-4031.27secreted frizzled-related protein 2 precursor [Hom... [more]
gi|56117838|ref|NP_003003.3|1.255e-3932.52secreted frizzled-related protein 1 precursor [Hom... [more]
gi|188528609|ref|NP_003006.2|1.999e-3731.66secreted frizzled-related protein 5 precursor [Hom... [more]
gi|4503825|ref|NP_003496.1|9.137e-1934.11frizzled-1 [Homo sapiens][more]
gi|4503833|ref|NP_003498.1|1.706e-1733.33frizzled-7 precursor [Homo sapiens][more]
back to top
BLAST of sfrp-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|442632294|ref|NP_001261836.1|1.526e-1638.94frizzled, isoform C [Drosophila melanogaster][more]
gi|17864440|ref|NP_524812.1|1.743e-1638.94frizzled, isoform A [Drosophila melanogaster][more]
gi|24640330|ref|NP_511068.2|2.955e-1629.23frizzled 4, isoform A [Drosophila melanogaster][more]
gi|45551429|ref|NP_727170.2|2.955e-1629.23frizzled 4, isoform B [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|6.332e-1432.35frizzled 2, isoform A [Drosophila melanogaster][more]
back to top
Secuencias
The following sequences are available for this feature:

mRNA sequence

>Pmo_009874 ID=Pmo_009874|Name=sfrp-1|organism=Phagocata morgani|type=mRNA|length=1068bp
AAAATATTTACACTAGAAATTTAAAACTTGAAAAAAATGTGTATTTTGTC
TTTATTTTTTTTTAATATTTTTTATTTACAAATCGCTTGCTTCCTGGGCG
ACTGGCAGCAATTTCAAAATGGTTATTCTGCAGAACAATGTTACAAAATT
CCAGATAACTTAACGCTTTGTCTCAATGTTGGATATAAAAGAATGATTTT
GCCAAATTATATTCAACACGAATATTTAGAAGAAACTGTTCAGCATTCAA
AAGTATGGATTGGTTTAGTGAATTCAAACTGCCATGAAGATATAAAAAAA
TTTTTATGTTCTTTGTACGCTCCTGTTTGTATATATAATATGAAAATTCA
AAAGGTGCCTCCATGTAAAGAATTATGTTTAAGTGTGAAAGAATCATGCT
TACCAAGTATGAAATTGTTTGGATTTGAATGGCCTAATATTATGGAATGT
TCTTTATTTCCAAGTGGAAGAAATTCACTCTGTATTCCCAGTACAATCCA
CAAAGATAAAAAATGTCGATCATGTGTCAAATCAGCTTCTTATGAAGTCA
TGGCTAACAAATTCTGTTTATCGAATATCGTTATAAGAGGAAAAATCAGA
CGCATCACAGCAAAGAAAGACAATGGATATATAATTGATTTGAGTCAAAA
ATCTCGATTTTTAAAGTTTCAATCTAATCAAAGTCAAAGTTCATTACAAA
TTTGGCTACAGTGTAATTGCACGAAATTAAAATTTGAAAATAAAGCTTTA
AAAGGAAAATGGTTGATAATGGTAAATATTGTCAAAGGTCAGCCAATTGT
AAATTTTATCACCAAATGGAAAAGAAGGAATATAGATTTTAGGAACAGTA
TAAATGTTTTACGGAAATTTGGAAACGAATTATGCCGATTGAATCTTCCA
AACAATTCAGACGGACGAACAAGTATGCTTAAAAGATATTTAGCATATGC
TAAAATGAAGAATCGAAACAAGGCTTCAAATAAAACGAAGTGACATTCAA
TAAAATTGATAACATAACTTTATTAGATTCAAGATTAATTTCATCGATCA
GTTTTATCCTGCTTCACG

Design Primers for sfrp-1

back to top

protein sequence

>Pmo_009874-protein ID=Pmo_009874-protein|Name=sfrp-1|organism=Phagocata morgani|type=polypeptide|length=319bp
MCILSLFFFNIFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY
KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIY
NMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI
PSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYII
DLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVK
GQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKR
YLAYAKMKNRNKASNKTK*
back to top

coding sequence

>Pmo_009874.37.993 ID=Pmo_009874.37.993|Name=Pmo_009874.37.993|organism=Phagocata morgani|type=CDS|length=957bp
ATGTGTATTTTGTCTTTATTTTTTTTTAATATTTTTTATTTACAAATCGC
TTGCTTCCTGGGCGACTGGCAGCAATTTCAAAATGGTTATTCTGCAGAAC
AATGTTACAAAATTCCAGATAACTTAACGCTTTGTCTCAATGTTGGATAT
AAAAGAATGATTTTGCCAAATTATATTCAACACGAATATTTAGAAGAAAC
TGTTCAGCATTCAAAAGTATGGATTGGTTTAGTGAATTCAAACTGCCATG
AAGATATAAAAAAATTTTTATGTTCTTTGTACGCTCCTGTTTGTATATAT
AATATGAAAATTCAAAAGGTGCCTCCATGTAAAGAATTATGTTTAAGTGT
GAAAGAATCATGCTTACCAAGTATGAAATTGTTTGGATTTGAATGGCCTA
ATATTATGGAATGTTCTTTATTTCCAAGTGGAAGAAATTCACTCTGTATT
CCCAGTACAATCCACAAAGATAAAAAATGTCGATCATGTGTCAAATCAGC
TTCTTATGAAGTCATGGCTAACAAATTCTGTTTATCGAATATCGTTATAA
GAGGAAAAATCAGACGCATCACAGCAAAGAAAGACAATGGATATATAATT
GATTTGAGTCAAAAATCTCGATTTTTAAAGTTTCAATCTAATCAAAGTCA
AAGTTCATTACAAATTTGGCTACAGTGTAATTGCACGAAATTAAAATTTG
AAAATAAAGCTTTAAAAGGAAAATGGTTGATAATGGTAAATATTGTCAAA
GGTCAGCCAATTGTAAATTTTATCACCAAATGGAAAAGAAGGAATATAGA
TTTTAGGAACAGTATAAATGTTTTACGGAAATTTGGAAACGAATTATGCC
GATTGAATCTTCCAAACAATTCAGACGGACGAACAAGTATGCTTAAAAGA
TATTTAGCATATGCTAAAATGAAGAATCGAAACAAGGCTTCAAATAAAAC
GAAGTGA
back to top
Grupos De Genes
sfrp-1 is similar in sequence to the genes of this group: GG7656
Gene NameGene ID
SMU15001274SMU15001274
sfrp-1Ddo_009225
sfrp-1Gsp_013592
sfrp-1Pgr_015361
sfrp-1Pmo_009874

Gene Group Protein Sequences

>SMU15001274

MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNV
GYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVC
ISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSL
CIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAI
QIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQI
DSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERY
AAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS*
>Ddo_009225 sfrp-1
LIAFSNDIGIRGMITILPLGLLLSLFSNGNCFIGDWESFRSGYTTDQCYK
VPENFSMCHNVGYNKMVLPNFIQHEYMEEAIAHSRVWLSLVKSQCHLDVR
KFLCSLYAPVCITNKRIQKVPPCRELCIIVKEACLPSMKMYGFNWPEIMK
CSKFPPVQNALCIPKTTVKKKNCELCVKNAPYEVIANRFCLSPIVIRAKI
KRIIPKESGFQIVLHQKSKFLKFQSNSSRDSVNLWLKCNCLNLKFQQRAL
RGRWIIMARIVEDRFVVNFISKWKKKKEEFKNSIRIIQKFGNVVCKSKLK
DGISLQERYVAYMKMNNKTNYQNQLKQQTRKFKKRKQNQQRRIP*
>Gsp_013592 sfrp-1
MVIIFRFTFILFVFNVNCFIGDWQSFQSGYTIDQCYHIPDNFSLCRNVGY
NRMVLPNYIQHESIEEAVQHSRVWMGLVNTQCHIDIRKFICSLYAPVCIS
SQRVQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCI
PRTLVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKTMQI
VLQKKSKFLKFFANFSQTDLNLRLKCNCTNLKFKQRALKGRWIIMAKVNQ
NEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAY
LKMNNKIKYSNNNNKSKQQTRRSKKPINTRSSSIS*
>Pgr_015361 sfrp-1
LFLFFIFYLHISCFLGDWQQFQNGYSTEQCFKIPDNLTLCLNVGYKRMIL
PNYIQHEYLDEAVQHSKVWIGLVNSHCHEDIRKFLCSLYAPVCINNMRIQ
KVPPCKELCVSVKEACLPSMKLFGFEWPNIMKCSLFPSVRNSLCIPSTVS
KGKKCRPCVKSSSYEVMANKFCLSNIVIRAKIKRIVKEGNNGFKIELGQK
TGFLKFQSDFTRNSLKILLQCNCTRLKFEKRALKGKWLIMVNIVDNQPVV
NFITKWKRKNTNFRYSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYA
KMNNITQFKNRKNRNNNSKENKKPKKSWTTQKKNAYKN*
>Pmo_009874 sfrp-1
MCILSLFFFNIFYLQIACFLGDWQQFQNGYSAEQCYKIPDNLTLCLNVGY
KRMILPNYIQHEYLEETVQHSKVWIGLVNSNCHEDIKKFLCSLYAPVCIY
NMKIQKVPPCKELCLSVKESCLPSMKLFGFEWPNIMECSLFPSGRNSLCI
PSTIHKDKKCRSCVKSASYEVMANKFCLSNIVIRGKIRRITAKKDNGYII
DLSQKSRFLKFQSNQSQSSLQIWLQCNCTKLKFENKALKGKWLIMVNIVK
GQPIVNFITKWKRRNIDFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKR
YLAYAKMKNRNKASNKTK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.