Pmo_032051, Pmo_032051 (mRNA) Phagocata morgani

Overview
NamePmo_032051
Unique NamePmo_032051
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1428
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_032051 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 231.491 bits (589), Expect = 4.750e-69
Identity = 138/396 (34.85%), Postives = 230/396 (58.08%), Query Frame = 1
Query:   76 KMVLSEFLTHVTSYKWVNFVGMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQD 1257
             M+L  F + V S   + F   +D  DKL++  +T+++ +  I+++ K Y+   I C++P   + +  + + ++YCWV  T  +P++  +P    ER       N +I YYQWVPFVLAL+ +LFY+P I+W+++++  SG  ++ LV+MA  +     E++ + +  IA N+E       ++    R       K  +     + SG  +   Y+ +K+LY VN+ GQ+FL+  FL  G++ K++G  +LN+++NGREW ++  FPRVT C   +V+ +G  + +  QC L INM NEK+++FLWFW  ++A  T+ SL  WI+   V +R++ F+ K+L   E Y+  DS  L  F   FLR+DGVF++RM+A +AG+L    +   LW  Y D
Sbjct:    2 SMLLYYFASAVKS---IQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAER------ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRL------KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCD 377          
BLAST of Pmo_032051 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 220.32 bits (560), Expect = 2.409e-63
Identity = 132/389 (33.93%), Postives = 222/389 (57.07%), Query Frame = 1
Query:  142 EDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFC-------AGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKE---DSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQ--DKYP 1266
            +DF DKL++  +T++L    ++++ K Y+   I C++P   +    + + ++YCWV  T  +PM   +P     R      RN +I YYQWVPF+LA++ +LFY+P I+W+ + Y  SG +L+GLV+MA  A     E K +TV  +A+++++      E+     T + +   ++S F         G+  G  + + Y+ IKVLY  NV  Q FL+   L  G  D  +G+ +L ++++  EW  T +FPRVT C   +V+ +G  + +  QC L INM NEK+++FLWFW +   I TV +   WI  + + ++ + F++K+LRV   +  +   D   L  F   FLRKDGVF++RM++ +AG+L++S ++  LW+ +   D+ P
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYSR------RNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQD------EVQL---TNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRSP 508          
BLAST of Pmo_032051 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 189.119 bits (479), Expect = 1.557e-52
Identity = 128/416 (30.77%), Postives = 227/416 (54.57%), Query Frame = 1
Query:  136 GMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTG----ETKAKTVTQIAQN-LENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVRE--------KYEKEDSPR------------LNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGKYDEPKD 1302
            G +D  D+L++  +  +L +  +VI+ K Y  T I C++    S +  +++++SYCW+  T  IPM  ++P   D  + EE     +I YYQWVPF+L  + ++F LP I W++ ++  SG +++ L+   N+AC+         + K V  I  N ++N+           R ++ +   ++        SG+ + + Y F K+LY VNV  Q F++   L+   +  +FG+ +L++I  GR W +T  FPRVT C   +V+++   N Y  QCAL IN++NEKV+ FLW W +I+AI T  S   WI    + + ++ ++ KF+++ E        K+EK+ +              L++F   FL+ DG+ ++RM++ +AGD+I   +V  LW+ Y+++  +  F +++E KD
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRF------LSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWR-EFEEHEEMKD 414          
BLAST of Pmo_032051 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 185.652 bits (470), Expect = 3.317e-51
Identity = 126/415 (30.36%), Postives = 222/415 (53.49%), Query Frame = 1
Query:  136 GMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGK----RSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVRE--------KYEKEDSPR------------LNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGKYDEPKD 1302
            G +D  D+L++  +  +L +  +VI+ K Y  T I C++    S +  +++++SYCW+  T  IPM  ++P   D  + EE     +I YYQWVPF+L  + ++F LP I W++ ++  SG +++ L+   N+AC+      A    +  + +   F  + ++            +A+ W    K     SG+ L + + F K+LY +NV  Q  ++   L+      +FG+ +LN+I  GR W +T  FPRVT C   +V+++   N Y  QCAL IN++NEKV+ FLW W +I+AI T  S   WI    + + ++ ++ KF+++ E        K+EK+ +              L+ F   FL+ DGV ++RM++ +AGD+I   +V  LW+ ++++  +  F +++E KD
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWR-EFEEHEEMKD 430          
BLAST of Pmo_032051 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 182.956 bits (463), Expect = 1.536e-50
Identity = 116/374 (31.02%), Postives = 202/374 (54.01%), Query Frame = 1
Query:  142 EDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQD 1257
            +D  D+LS+  + +LL   +I+++ K Y+ ++I C++P++  G  ++ + + YC++  T  IP  S +P   ++R   E      I YYQWVP VLA+Q  +FYLP  IW  + Y   G D   ++  A +  +Q  ET+ K V ++   + +I    R  N + R +  +          GK  G    + Y+ IK++Y+ NVF Q  ++ +FL  G++   +G+    ++  GREW D+ +FPRVT C  + V+ +   + Y  QC L INM NEK+Y+F+WFW V V I T I+    I+R++  +    +++  L       K++   + +F    L++DGV ++R +  +AG ++T  I  EL+K + +
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE------IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT-RSKNEYGRFYCYRF---------GKGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGE 373          
BLAST of Pmo_032051 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 295/426 (69.25%), Postives = 350/426 (82.16%), Query Frame = 1
Query:   79 MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGKYDEPKDCG--SDSSTLPMKDEFL* 1350
            MVLSEF+ + T YKW +FVGMEDFADKLSF++STS+LLL+T+VITVKSYLLTSIACYIPI PSGKDFDDFLKSYCWVHGTIP+  +LP   D  SWE++D  +RINYYQWVPFVLALQGILFYLPRIIWQ+ITYNLSG DLEGLVEMANSA NQTG+ K++TV QIA NLEN+ F HR+IN H +  + K + AKSW C+ KRSG+QL  QYMFIKVLYV+N FGQLFLMQ FL FGH+   FGYV+L NI+ GREWNDT IFPRVTYCY+  +QHV ++N+YLAQC LPINMLNEK+YIFLWFWTVIV  FT ISL QWI+R+  S+ ++ FLKKFLR+RE+Y  ED   L +F  GFLRKDGVFI+RM ++NAGDLIT++IVT LW  Y++K+ + NF K   P D    SD+STLP+KD+F+*
Sbjct:    1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP--PDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI* 424          
BLAST of Pmo_032051 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 388.652 bits (997), Expect = 3.211e-130
Identity = 193/404 (47.77%), Postives = 271/404 (67.08%), Query Frame = 1
Query:   79 MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA-GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGKY 1287
            MV  EFL  +  +K   +VG+EDFADKLSF  S +LL+L  +V+T+KSYL   +ACY    P G +F+++L++YCWVHGTI        P+++  W   D   RINYYQWVPF+L LQ I+FY+P+IIWQII YN SG +LE +V  AN+A N     +   + +IA+ +E++ F HR+        + +       FC   K  G  LI+ Y+ IK LY +NV GQLF+M++FL F +    FGY +L+N+I+G+EW+ T IFPRVTYCYV  ++HVG+ N Y+AQCALP+NMLNEK+Y+FLWFW V+V I T IS+  W +R+A  +R   F+K+FL + + YE+ D P +N F E FLR DGVF++RML +NAGD+IT++IV  L + Y++ Y  ++F  Y
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNY 404          
BLAST of Pmo_032051 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 379.022 bits (972), Expect = 1.047e-126
Identity = 186/404 (46.04%), Postives = 277/404 (68.56%), Query Frame = 1
Query:   85 LSEFLTHVTSYKWVNFVGMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPM--NSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFG--HQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGK 1284
            +  FL+  T+++   +VG+ED ADK SF  S  +L++ +++++ K Y+   I+CYIP+  SG D D ++K+YCWVHGTIP   N +LP  KDE  W   D + +INYYQWVPFVL LQG+LFYLPR+IW+ I YNLSG DLEGLV  A  A NQ GE + +T+ Q+A+ LE++F   R +  H +  V++  +  S  C G+R+G   I  Y+ IK+LY+ N   Q+ LMQ FL++G    +  FG+ IL +I++G++WND  +FPRV++C+++ +  V  +N ++AQCALPINMLNEK+YIFLWFWTV V   T+IS+  W++R+    +   F+K+FL+++  Y K+    ++ F E FLR DG+FI+ ++++NAGDLI ++IV+ELW+ Y   Y K++F K
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDE--WIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Pmo_032051 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 370.933 bits (951), Expect = 1.395e-123
Identity = 177/387 (45.74%), Postives = 268/387 (69.25%), Query Frame = 1
Query:  130 FVGMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFG--HQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGK 1284
            +VG+ED ADK SF  S  +L++ T++++ K Y+   IACYIPI  +G+  +D++++YCW HGTIP   +   P++ + W + D + R+NYYQWVPFVL LQG+LFYLPR+IW+ I YNLSG DLEGLV  A  A NQ GE + +T+ Q+A+ LE++F   R +  H +  V++  +  S  C G+R+G   I  Y+ IK+LY+ N   Q+ LMQ FL++G    +  FG+ IL +I++G++WND  +FPRV++C+++ +  V  +N ++AQCALPINMLNEK+YIFLWFWTV V   T+IS+  W++R+    +   F+K+FL+++  Y K+    ++ F E FLR DG+FI+ ++++NAGDLI ++IV+ELW+ Y   Y K++F K
Sbjct:   16 YVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Pmo_032051 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 349.362 bits (895), Expect = 6.626e-115
Identity = 166/408 (40.69%), Postives = 262/408 (64.22%), Query Frame = 1
Query:   79 MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNXXXXXXXXXXXXXXXXXYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA----GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNFGKYD 1290
            MV  EFL+ +  +K  ++ G+EDFAD+L+F  S  +L L  +++T K+Y    ++CY+   PSG +FD ++++YCWVHGTIP   +   P     W   D + RI YYQWVPF+L LQ ILFY+P+++W+II YN  G +LE L+  A  +       +   +  I + +E++ + HR+   +++  + KA +    +C      K  G  L+  Y FIK LY +NV GQL+LM+ FL F      FGY ILN+II+G+ W++T+ FPRV+YCY   ++H+G  N Y+AQC LP+NMLNEK+YIFLWFW ++V I T++S+ QW+ R+   ++   F KK L++ + Y++ ++  +N F + +LR DG+F+IRM+ +N+GD++ + I+  LW+TY++KY   +F  Y+
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRD---YRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYN 405          
BLAST of Pmo_032051 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 95.1301 bits (235), Expect = 5.009e-21
Identity = 99/360 (27.50%), Postives = 153/360 (42.50%), Query Frame = 1
Query:  223 YLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSL----------PWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLV-----EMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWND--TQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVA-VSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGV---FIIRMLAMNAGDLITSNIVTEL 1239
            Y+   I C +   P G      + +YCW++ T  +   L          P        E+  + H+  YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV      + N  C    + K   V     NL      +R   +  R FV +A                          L  VNV GQ++ +  FL  G    Y   V+    +   E  D   ++FP+VT C  +K    G    +   C LP+N++NEK+Y+FLWFW +I++I + ISL   I+R+A V+  ++  L   LR R +  + +   L A       K  +   F++  L  N   LI   ++++L
Sbjct:   47 YIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHK--YYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKN--DRKKILVDYFIGNL------NRHNFYAFRFFVCEA--------------------------LNFVNVIGQIYFVDFFLD-GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPKLRHL--LLRARSRLAESEEVELVA------NKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Pmo_032051 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 95.1301 bits (235), Expect = 5.009e-21
Identity = 99/360 (27.50%), Postives = 153/360 (42.50%), Query Frame = 1
Query:  223 YLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSL----------PWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLV-----EMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWND--TQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVA-VSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGV---FIIRMLAMNAGDLITSNIVTEL 1239
            Y+   I C +   P G      + +YCW++ T  +   L          P        E+  + H+  YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV      + N  C    + K   V     NL      +R   +  R FV +A                          L  VNV GQ++ +  FL  G    Y   V+    +   E  D   ++FP+VT C  +K    G    +   C LP+N++NEK+Y+FLWFW +I++I + ISL   I+R+A V+  ++  L   LR R +  + +   L A       K  +   F++  L  N   LI   ++++L
Sbjct:   47 YIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHK--YYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKN--DRKKILVDYFIGNL------NRHNFYAFRFFVCEA--------------------------LNFVNVIGQIYFVDFFLD-GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPKLRHL--LLRARSRLAESEEVELVA------NKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Pmo_032051 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 95.1301 bits (235), Expect = 5.009e-21
Identity = 99/360 (27.50%), Postives = 153/360 (42.50%), Query Frame = 1
Query:  223 YLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSL----------PWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLV-----EMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWND--TQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVA-VSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGV---FIIRMLAMNAGDLITSNIVTEL 1239
            Y+   I C +   P G      + +YCW++ T  +   L          P        E+  + H+  YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV      + N  C    + K   V     NL      +R   +  R FV +A                          L  VNV GQ++ +  FL  G    Y   V+    +   E  D   ++FP+VT C  +K    G    +   C LP+N++NEK+Y+FLWFW +I++I + ISL   I+R+A V+  ++  L   LR R +  + +   L A       K  +   F++  L  N   LI   ++++L
Sbjct:   47 YIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHK--YYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKN--DRKKILVDYFIGNL------NRHNFYAFRFFVCEA--------------------------LNFVNVIGQIYFVDFFLD-GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPKLRHL--LLRARSRLAESEEVELVA------NKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Pmo_032051 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 95.1301 bits (235), Expect = 5.009e-21
Identity = 99/360 (27.50%), Postives = 153/360 (42.50%), Query Frame = 1
Query:  223 YLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSL----------PWPKDERSWEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLV-----EMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWND--TQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVIVAIFTVISLCQWIFRVA-VSNREIGFLKKFLRVREKYEKEDSPRLNAFCEGFLRKDGV---FIIRMLAMNAGDLITSNIVTEL 1239
            Y+   I C +   P G      + +YCW++ T  +   L          P        E+  + H+  YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV      + N  C    + K   V     NL      +R   +  R FV +A                          L  VNV GQ++ +  FL  G    Y   V+    +   E  D   ++FP+VT C  +K    G    +   C LP+N++NEK+Y+FLWFW +I++I + ISL   I+R+A V+  ++  L   LR R +  + +   L A       K  +   F++  L  N   LI   ++++L
Sbjct:   47 YIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHK--YYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKN--DRKKILVDYFIGNL------NRHNFYAFRFFVCEA--------------------------LNFVNVIGQIYFVDFFLD-GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPKLRHL--LLRARSRLAESEEVELVA------NKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Pmo_032051 vs. RefSeq Drosophila melanogaster
Match: gi|24643568|ref|NP_728361.1| (shaking B, isoform A [Drosophila melanogaster])

HSP 1 Score: 92.0485 bits (227), Expect = 5.089e-20
Identity = 74/250 (29.60%), Postives = 111/250 (44.40%), Query Frame = 1
Query:  280 DDFLKSYCWVHGTIPMNS--------SLPWPKDERS-WEELDRNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANSACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCAGKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNNIINGREWNDTQ---IFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYIFLWFW 993
            +D L +YCW+  T  + S        S+P+P    S  +  D+ H   YYQWV F L  Q ILFY PR +W+    +  G  +  L+   +       E K K    +    EN+                   +  +W+            +Y   ++L ++NV GQ+FLM RF  F  +   FG  +++ +   +E        IFPR+T C   K    G    + A C LP+N++NEK+YIFLWFW
Sbjct:   62 EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKH-YKYYQWVCFCLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 275          
The following BLAST results are available for this feature:
BLAST of Pmo_032051 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL4.750e-6934.85RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL2.409e-6333.93RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.557e-5230.77RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL3.317e-5130.36RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|12643734|sp|Q19746|INX3_CAEEL1.536e-5031.02RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of Pmo_032051 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150009180.000e+069.25Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150008373.211e-13047.77Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150036481.047e-12646.04SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150036491.395e-12345.74SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150006576.626e-11540.69Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Pmo_032051 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pmo_032051 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|5.009e-2127.50innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|5.009e-2127.50innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|5.009e-2127.50innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|5.009e-2127.50innexin 2, isoform D [Drosophila melanogaster][more]
gi|24643568|ref|NP_728361.1|5.089e-2029.60shaking B, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_032051 ID=Pmo_032051|Name=Pmo_032051|organism=Phagocata morgani|type=mRNA|length=1428bp
ATTCAAGCCAGTTGTTGTGTTGGTGTTATATCGTCATCGGGAATCAGTTT
CATTTGCCTATTGTAAATCGTAACAAAGATGGTGCTTAGCGAATTTCTTA
CACATGTAACCAGTTACAAATGGGTGAACTTTGTTGGGATGGAAGATTTC
GCTGACAAGCTCAGTTTCAACGTATCTACATCACTGTTGCTATTGATTAC
GATTGTAATCACGGTCAAGAGTTACTTGCTGACATCGATAGCTTGTTATA
TTCCAATACAACCGTCCGGGAAAGACTTTGACGATTTCTTGAAGAGCTAT
TGTTGGGTGCACGGCACAATTCCTATGAACAGTTCGTTACCATGGCCAAA
GGACGAAAGATCGTGGGAAGAATTAGACAGGAATCACAGAATAAATTATT
ATCAATGGGTACCCTTTGTTTTGGCTCTACAGGGAATCTTGTTTTACTTA
CCACGAATAATCTGGCAAATCATCACGTACAATTTATCGGGAGCCGACCT
CGAGGGTCTCGTCGAGATGGCCAACTCTGCCTGCAATCAAACAGGGGAAA
CTAAAGCGAAAACCGTCACTCAAATTGCACAAAATCTTGAGAATATTTTC
TTCTGTCACCGTGAAATCAACTTCCATAAACGCACTTTCGTCGTCAAGGC
TGCCAAAGCCAAAAGTTGGTTCTGTGCCGGCAAACGAAGCGGGAAGCAGC
TGATCGTTCAATACATGTTCATCAAGGTCCTGTATGTGGTCAATGTATTC
GGTCAGCTCTTCCTTATGCAACGGTTTCTACAATTCGGACATCAAGACAA
ATATTTCGGTTACGTCATTCTCAACAATATTATCAACGGTCGTGAGTGGA
ACGATACTCAAATATTCCCCCGCGTCACGTACTGCTACGTGAACAAGGTG
CAGCATGTCGGCATGCAGAACGACTACTTAGCACAATGCGCCCTGCCAAT
CAACATGCTCAACGAGAAGGTCTACATCTTCCTCTGGTTCTGGACGGTGA
TTGTCGCCATATTTACAGTGATCAGCCTGTGCCAGTGGATATTCCGAGTT
GCGGTGTCGAATCGCGAGATCGGGTTCTTGAAAAAGTTTCTCCGGGTTCG
AGAAAAATATGAAAAGGAAGACTCGCCTCGTCTGAACGCTTTCTGTGAAG
GATTTTTGAGAAAAGACGGCGTCTTCATTATTCGCATGCTGGCGATGAAT
GCCGGCGATTTGATTACGAGTAACATTGTCACGGAACTGTGGAAAACATA
CCAAGATAAGTATCCGAAAGTGAATTTTGGTAAATATGATGAACCGAAAG
ATTGTGGCAGCGATAGTTCGACTTTACCAATGAAAGACGAGTTTTTGTAA
TGGGTTTCGCTTCGACTTCTCTGCTTTCACATTGGAACAATGTAATATTC
CGATTATATCATATTATTTCGAAATAGA

Design Primers for Pmo_032051

back to top

protein sequence

>Pmo_032051-protein ID=Pmo_032051-protein|Name=Pmo_032051|organism=Phagocata morgani|type=polypeptide|length=424bp
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*
back to top

coding sequence

>Pmo_032051.79.1350 ID=Pmo_032051.79.1350|Name=Pmo_032051.79.1350|organism=Phagocata morgani|type=CDS|length=1272bp
ATGGTGCTTAGCGAATTTCTTACACATGTAACCAGTTACAAATGGGTGAA
CTTTGTTGGGATGGAAGATTTCGCTGACAAGCTCAGTTTCAACGTATCTA
CATCACTGTTGCTATTGATTACGATTGTAATCACGGTCAAGAGTTACTTG
CTGACATCGATAGCTTGTTATATTCCAATACAACCGTCCGGGAAAGACTT
TGACGATTTCTTGAAGAGCTATTGTTGGGTGCACGGCACAATTCCTATGA
ACAGTTCGTTACCATGGCCAAAGGACGAAAGATCGTGGGAAGAATTAGAC
AGGAATCACAGAATAAATTATTATCAATGGGTACCCTTTGTTTTGGCTCT
ACAGGGAATCTTGTTTTACTTACCACGAATAATCTGGCAAATCATCACGT
ACAATTTATCGGGAGCCGACCTCGAGGGTCTCGTCGAGATGGCCAACTCT
GCCTGCAATCAAACAGGGGAAACTAAAGCGAAAACCGTCACTCAAATTGC
ACAAAATCTTGAGAATATTTTCTTCTGTCACCGTGAAATCAACTTCCATA
AACGCACTTTCGTCGTCAAGGCTGCCAAAGCCAAAAGTTGGTTCTGTGCC
GGCAAACGAAGCGGGAAGCAGCTGATCGTTCAATACATGTTCATCAAGGT
CCTGTATGTGGTCAATGTATTCGGTCAGCTCTTCCTTATGCAACGGTTTC
TACAATTCGGACATCAAGACAAATATTTCGGTTACGTCATTCTCAACAAT
ATTATCAACGGTCGTGAGTGGAACGATACTCAAATATTCCCCCGCGTCAC
GTACTGCTACGTGAACAAGGTGCAGCATGTCGGCATGCAGAACGACTACT
TAGCACAATGCGCCCTGCCAATCAACATGCTCAACGAGAAGGTCTACATC
TTCCTCTGGTTCTGGACGGTGATTGTCGCCATATTTACAGTGATCAGCCT
GTGCCAGTGGATATTCCGAGTTGCGGTGTCGAATCGCGAGATCGGGTTCT
TGAAAAAGTTTCTCCGGGTTCGAGAAAAATATGAAAAGGAAGACTCGCCT
CGTCTGAACGCTTTCTGTGAAGGATTTTTGAGAAAAGACGGCGTCTTCAT
TATTCGCATGCTGGCGATGAATGCCGGCGATTTGATTACGAGTAACATTG
TCACGGAACTGTGGAAAACATACCAAGATAAGTATCCGAAAGTGAATTTT
GGTAAATATGATGAACCGAAAGATTGTGGCAGCGATAGTTCGACTTTACC
AATGAAAGACGAGTTTTTGTAA
back to top
Gene Groups
Pmo_032051 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.