frizzled-like, Ddo_014376 (mRNA) Dugesia dorotocephala

Resumen
Nombrefrizzled-like
Nombre únicoDdo_014376
TipomRNA
OrganismoDugesia dorotocephala (D. dorotocephala)
Secuencia de longitud2288
Análisis
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Properties
Property NameValue
NoteFrizzled-like
Homología
BLAST of frizzled-like vs. uniprot
Match: gi|17433091|sp|Q9ULW2|FZD10_HUMAN (RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz10; AltName: Full=FzE7; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 375.941 bits (964), Expect = 1.512e-118
Identity = 203/550 (36.91%), Postives = 320/550 (58.18%), Query Frame = 1
Query:  127 LFGFVSAKLSVDIYK----QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGK---ICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVD-ILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            + G  +A  S+D+ +    +C PI  P+C+DI Y  TRMPNL+G  +Q EA+ ++ +F PL+   C  +L+ FLCS+Y PMC  +    S  I  C+ +C   + +C P M E     WP+ LDC KLP K     +C+   +   DE T  +                L +  + +  +    +  G   G    P + +  +  + SCA +C+  V   +S  DK FA +WL  W+V+CFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G L+    G +++AC   + QL +++  G E+T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WA+PA+K+I IL++ ++  DELTG C+VG+ + NAL  FV++P   YLV G  F+  G+V+L  +RR            N  +LEKLM +IG+FS+LY +P  C +  +  +   M+Y+ + + A ++   N         + ++ +D ++   +P+VE+ M++IFM LV+GITSG+WIW  +KT++S
Sbjct:   14 VMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQV---STPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGS-----------GLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVE-KSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMN---------NQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTLQS 530          
BLAST of frizzled-like vs. uniprot
Match: gi|52782829|sp|Q8BKG4|FZD10_MOUSE (RecName: Full=Frizzled-10; Short=Fz-10; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 372.089 bits (954), Expect = 4.420e-117
Identity = 205/568 (36.09%), Postives = 325/568 (57.22%), Query Frame = 1
Query:  118 INLLFGFVSAKLSVDIYK----QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGK---ICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFD-VAVRALYQF-----SPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS----CINGIK 1764
            + ++ G  +A  S+D+ +    +C P+  P+C+DI Y  TRMPNL+G  +Q EA+ ++ +F PL+   C ++L+ FLCS+Y PMC +E V  S  I  C+ +C   + +C P M E  +  WP+ LDC KLP K     +C+   +   DE +  +                L +  + +  +    +  G        P + +  + +  SCA +C+  V   +S  DK FA +WL  WSV+CFFS   T++ F  + +RF YPE+PI+FLS+CY  Y+ G ++    G +++AC   + QL +++  G E+T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WA+PA+K+I IL++ ++  DELTG C+VG+ + NAL  FV+VP   YLV G  F+  G+V+L  +RR            N  +LEKLM +IGVFS+LY +P  C +  +  +   M+Y+  +A +   +      +P+CL    +               P+VE+ M+++ M LV+GITSG+W+W  +KT++S    C  G+K
Sbjct:   12 LQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMC-TEQV--STPIPACRVMCEQARLKCSPIM-EQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGS-----------GMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSE-SCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSI---------------PAVEVFMVKVSMLLVVGITSGVWVW-TSKTLQSWQHVCSRGLK 541          
BLAST of frizzled-like vs. uniprot
Match: gi|17433077|sp|Q9PWH2|FZD10_CHICK (RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-10; Flags: Precursor [Gallus gallus])

HSP 1 Score: 371.703 bits (953), Expect = 6.901e-117
Identity = 207/562 (36.83%), Postives = 326/562 (58.01%), Query Frame = 1
Query:   94 SIILIVIGINLLFGFVSAKLSVDIYK----QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGK---ICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCL-PSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVD-ILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            +++  V+ +  L    +   S+DI +    +C PI  P+C+DI Y  TRMPNL+G  +Q EA+ ++ +F PL+   C  +LK FLCS+Y PMC +E V  S  I  C+ +C   + +C P M E     WP+ LDC KLP K     +C+   +   DE    +           + L  + +  + + T  D+ Q    L  + C  P + +  +  + SCA +C+  V   +S  DK FA IW+  WS++CFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G ++    G +++AC   + QL +++  G E+T C I FL++Y+FG +S+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WA+PA+K+I IL++ ++  DELTG C+VG+ + NAL  FV++P   YL+ G  F+  G+V+L  +RR            N  +LEKLM +IGVFS+LY +P  C +  +  +   M+Y+ +               K    + ++ +D ++   +P+VE+ M++IFM LV+GITSG+WIW  +KT++S
Sbjct:    7 NLVRAVLALCWLAEHCAGISSIDIERPGDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMC-TEQV--STPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPPRGS-----------SMLPPMFRPQRPS-TGHDLQQHKDSLSRTSCENPGKFHHVE-KSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQL-YVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVAS----------QQKCKMNNQTKNLDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTLQS 534          
BLAST of frizzled-like vs. uniprot
Match: gi|17433043|sp|Q9DEB5|FZ10A_XENLA (RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=Xfz10-A; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 370.163 bits (949), Expect = 3.190e-116
Identity = 212/587 (36.12%), Postives = 322/587 (54.86%), Query Frame = 1
Query:  172 QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGK---ICLTPDSFDLDEQTGKTK--------SKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVD-ILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCIN--GIKCWRLNKEIQLSQINQCDSVTTPNNFPLSQVNHKESLLPYP 1884
            +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ +F PL+   C ++LK FLCS+Y PMC +E V  S  I  C+ +C   + +C P M E     WP+ LDC KLP K     +C+   +   DE    +          +  +  E+Y +  T     + N  K    +K+                     SCA +CS++V   +S  DK FA IW+  WS++CFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G ++    G  ++AC   + QL +++  G E+T C I FL++Y+FG +S+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WA+PA+K+I IL++ ++  DELTG C+VG+ + NAL  FV++P   YL+ G  F+  G+V+L  +RR            N  +LEKLM +IGVFS+LY +P  C +  +  +   M+++ +               K    S ++ +D  +   +P+VE+ M++IFM LV+GITSG+WIW  +KTV+S  N    +  + N+    S I        P + P       ES L  P
Sbjct:   39 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMC-TEQV--STPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDETPRGSSMLPPIFRPQRPSSGHEIYPKDPTSRSSCE-NSGKFHHVEKSA--------------------SCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILAT----------QDKCKMDSQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQSWQNVFSKRLKKRNRSKPASVITSAGIYKKPQHPPKVHHGKYESALQSP 583          
BLAST of frizzled-like vs. uniprot
Match: gi|17433096|sp|Q9W742|FZ10B_XENLA (RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=Xfz10-B; AltName: Full=Frizzled-9; Short=Fz-9; Short=Xfz9; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 365.925 bits (938), Expect = 9.603e-115
Identity = 211/587 (35.95%), Postives = 322/587 (54.86%), Query Frame = 1
Query:  172 QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGK---ICLTPDSFDLDEQTGKTK--------SKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVD-ILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCIN--GIKCWRLNKEIQLSQINQCDSVTTPNNFPLSQVNHKESLLPYP 1884
            +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ +F PL+   C ++LK FLCS+Y PMC +E V  S  I  C+ +C   + +C P M E     WP+ LDC KLP K     +C+   +   DE    +          +  +  E+Y + +   + +  N  K    +K+                     SCA +CS++V   +S +DK FA IW+  WS++CFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G ++    G  ++AC   + QL +++  G E+T C I FL++Y+FG +S+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WA+PA+K+I IL++ ++  DELTG C+VG+ + NAL  FV++P   YL+ G  F+  G+V+L  +RR            N  +LEKLM +IGVFS+LY +P  C +  +  +   M+++ +               K    S ++ +D  +   +P+VE+ M++IFM LV+GITSG+WIW  +KTV+S  N       + N+    S I        P   P       ES L  P
Sbjct:   33 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMC-TEQV--STPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDEAPRSSSILPPIFRPQRPNSGHEMYPK-DPKGRSSCENSGKFHHVEKSA--------------------SCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILA----------TQDKCKMDSQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQSWQNVFSKSLKKRNRNKPASVITSAGIYKKPQQPPKIHHGKYESALRSP 577          
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15029711 (SmedSxlregen_c141340_g1_i1|m.45153|m.4173)

HSP 1 Score: 950.658 bits (2456), Expect = 0.000e+0
Identity = 454/644 (70.50%), Postives = 543/644 (84.32%), Query Frame = 1
Query:   82 IIMKSIILIVIGINLLFGFVSAKLSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQINQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYP-NIEFALPSISVPSEVVFPPPNNSSISDASSKH* 2010
            I M   +LI+I I+     ++ +   DIYKQC PI EP CQD+ Y+ T MPNL+G YSQTEASKR RDF PLINI+CSNYLKLFLCSVYFPMC++++ M+S  +KPC+ LC HVK+RCEP MKE+ +LTW EELDCEK PE+GKICLTPDSF  DE      S+ ++ ++LY +L+ +MQGN+I ++KL+I+QK   ++G++CLPS++NIGQ  N+SCAQICSANVQF+  DK FANIWL+GWSV+CFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYA GNL GAILGR  VACR+FN++ DF+V +GRETTWCKINFLM+YFFGS+SALWWVVLTITWFLSASRHWGYEAIESISSMLHL+SWA+PALKSIFILILHKIDADELTGQCFVGNSN   LW FVIVP++IYL  G+VFL++GY+SLLKVRRSFLQRPDC DTNNLKRLEKLMAKIGVFSILY++PV+CT+VS+I DAYKM  FD+ ++AL++FSPNC+   G+ WS  +CV+ILQP+LPSVE+RMLRIFMNLVIGITSGIWIWGN KTV+SCI+ ++ W   KE + +  NQCDS T  NN PLSQ   KE+LLPY DWK NS YP  +E+ LP++SVPS++V PPPNNSSISD SS+H*
Sbjct:   19 ISMTKTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIV-PPPNNSSISDDSSRH* 661          
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15005387 (SmedAsxldir_c106380_g2_i1|m.75515|m.16659)

HSP 1 Score: 380.178 bits (975), Expect = 1.396e-120
Identity = 212/618 (34.30%), Postives = 343/618 (55.50%), Query Frame = 1
Query:  136 FVSAKLSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETL--MQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPAN-------VSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTN-RFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMV--DNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRP---DCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTV----RSCINGIKCWRLNKEIQLSQINQCDSVTTPNNFPLSQVNHK------ESLLPYPDWKFNSPYPN 1914
            F S     D+Y +C  I + +CQ ++Y +TRMPN +GI +Q +++KR+ D+FPLIN +CS Y + FLC+ YFPMC ++ +  ++ + PC+ +C  V+ RCEPFMK + +L WP EL+C+K P   +IC+ P ++DLD       +  + +K+ Y + +++  + GN +   +L+ F+     +  KCL S +++    +        SC   C +N+ +S SDK  A IW   W+++C  S ++ I  F  +   RFLYPE+PI+F+ +CY      NL    L RK + C+  +   + M+    G E+  C + FL +Y+F   +ALWW++L I+ +L++ R W  E +E IS+ +H++SW LPA+ +  +LILHKID DEL G C+VG  N+ +   F+++P I+  + G V L L + SL+ +R++          +   N + LEK +AK G+F  +Y +P+ C +   +     ++ ++            C+   G+ WS   C+  L   LP VE+R+L IF  LVIGITSG+W+W N KT+    R  ++ I C   NKE  +       S+   +  PLS +N +       S L Y +   NS Y N
Sbjct:   25 FKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFMK-AFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGN-VKTNRLENFETE---INLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLP--LPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITC--RNKENPIMNY----SIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKN 628          
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15040087 (dd_smedV4_7210_0_1|m.35691|m.13357)

HSP 1 Score: 305.064 bits (780), Expect = 7.871e-93
Identity = 183/532 (34.40%), Postives = 279/532 (52.44%), Query Frame = 1
Query:  169 KQCSP--ITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLP---EKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDF-MVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            ++C P  I  P CQ++ Y  T MPNL+ + +Q EA  +++ F  LI  +CS  L  FLCSVY PMCD    +++ +I PC+ LC  V+  CE  M+    L WP  L+C + P    +G +C+        E  G +    EN + +   ++       IN+T+             KC+P                CSAN+ F+  DK  A IWL   + +CF S + TI+ F  NT+RF YPE+P++FL++CY  Y+  + +     R++ AC        F +   G + T C I FL+ +FF ++S +WWV+LT+ W L+A   W  EAI   S   HL +W + +L ++ +L+L  +DADEL G C VG  N + L IFVI+P+II+LV G  FL  G V+L++VRR        ND    ++LE LM +IG+FS+L+++P         +     N+++ A R  +  S                        P++E+ ML+IFM+ V+GITSG+W+W + KT+ S
Sbjct:   44 RKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDP---ISNYLIGPCQPLCEEVRDSCERIMRP-FNLPWPVTLNCSRFPVRNAEGSMCM--------EGPGPSVKSTENFQTMCGGMKNPRLFIFINRTQ-------------KCVPK---------------CSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHVK-----NDGIKTEKLEILMVRIGLFSVLFLVPS--------STVLGCNFYEYANRDHWLKSGTN---------------------PNIEVYMLKIFMSSVVGITSGVWVW-SIKTLES 500          
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15036199 (SmedSxlregen_c90692_g1_i1|m.42870|m.18187)

HSP 1 Score: 299.671 bits (766), Expect = 2.864e-90
Identity = 188/573 (32.81%), Postives = 289/573 (50.44%), Query Frame = 1
Query:  172 QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKT---KSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQINQCDSVTT--PNN---FPLSQVNHKE 1866
            +C PI  P+C++I Y  T MPN     +Q EA   +  F+PL+ I CS+ L+LFLCS+Y P+C        + I+ C+ +C   +  C P M  +    WP+ +DC+KL E  + CL  D+ ++ +   K    K ++  I +   Q  +++ G   N                                C Q C +   F   DK+F   WL  W+V+C  S   T++ F  + +RF YPE+PIVFLS CY   + G ++   +G + +AC       D +         C I FL++YFFG ++++WWV+LTITWFLSA   WG EAI   S + H L+W L  +KSI  L L  ID D + G C++GN+N+  L +F+IVP  +YL+ G  FL  G+++L+ +R++   + +    +   +LEKLM +IG+F +LY +P    +  H+        ++V  R  ++ S NC   + +    +          P   + ML+ FM LV+GITSG WIW  +KT+ S  N  +  RL++ I      Q D  T   P N    PL Q+N  +
Sbjct:   58 KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNW---PKPIQACRSVCESARDGCAPVM-NTYGFKWPKSMDCDKLTEN-QACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVAN--------------------------------CFQSCHS-ANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG-----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGE----SKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHL--------YEVKNREFWEKSNNCYCNRNIKSQENF-------SKPEYSVFMLKYFMCLVVGITSGFWIW-TSKTLDSWHNAFR--RLSQSI----CGQSDKHTKQFPGNEQETPLCQINSNQ 561          
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15014534 (SmedAsxldir_c94917_g1_i1|m.35515|m.3335)

HSP 1 Score: 300.827 bits (769), Expect = 1.209e-89
Identity = 188/593 (31.70%), Postives = 298/593 (50.25%), Query Frame = 1
Query:  172 QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLP----EKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKC---LP----SQINIGQPANVS------CAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQ----LDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALY--QFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTV--------RSCINGIKCWRLNKEIQLSQINQCDSVTTPNNFPLSQVN 1857
            +C  I  P+C+DI Y  T MPN+    +Q EA      F+PL+ I+CS  L+ FLCS+Y P+C  + V +   + PC+ +C  VK+ C+P +++     WPE+++C++ P     +  +C+  +            + A   +   N  +   Q N +N+    + ++    +  +C    P    ++IN      VS      CAQ C +    S SD+ F   WL  W++IC  S    +  FS +  R+ YPE+PI+F+SICYF  + G L+  ++G +++AC S   +    L  +   G     C I FL++Y+FG +++LWWV+LTITWFL+A   WG EAI   S + H L+W LP +KSI  L +  +D D ++G C+VGN++   L +FV+ P ++YL  G + L  G+ SL ++ RS ++      T   ++LEKLM +IGVFS+LY  P    V   I        +++  RA +    S +C        ++ R         PS  + M + FM + +G+TSG WIW + KT+        R  IN       NK   L+ +   +     NN  L   N
Sbjct:   42 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKS---LPPCRSVCERVKKGCDPLLQK-YTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQ-NLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRI-RSIIKLQTGGKT---EKLEKLMIRIGVFSVLYTAPAAVIVACII--------YELQNRAEWYQNLSCDCFDSNRHQLNLPR---------PSYSVFMFKYFMFMGVGMTSGFWIW-SKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDN 607          
BLAST of frizzled-like vs. RefSeq Human
Match: gi|6005762|ref|NP_009128.1| (frizzled-10 precursor [Homo sapiens])

HSP 1 Score: 375.941 bits (964), Expect = 5.707e-119
Identity = 203/550 (36.91%), Postives = 320/550 (58.18%), Query Frame = 1
Query:  127 LFGFVSAKLSVDIYK----QCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGK---ICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVD-ILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            + G  +A  S+D+ +    +C PI  P+C+DI Y  TRMPNL+G  +Q EA+ ++ +F PL+   C  +L+ FLCS+Y PMC  +    S  I  C+ +C   + +C P M E     WP+ LDC KLP K     +C+   +   DE T  +                L +  + +  +    +  G   G    P + +  +  + SCA +C+  V   +S  DK FA +WL  W+V+CFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G L+    G +++AC   + QL +++  G E+T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WA+PA+K+I IL++ ++  DELTG C+VG+ + NAL  FV++P   YLV G  F+  G+V+L  +RR            N  +LEKLM +IG+FS+LY +P  C +  +  +   M+Y+ + + A ++   N         + ++ +D ++   +P+VE+ M++IFM LV+GITSG+WIW  +KT++S
Sbjct:   14 VMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQV---STPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGS-----------GLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVE-KSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMN---------NQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTLQS 530          
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503835|ref|NP_003499.1| (frizzled-9 precursor [Homo sapiens])

HSP 1 Score: 353.599 bits (906), Expect = 2.414e-110
Identity = 202/526 (38.40%), Postives = 299/526 (56.84%), Query Frame = 1
Query:  175 CSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQ--FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            C  +  P+C+ I Y  TRMPNL+G  SQ EA+  + +F PL+   C ++L+ FLCS+Y PMC  +    S  I  C+ +C   + RC P M E     WP+ LDC +LP +      P +  ++     T   AE     +  L  L    +  +   D+   AG   G+   P +    + +  SCA  C   V+  +S  DK FA +W+  WS +CFFS   T++ F    +RF YPE+PI+FLS+CY  Y+   L+ A+ G ++VAC      L +++  G E T C + FL++Y+FG +S+LWWVVLT+TWFL+A + WG+EAIE+  S  H+ +W LPALK+I IL L K+  DELTG C+V +++  AL  FV+VP   YLV G  FL  G+V+L  +R+            N ++LEKLM KIGVFSILY +P  C +V ++ +   M+++   +RA  Q    C    G      R   +    +P+V + ML+IFM+LV+GITSG+W+W ++KT ++
Sbjct:   39 CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQV---STPIPACRPMCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRND----PHALCMEAPENATAGPAEP----HKGLGMLPVAPRPARPPGDLGPGAGG-SGTCENPEKFQYVEKSR-SCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGAL-YVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWR--LRATEQ---PCAAAAGPG--GRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVW-SSKTFQT 536          
BLAST of frizzled-like vs. RefSeq Human
Match: gi|22547161|ref|NP_036325.2| (frizzled-4 precursor [Homo sapiens])

HSP 1 Score: 343.584 bits (880), Expect = 3.802e-107
Identity = 193/531 (36.35%), Postives = 293/531 (55.18%), Query Frame = 1
Query:  169 KQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQ----PANVSCAQICSANVQ-FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            ++C PI   +CQ++ Y  T+MPNL+G   QT+A  ++  F PLI   CS+ L+ FLCSVY PMC  +  +    I PC  +C  VK+RCEP +KE     WPE L+C K P +                             +N +   M+G    +  L    K     G +C     N  Q      +++C   C  +   +S S K F +IW+  W+ +CF S   T++ F  +++RF YPE+PI+FLS+CY  Y+   ++   +GR+ ++C         ++  G + T C I FL++YFFG +S++WWV+LT+TWFL+A   WG+EAIE  SS  H+ +WA+PA+K+I ILI+  +DADELTG C+VGN N +AL  FV+ P   YLV G +F++ G V+L K+ RS LQ+    D     +LE+LM KIGVFS+LY +P  C +  +        +++++  AL+++S +   M                      + ML+IFM+L++GITSG+WIW + KT+ +
Sbjct:   43 RRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIP---IGPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFPPQND---------------------------HNHM--CMEGPGDEEVPLP--HKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKI-RSNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACY--------FYEISNWALFRYSADDSNMA---------------------VEMLKIFMSLLVGITSGMWIW-SAKTLHT 503          
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503833|ref|NP_003498.1| (frizzled-7 precursor [Homo sapiens])

HSP 1 Score: 322.398 bits (825), Expect = 9.239e-99
Identity = 184/541 (34.01%), Postives = 294/541 (54.34%), Query Frame = 1
Query:  151 LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLP--EKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQ-------KAGWLMGSKCLPSQINIGQPANVSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            +SV  +  C PI+ P+C DI Y QT +PNL+G  +Q +A   +  F+PL+ ++CS  L+ FLCS+Y P+C   +V++ Q I PC+ LC   +Q CE  M +     WPE L CE  P    G+IC+  ++ D     G   +       L +   T +     +      F        K    +G + L  + + G P     A   +  + F   ++ FA +W+  WSV+C  S L T++ +  +  RF YPE+PI+FLS CYF  A  ++ G +L  + V    F++     V  G +   C I F+++YFFG +S++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL + ++D D L+G C+VG S+ +AL  FV+ P  +YL  G  FL  G+VSL ++R         +D    ++LEKLM +IGVFS+LY +P    +  +        +++ A R  ++ +    T K  ++++        PM P   + M++  M +++GIT+G WIW + KT++S
Sbjct:   41 ISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC---TVLD-QAIPPCRSLCERARQGCEALMNK-FGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFL-GERDCGAPCEPGRA---NGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-----HDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACY--------FYEQAFREHWERTWLLQTCK--SYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIW-SGKTLQS 556          
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 319.701 bits (818), Expect = 7.701e-97
Identity = 188/546 (34.43%), Postives = 277/546 (50.73%), Query Frame = 1
Query:  151 LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLP--EKGKICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSK--C-----LPSQINIGQPANVSCAQICSAN-----VQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            +SV  +  C PI+ P+C DI Y QT MPNL+G  +Q +A   +  F+PL+ ++CS  LK FLCS+Y P+C     +  Q + PC+ LC   +Q CE  M +     WP+ L CEK P    G++C+  ++ D          K      L  +  T    +     +      AG     K  C     +PS +N        C   C        + F   +  F+  W+  WSV+C  S L T++ +  +  RF YPE+PI+FLS CY   A   + G +L  + V    F E     V  G +   C I F+M+YFF  +S++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL L ++D D L+G CFVG +N +AL  FV+ P  +YL  G  FL  G+VSL ++R         +D    ++LEKLM +IGVFS+LY +P    +  +    Y+  + D   R+    S     +               PM P   + M++  M L++GITSG WIW + KT+ S
Sbjct:  108 ISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC----TVLEQALPPCRSLCERARQGCEALMNK-FGFQWPDTLKCEKFPVHGAGELCVGQNTSD----------KGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-----HDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYF---YEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIW-SGKTLNS 629          
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 271.166 bits (692), Expect = 5.956e-80
Identity = 164/538 (30.48%), Postives = 265/538 (49.26%), Query Frame = 1
Query:  166 YKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKG--KICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACR---------SFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRA--LYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTV 1740
            + +C PIT  +C++I Y  T MPNLIG   Q EA   +  F PL+ I CS+ L+LFLCS+Y P+C     +  + I PC+ LC   +  CE  MK +    WPE L+C K P  G   +C+  ++                +    +Q         I      +  K    MG      ++ +G      C   C A + F   ++     W+  W+ +C  SCL T++ F  +++RF YPE+ IVFL++CY    C  + G   G  +V+CR            + +  +    R+TT C + F+ +YF   ++  WW  L   WFL+A   WG+EAIE+ S + HL++WA+PAL++I +L L K++ D L+G CFVG  +T++L  F+I+P  IYL  G +FL  G++SL ++R          D     +LE+LM +IG FS L+I+P V  +     + Y  + + +         FS  C   +      +R         P  ++ M++   ++++G+TS +W++ +   V
Sbjct:   50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESARV-CEKLMK-TYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFV-CPVQLKTPLGMGY-----ELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAG-DSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-----TDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEAR---------PIFQIFMVKYLCSMLVGVTSSVWLYSSKTMV 559          
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 271.166 bits (692), Expect = 1.027e-79
Identity = 163/541 (30.13%), Postives = 265/541 (48.98%), Query Frame = 1
Query:  166 YKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKG--KICLTPDSFDLDEQTGKTKSKAENIKELYNQLETLMQGNKIN---KTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICSANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACR---------SFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRA--LYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTV 1740
            + +C PIT  +C++I Y  T MPNLIG   Q EA   +  F PL+ I CS+ L+LFLCS+Y P+C     +  + I PC+ LC   +  CE  MK +    WPE L+C K P  G   +C+  ++                +    +Q         I      +L      G+         ++ +G      C   C A + F   ++     W+  W+ +C  SCL T++ F  +++RF YPE+ IVFL++CY    C  + G   G  +V+CR            + +  +    R+TT C + F+ +YF   ++  WW  L   WFL+A   WG+EAIE+ S + HL++WA+PAL++I +L L K++ D L+G CFVG  +T++L  F+I+P  IYL  G +FL  G++SL ++R          D     +LE+LM +IG FS L+I+P V  +     + Y  + + +         FS  C   +      +R         P  ++ M++   ++++G+TS +W++ +   V
Sbjct:   50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESARV-CEKLMK-TYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGY---------ELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAG-DSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-----TDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEAR---------PIFQIFMVKYLCSMLVGVTSSVWLYSSKTMV 559          
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 237.269 bits (604), Expect = 7.274e-67
Identity = 126/328 (38.41%), Postives = 184/328 (56.10%), Query Frame = 1
Query:  763 FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            FS  +K FA +W+  WS +CF S L+T+  F  +T RF YPE+PIVFLS CYF  A G L    L  + +AC         + ++      C + FL+ YFFG +S++WWV+L+ TWFL+A   WG EAI   S   HL +W +P ++S+ +L+L  +D D + G C+VGN N + L  FV+ P  +YLV G  FL  G+VSL ++R    Q+          +LEKLM +IG+FS+LY +P    +  ++   Y+  YF+  ++AL   +  C  +KG                P   + ML+ FM L +GITSG+WIW + KT+ S
Sbjct:  309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYL---YEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIW-SGKTLES 612          

HSP 2 Score: 87.8113 bits (216), Expect = 1.560e-17
Identity = 45/141 (31.91%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  133 GFVSAKLSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQT 555
            G+    +  D   +C  IT P+C+ I Y  T  PN +   +Q EA   +  F+PL+ I+CS  LK FLCS+Y P+C  +     + +  C+ +C   +  C P M++     WPE + CE LP  G     PD+  +++ +
Sbjct:   50 GYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLED---YHKPLPVCRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGD----PDNLCMEQPS 182          
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 237.269 bits (604), Expect = 7.274e-67
Identity = 126/328 (38.41%), Postives = 184/328 (56.10%), Query Frame = 1
Query:  763 FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            FS  +K FA +W+  WS +CF S L+T+  F  +T RF YPE+PIVFLS CYF  A G L    L  + +AC         + ++      C + FL+ YFFG +S++WWV+L+ TWFL+A   WG EAI   S   HL +W +P ++S+ +L+L  +D D + G C+VGN N + L  FV+ P  +YLV G  FL  G+VSL ++R    Q+          +LEKLM +IG+FS+LY +P    +  ++   Y+  YF+  ++AL   +  C  +KG                P   + ML+ FM L +GITSG+WIW + KT+ S
Sbjct:  309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYL---YEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIW-SGKTLES 612          

HSP 2 Score: 87.8113 bits (216), Expect = 1.560e-17
Identity = 45/141 (31.91%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  133 GFVSAKLSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQT 555
            G+    +  D   +C  IT P+C+ I Y  T  PN +   +Q EA   +  F+PL+ I+CS  LK FLCS+Y P+C  +     + +  C+ +C   +  C P M++     WPE + CE LP  G     PD+  +++ +
Sbjct:   50 GYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLED---YHKPLPVCRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGD----PDNLCMEQPS 182          
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 237.269 bits (604), Expect = 7.274e-67
Identity = 126/328 (38.41%), Postives = 184/328 (56.10%), Query Frame = 1
Query:  763 FSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPALKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFLSLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCTVVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLPSVELRMLRIFMNLVIGITSGIWIWGNTKTVRS 1746
            FS  +K FA +W+  WS +CF S L+T+  F  +T RF YPE+PIVFLS CYF  A G L    L  + +AC         + ++      C + FL+ YFFG +S++WWV+L+ TWFL+A   WG EAI   S   HL +W +P ++S+ +L+L  +D D + G C+VGN N + L  FV+ P  +YLV G  FL  G+VSL ++R    Q+          +LEKLM +IG+FS+LY +P    +  ++   Y+  YF+  ++AL   +  C  +KG                P   + ML+ FM L +GITSG+WIW + KT+ S
Sbjct:  309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYL---YEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIW-SGKTLES 612          

HSP 2 Score: 87.8113 bits (216), Expect = 1.560e-17
Identity = 45/141 (31.91%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  133 GFVSAKLSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLINIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMKESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQT 555
            G+    +  D   +C  IT P+C+ I Y  T  PN +   +Q EA   +  F+PL+ I+CS  LK FLCS+Y P+C  +     + +  C+ +C   +  C P M++     WPE + CE LP  G     PD+  +++ +
Sbjct:   50 GYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLED---YHKPLPVCRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGD----PDNLCMEQPS 182          
The following BLAST results are available for this feature:
BLAST of frizzled-like vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17433091|sp|Q9ULW2|FZD10_HUMAN1.512e-11836.91RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz1... [more]
gi|52782829|sp|Q8BKG4|FZD10_MOUSE4.420e-11736.09RecName: Full=Frizzled-10; Short=Fz-10; AltName: C... [more]
gi|17433077|sp|Q9PWH2|FZD10_CHICK6.901e-11736.83RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-... [more]
gi|17433043|sp|Q9DEB5|FZ10A_XENLA3.190e-11636.12RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=X... [more]
gi|17433096|sp|Q9W742|FZ10B_XENLA9.603e-11535.95RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=X... [more]
back to top
BLAST of frizzled-like vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150297110.000e+070.50SmedSxlregen_c141340_g1_i1|m.45153|m.4173[more]
SMU150053871.396e-12034.30SmedAsxldir_c106380_g2_i1|m.75515|m.16659[more]
SMU150400877.871e-9334.40dd_smedV4_7210_0_1|m.35691|m.13357[more]
SMU150361992.864e-9032.81SmedSxlregen_c90692_g1_i1|m.42870|m.18187[more]
SMU150145341.209e-8931.70SmedAsxldir_c94917_g1_i1|m.35515|m.3335[more]
back to top
BLAST of frizzled-like vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|6005762|ref|NP_009128.1|5.707e-11936.91frizzled-10 precursor [Homo sapiens][more]
gi|4503835|ref|NP_003499.1|2.414e-11038.40frizzled-9 precursor [Homo sapiens][more]
gi|22547161|ref|NP_036325.2|3.802e-10736.35frizzled-4 precursor [Homo sapiens][more]
gi|4503833|ref|NP_003498.1|9.239e-9934.01frizzled-7 precursor [Homo sapiens][more]
gi|4503825|ref|NP_003496.1|7.701e-9734.43frizzled-1 [Homo sapiens][more]
back to top
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17864440|ref|NP_524812.1|5.956e-8030.48frizzled, isoform A [Drosophila melanogaster][more]
gi|442632294|ref|NP_001261836.1|1.027e-7930.13frizzled, isoform C [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|7.274e-6738.41frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|7.274e-6738.41frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|7.274e-6738.41frizzled 2, isoform C [Drosophila melanogaster][more]
back to top
Secuencias
The following sequences are available for this feature:

mRNA sequence

>Ddo_014376 ID=Ddo_014376|Name=frizzled-like|organism=Dugesia dorotocephala|type=mRNA|length=2288bp
GGCGTTTTACAAACACAAAAACGATTCTCGGTTTTCATTTTTACTAAATA
TTTTTTTGGATATTATTTTTTTGCCGTGACAATTATTATGAAATCGATTA
TTTTGATTGTAATTGGTATTAATTTATTGTTTGGATTCGTTTCGGCGAAA
TTGTCAGTCGACATTTACAAACAATGTTCTCCGATTACCGAGCCCGTCTG
CCAGGACATTCGCTATACGCAAACGAGAATGCCGAATCTGATTGGGATTT
ACTCCCAGACGGAAGCGAGCAAAAGGATCCGAGACTTTTTCCCGTTGATT
AATATCCGGTGTAGTAATTACCTGAAACTTTTCCTTTGTTCGGTTTATTT
TCCGATGTGCGACTCGGAATCGGTGATGAATTCCCAAATAATTAAACCCT
GCAAACGTTTATGTACTCACGTCAAACAACGTTGTGAACCCTTTATGAAA
GAATCACTTCAGTTGACATGGCCAGAAGAATTAGACTGTGAGAAATTACC
GGAAAAAGGAAAGATCTGTCTCACGCCGGATTCGTTTGATCTCGATGAAC
AAACTGGAAAAACAAAATCCAAAGCGGAAAACATTAAAGAGTTATACAAT
CAACTGGAGACCTTAATGCAAGGTAACAAAATCAATAAAACGAAACTTGA
TATCTTCCAGAAAGCTGGTTGGTTGATGGGGTCGAAATGTTTACCGTCAC
AAATCAACATCGGTCAACCGGCAAACGTTTCCTGTGCCCAAATCTGTTCG
GCAAACGTTCAGTTCAGCGGTAGCGATAAAGCGTTCGCCAACATCTGGCT
GATGGGTTGGTCGGTAATTTGTTTTTTTTCCTGTTTACTAACGATTATTG
TGTTTTCGTGCAACACGAACCGATTTCTCTATCCGGAAAAACCGATTGTA
TTTTTATCGATTTGCTATTTTTTCTACGCTTGCGGTAATTTATTGGGAGC
GATTTTAGGCCGAAAAAACGTTGCTTGTCGATCGTTCAATGAACAGTTGG
ATTTCATGGTCGACAATGGCCGTGAAACGACTTGGTGTAAAATTAATTTT
TTAATGGTTTACTTTTTCGGTTCCTCAAGTGCTTTATGGTGGGTGGTGTT
AACGATCACTTGGTTTCTTTCCGCGTCCCGACATTGGGGCTATGAAGCCA
TTGAATCTATTAGTAGTATGTTACACTTGTTAAGTTGGGCATTGCCGGCT
TTGAAATCTATTTTCATACTTATTCTTCATAAAATCGATGCGGATGAGTT
AACCGGTCAATGTTTCGTCGGTAATAGTAATACAAACGCATTATGGATAT
TCGTAATTGTACCCCATATCATTTACCTGGTAACAGGTGTTGTCTTTTTG
TCGTTAGGTTACGTTTCCCTTTTAAAGGTCCGTAGATCGTTTTTACAAAG
GCCCGACTGTAATGATACTAATAATTTAAAGCGCCTAGAAAAGTTAATGG
CTAAAATTGGAGTGTTTTCAATTCTTTATATTATACCGGTAGTCTGCACT
GTTGTTAGCCATATAACTGATGCATATAAGATGAATTATTTTGATGTTGC
CGTCAGAGCTCTCTATCAGTTTTCCCCAAATTGTCTAACAATGAAAGGGG
TTGCGTGGTCGATGAGTAGATGTGTCGATATTTTACAGCCGATGTTGCCA
TCAGTAGAACTAAGAATGTTGAGAATATTTATGAATCTCGTCATTGGTAT
TACATCCGGTATTTGGATATGGGGTAATACGAAAACGGTGAGATCATGTA
TCAATGGGATAAAGTGTTGGAGACTCAACAAAGAGATACAACTCAGTCAA
ATCAACCAATGTGACTCAGTAACAACACCAAACAATTTTCCTTTATCGCA
AGTCAATCACAAAGAATCTCTTTTGCCTTATCCGGACTGGAAGTTCAACT
CTCCATATCCAAACATCGAATTCGCCCTGCCAAGCATTTCAGTCCCCAGT
GAAGTAGTATTCCCCCCTCCCAATAACTCGTCAATTAGTGATGCATCAAG
CAAACATTAAGCCATCAAGCAGCCAAATTTTCAGAACAAAAAAGAAAGAA
AAAAATAATAGAAATAATTGATAATTATTTACTGAATCCATTTTTTTATA
CTGCATCTCTCTTTCGTGTTGTTAGATAAAAGCAAATCAGAAAAAAAACA
TCCGTAACATTTAATCAAAAAAGACCAAATTTTTTTTTGTCAAAGATCAA
TTGGAAAACATATTGGAAAAACGAAAATTCTTGTGATATATTCTCCTTTA
TTTTTTTGTTTTCTTTCGTTTTTCTTTCTTTTGTGAGA

Design Primers for frizzled-like

back to top

protein sequence

>Ddo_014376-protein ID=Ddo_014376-protein|Name=frizzled-like|organism=Dugesia dorotocephala|type=polypeptide|length=670bp
GVLQTQKRFSVFIFTKYFFGYYFFAVTIIMKSIILIVIGINLLFGFVSAK
LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLI
NIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMK
ESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYN
QLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICS
ANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIV
FLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINF
LMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPA
LKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFL
SLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCT
VVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLP
SVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQ
INQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYPNIEFALPSISVPS
EVVFPPPNNSSISDASSKH*
back to top

coding sequence

>Ddo_014376.1.2010 ID=Ddo_014376.1.2010|Name=Ddo_014376.1.2010|organism=Dugesia dorotocephala|type=CDS|length=2010bp
GGCGTTTTACAAACACAAAAACGATTCTCGGTTTTCATTTTTACTAAATA
TTTTTTTGGATATTATTTTTTTGCCGTGACAATTATTATGAAATCGATTA
TTTTGATTGTAATTGGTATTAATTTATTGTTTGGATTCGTTTCGGCGAAA
TTGTCAGTCGACATTTACAAACAATGTTCTCCGATTACCGAGCCCGTCTG
CCAGGACATTCGCTATACGCAAACGAGAATGCCGAATCTGATTGGGATTT
ACTCCCAGACGGAAGCGAGCAAAAGGATCCGAGACTTTTTCCCGTTGATT
AATATCCGGTGTAGTAATTACCTGAAACTTTTCCTTTGTTCGGTTTATTT
TCCGATGTGCGACTCGGAATCGGTGATGAATTCCCAAATAATTAAACCCT
GCAAACGTTTATGTACTCACGTCAAACAACGTTGTGAACCCTTTATGAAA
GAATCACTTCAGTTGACATGGCCAGAAGAATTAGACTGTGAGAAATTACC
GGAAAAAGGAAAGATCTGTCTCACGCCGGATTCGTTTGATCTCGATGAAC
AAACTGGAAAAACAAAATCCAAAGCGGAAAACATTAAAGAGTTATACAAT
CAACTGGAGACCTTAATGCAAGGTAACAAAATCAATAAAACGAAACTTGA
TATCTTCCAGAAAGCTGGTTGGTTGATGGGGTCGAAATGTTTACCGTCAC
AAATCAACATCGGTCAACCGGCAAACGTTTCCTGTGCCCAAATCTGTTCG
GCAAACGTTCAGTTCAGCGGTAGCGATAAAGCGTTCGCCAACATCTGGCT
GATGGGTTGGTCGGTAATTTGTTTTTTTTCCTGTTTACTAACGATTATTG
TGTTTTCGTGCAACACGAACCGATTTCTCTATCCGGAAAAACCGATTGTA
TTTTTATCGATTTGCTATTTTTTCTACGCTTGCGGTAATTTATTGGGAGC
GATTTTAGGCCGAAAAAACGTTGCTTGTCGATCGTTCAATGAACAGTTGG
ATTTCATGGTCGACAATGGCCGTGAAACGACTTGGTGTAAAATTAATTTT
TTAATGGTTTACTTTTTCGGTTCCTCAAGTGCTTTATGGTGGGTGGTGTT
AACGATCACTTGGTTTCTTTCCGCGTCCCGACATTGGGGCTATGAAGCCA
TTGAATCTATTAGTAGTATGTTACACTTGTTAAGTTGGGCATTGCCGGCT
TTGAAATCTATTTTCATACTTATTCTTCATAAAATCGATGCGGATGAGTT
AACCGGTCAATGTTTCGTCGGTAATAGTAATACAAACGCATTATGGATAT
TCGTAATTGTACCCCATATCATTTACCTGGTAACAGGTGTTGTCTTTTTG
TCGTTAGGTTACGTTTCCCTTTTAAAGGTCCGTAGATCGTTTTTACAAAG
GCCCGACTGTAATGATACTAATAATTTAAAGCGCCTAGAAAAGTTAATGG
CTAAAATTGGAGTGTTTTCAATTCTTTATATTATACCGGTAGTCTGCACT
GTTGTTAGCCATATAACTGATGCATATAAGATGAATTATTTTGATGTTGC
CGTCAGAGCTCTCTATCAGTTTTCCCCAAATTGTCTAACAATGAAAGGGG
TTGCGTGGTCGATGAGTAGATGTGTCGATATTTTACAGCCGATGTTGCCA
TCAGTAGAACTAAGAATGTTGAGAATATTTATGAATCTCGTCATTGGTAT
TACATCCGGTATTTGGATATGGGGTAATACGAAAACGGTGAGATCATGTA
TCAATGGGATAAAGTGTTGGAGACTCAACAAAGAGATACAACTCAGTCAA
ATCAACCAATGTGACTCAGTAACAACACCAAACAATTTTCCTTTATCGCA
AGTCAATCACAAAGAATCTCTTTTGCCTTATCCGGACTGGAAGTTCAACT
CTCCATATCCAAACATCGAATTCGCCCTGCCAAGCATTTCAGTCCCCAGT
GAAGTAGTATTCCCCCCTCCCAATAACTCGTCAATTAGTGATGCATCAAG
CAAACATTAA
back to top
Grupos De Genes
frizzled-like is similar in sequence to the genes of this group: GG4852
Gene NameGene ID
SMU15029711SMU15029711
frizzled-likeDdo_014376
frizzled-likeGsp_021429
Pgr_015739Pgr_015739
frizzled-likePgr_020264
frizzled-likePmo_014048

Gene Group Protein Sequences

>SMU15029711

MCINLYLYIYKTIIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQC
VPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLK
LFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSE
ELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGN
RIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHD
KVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFY
ASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSA
SALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILIL
HKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLK
VRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAY
KMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRI
FMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTI
QNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIVPPPNN
SSISDDSSRH*
>Ddo_014376 frizzled-like
GVLQTQKRFSVFIFTKYFFGYYFFAVTIIMKSIILIVIGINLLFGFVSAK
LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLI
NIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMK
ESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYN
QLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICS
ANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIV
FLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINF
LMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPA
LKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFL
SLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCT
VVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLP
SVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQ
INQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYPNIEFALPSISVPS
EVVFPPPNNSSISDASSKH*
>Gsp_021429 frizzled-like
MMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPN
SVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQ
IVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESF
SLDDLDQQNQSQGDDVQQLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQ
CLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCF
LTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSY
DDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHW
GYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQN
VLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRL
EKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCV
TKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKT
LKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY
NNWKLNSSYPANEFGLATVSVPSEIIPPPNNSSISDLSSKH*
>Pgr_015739 Pgr_015739
MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRM
PNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTS
PPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPE
SFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSE
TKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLS
SLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR
PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASR
HWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNH
LPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLK
RLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPD
CVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK
KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQN
WTYCPSVLSEPTVCGIVNEPCEGIVAPNNSSKSETSSRH*
>Pgr_020264 frizzled-like
KVGIKMRQMFFLWSGILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRY
THTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDA
EAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKM
CLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKA
GSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSL
LCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRR
NVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWF
LSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCF
VGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCID
PSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALY
EYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIW
IWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSPT
QGWNYAPVSESQSTRGVTSQTPIEGIVAPHNSSISEASSRH*
>Pmo_014048 frizzled-like
KLSVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTR
MPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAI
STPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTP
DSFSLDKEVEKEPSHVDTMKNLLQKLELSLKQSDKDKSRIDLLMKAGLYA
SAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANIWLISWSLLCLV
SSLLTIITFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVIC
RPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSAS
RHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNS
DKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNL
KRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSA
DCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGN
KKSFRYCGRNKKDIQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGWSYVP
TLASEHAVGGLSQTPVEGIMAPNNSSISEVSSKH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.