Pmo_012872, Pmo_012872 (mRNA) Phagocata morgani

Overview
NamePmo_012872
Unique NamePmo_012872
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length4732
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_012872 vs. uniprot
Match: gi|74736013|sp|Q5BJF6|ODFP2_HUMAN (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 113.62 bits (283), Expect = 4.757e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2260
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          

HSP 2 Score: 113.62 bits (283), Expect = 4.757e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = -2
Query: 2473 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 3297
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          

HSP 3 Score: 77.0258 bits (188), Expect = 1.014e-12
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          

HSP 4 Score: 77.0258 bits (188), Expect = 1.014e-12
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = -2
Query: 3496 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4476
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          
BLAST of Pmo_012872 vs. uniprot
Match: gi|158513400|sp|A3KGV1|ODFP2_MOUSE (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 112.079 bits (279), Expect = 1.555e-23
Identity = 92/280 (32.86%), Postives = 160/280 (57.14%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGL--SNP 2236
            D  +S  M++R E  E   Q+ R  +EN +L D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E      + + ++  RE   L RQLE+A+ D+RR  +  +E+  SK+R+ QS+I DLE QL++ + E  + RR+ ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P ++    S+P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKMLKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSQKVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSP 822          

HSP 2 Score: 112.079 bits (279), Expect = 1.555e-23
Identity = 92/280 (32.86%), Postives = 160/280 (57.14%), Query Frame = -2
Query: 2497 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGL--SNP 3297
            D  +S  M++R E  E   Q+ R  +EN +L D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E      + + ++  RE   L RQLE+A+ D+RR  +  +E+  SK+R+ QS+I DLE QL++ + E  + RR+ ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P ++    S+P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKMLKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSQKVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSP 822          

HSP 3 Score: 75.0998 bits (183), Expect = 3.308e-12
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGTLLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          

HSP 4 Score: 75.0998 bits (183), Expect = 3.308e-12
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = -2
Query: 3496 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4476
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGTLLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          
BLAST of Pmo_012872 vs. uniprot
Match: gi|158564320|sp|Q6AYX5|ODFP2_RAT (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 110.923 bits (276), Expect = 3.888e-23
Identity = 92/280 (32.86%), Postives = 160/280 (57.14%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGL--SNP 2236
            D  +S  M++R E  E   Q+ R  +EN +L D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E      + + ++  RE   L RQLE+A+ D+RR  +  +E+  SK+R+ QS+I DLE QL++ + E  + RR+ ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P ++    S+P
Sbjct:  539 DNYKSQVMKTRLEADEVAAQLERCDKENKMLKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLELAREKHQASQKENKQLSQKVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSP 817          

HSP 2 Score: 110.923 bits (276), Expect = 3.888e-23
Identity = 92/280 (32.86%), Postives = 160/280 (57.14%), Query Frame = -2
Query: 2497 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGL--SNP 3297
            D  +S  M++R E  E   Q+ R  +EN +L D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E      + + ++  RE   L RQLE+A+ D+RR  +  +E+  SK+R+ QS+I DLE QL++ + E  + RR+ ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P ++    S+P
Sbjct:  539 DNYKSQVMKTRLEADEVAAQLERCDKENKMLKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLELAREKHQASQKENKQLSQKVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSP 817          

HSP 3 Score: 90.5077 bits (223), Expect = 6.458e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            S+ P+++HVD++TP+HV + K  +    +        ++ ++ N RR    S+ + T    M   K  +R +  +  +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+    +E    E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:    6 STPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 389          

HSP 4 Score: 90.5077 bits (223), Expect = 6.458e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = -2
Query: 3496 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4623
            S+ P+++HVD++TP+HV + K  +    +        ++ ++ N RR    S+ + T    M   K  +R +  +  +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+    +E    E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:    6 STPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 389          
BLAST of Pmo_012872 vs. uniprot
Match: gi|82082176|sp|Q5ZKK5|ODFP2_CHICK (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 109.768 bits (273), Expect = 6.926e-23
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = 2
Query: 1769 RIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTS 2245
            + EELERK++    QN++    + ++E +    + + ++  RE + L RQLE A+ D++R  +  RE+  S++R+ QS++ DLE QL++ + E  + RR+ E+ +R+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVF D  L   L +P  S
Sbjct:  663 KAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSAL---LGSPGRS 818          

HSP 2 Score: 109.768 bits (273), Expect = 6.926e-23
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = -2
Query: 2488 RIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTS 2964
            + EELERK++    QN++    + ++E +    + + ++  RE + L RQLE A+ D++R  +  RE+  S++R+ QS++ DLE QL++ + E  + RR+ E+ +R+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVF D  L   L +P  S
Sbjct:  663 KAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSAL---LGSPGRS 818          

HSP 3 Score: 101.679 bits (252), Expect = 2.312e-20
Identity = 108/398 (27.14%), Postives = 195/398 (48.99%), Query Frame = 2
Query:   95 LPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIAT-SKLM--GKKKVGSRRIRSMSPPW---VPPPAKTTKGSKSTLGPFWTEDE-ADIGQQERYESKINELMNEVGDLR--YQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD---------ESETLVQALIETE---LSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILK 1222
            + N  SS P+++HVD++TP+HV + K +++           +++ N+ N RR    ++ + T +  M  GK  V     +   P     + PP      S   L    T++E A   +   YE KI+ LMN VG L+   +L+K++QR ++  +   L+  ++ ++E+ QE+   E EN +LR  ++R   +             E E L+  L E E    +A R  H ++   + L N+  E H +S  DI+ +         ++  F+  N  LR LL+   +RE   ++ L +    L +  A+ +    +LQ  + +++  I++L  Q+  + ++    +   +SLE+V+GHLQ QL+ K  + NR++ QIR LE   A+ + + E + D LK
Sbjct:    1 MKNRSSSPPLHVHVDENTPVHVHIKKGQKTTPAKCQQKHKQKMKGNTVNVRR----AVQVKTKAPWMPPGKTSVLDSTYKWEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQM--TKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERL-NV--EKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERERDVQKIL-EKQGVLMKMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLK 387          

HSP 4 Score: 101.679 bits (252), Expect = 2.312e-20
Identity = 108/398 (27.14%), Postives = 195/398 (48.99%), Query Frame = -2
Query: 3511 LPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIAT-SKLM--GKKKVGSRRIRSMSPPW---VPPPAKTTKGSKSTLGPFWTEDE-ADIGQQERYESKINELMNEVGDLR--YQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD---------ESETLVQALIETE---LSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILK 4638
            + N  SS P+++HVD++TP+HV + K +++           +++ N+ N RR    ++ + T +  M  GK  V     +   P     + PP      S   L    T++E A   +   YE KI+ LMN VG L+   +L+K++QR ++  +   L+  ++ ++E+ QE+   E EN +LR  ++R   +             E E L+  L E E    +A R  H ++   + L N+  E H +S  DI+ +         ++  F+  N  LR LL+   +RE   ++ L +    L +  A+ +    +LQ  + +++  I++L  Q+  + ++    +   +SLE+V+GHLQ QL+ K  + NR++ QIR LE   A+ + + E + D LK
Sbjct:    1 MKNRSSSPPLHVHVDENTPVHVHIKKGQKTTPAKCQQKHKQKMKGNTVNVRR----AVQVKTKAPWMPPGKTSVLDSTYKWEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQM--TKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERL-NV--EKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERERDVQKIL-EKQGVLMKMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLK 387          
BLAST of Pmo_012872 vs. uniprot
Match: gi|82179654|sp|Q5PQ23|ODFP2_XENLA (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2 [Xenopus laevis])

HSP 1 Score: 100.523 bits (249), Expect = 3.481e-20
Identity = 99/383 (25.85%), Postives = 172/383 (44.91%), Query Frame = 2
Query:   95 LPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPW--------VPPPAKTTKGSKSTLGPFWT-EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQR-------DELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLE 1168
            + N   S P+++HVD+ TP+HV + K  R   K     A  + +   N RR    S  + T   +     G   +R     W        + PP      S   +    T E+E    +   YE KI  LM+E+G L+++LE +K+        ++L  S   L+A ++ + E+ QE+   E EN  L+  LDR   +            +E   L+  L+E E        Q+  + D ++  L+   +++  DI+ +         ++  F+  N  LR LL+  Q R+      L +    L ++ ++ +     LQ  ++E++  ++DL  QL  + D +   +   +S+E+ K HLQ QL+ +  + NR+SVQIR LE
Sbjct:    1 MKNRSPSPPLHVHVDESTPVHVHIKKSSRPPAKTQ-QGAKLKKKGMGNLRR----SATVKTK--VPWIPPGKSSLRDAGLKWEGLTHRLDITPPDTERMFSALRMSDLSTDEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQR-LKHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLR-EQHRQETETYRLMEQKEMLLKKLSDADTEKMHLQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLE 374          

HSP 2 Score: 100.523 bits (249), Expect = 3.481e-20
Identity = 99/383 (25.85%), Postives = 172/383 (44.91%), Query Frame = -2
Query: 3565 LPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPW--------VPPPAKTTKGSKSTLGPFWT-EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQR-------DELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLE 4638
            + N   S P+++HVD+ TP+HV + K  R   K     A  + +   N RR    S  + T   +     G   +R     W        + PP      S   +    T E+E    +   YE KI  LM+E+G L+++LE +K+        ++L  S   L+A ++ + E+ QE+   E EN  L+  LDR   +            +E   L+  L+E E        Q+  + D ++  L+   +++  DI+ +         ++  F+  N  LR LL+  Q R+      L +    L ++ ++ +     LQ  ++E++  ++DL  QL  + D +   +   +S+E+ K HLQ QL+ +  + NR+SVQIR LE
Sbjct:    1 MKNRSPSPPLHVHVDESTPVHVHIKKSSRPPAKTQ-QGAKLKKKGMGNLRR----SATVKTK--VPWIPPGKSSLRDAGLKWEGLTHRLDITPPDTERMFSALRMSDLSTDEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQR-LKHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLR-EQHRQETETYRLMEQKEMLLKKLSDADTEKMHLQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLE 374          
BLAST of Pmo_012872 vs. Smed Unigenes AA
Match: SMU15005578 (SmedAsxldir_c106665_g2_i9|m.77475|m.37289)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 426/778 (54.76%), Postives = 563/778 (72.37%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXXEDTIQDXXXXXXXXXXXXXXXMSEFGVPNHISEPNRHCSHCV-----------------------------------------DYDASESSS--MESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2269
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KS LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q L+S+L  KE+ +EQLM      NH S  + HC HC                                          D+D+S+S S  + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSFSNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 775          

HSP 2 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 426/778 (54.76%), Postives = 563/778 (72.37%), Query Frame = -2
Query: 2464 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXAEDTIQDXXXXXXXXXXXXXXLMSEFGVPNHISEPNRHCSHCV-----------------------------------------DYDASESSS--MESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 4662
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KS LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q L+S+L  KE+ +EQLM      NH S  + HC HC                                          D+D+S+S S  + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSFSNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 775          
BLAST of Pmo_012872 vs. Smed Unigenes AA
Match: SMU15005577 (SmedAsxldir_c106665_g2_i7|m.77472|m.45171)

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 423/769 (55.01%), Postives = 561/769 (72.95%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXXEDTIQDXXXXXXXXXXXXXXXMSEFGVPNHISEPNRHCSHCVDYD---------------------------ASES-------SSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2269
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KS LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q L+S+L  KE+ +EQLM      NH S  + HC HC + +                           +S+S         + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 766          

HSP 2 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 423/769 (55.01%), Postives = 561/769 (72.95%), Query Frame = -2
Query: 2464 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXAEDTIQDXXXXXXXXXXXXXXLMSEFGVPNHISEPNRHCSHCVDYD---------------------------ASES-------SSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 4662
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KS LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q L+S+L  KE+ +EQLM      NH S  + HC HC + +                           +S+S         + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 766          
BLAST of Pmo_012872 vs. Smed Unigenes AA
Match: SMU15001741 (Asxlregen_comp65555_c0_seq4|m.19436|m.7732)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 408/753 (54.18%), Postives = 542/753 (71.98%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKST------------------LGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXXEDTIQDXXXXXXXXXXXXXXXMSEFGVPNHISEPNRHCSHCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2269
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KST                  LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q                     + + ++   RH    +         + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQ--------------------LTSILTAKERHIEQLM---------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 721          

HSP 2 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 408/753 (54.18%), Postives = 542/753 (71.98%), Query Frame = -2
Query: 2464 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKST------------------LGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXAEDTIQDXXXXXXXXXXXXXXLMSEFGVPNHISEPNRHCSHCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 4662
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KST                  LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q                     + + ++   RH    +         + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQ--------------------LTSILTAKERHIEQLM---------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 721          
BLAST of Pmo_012872 vs. Smed Unigenes AA
Match: SMU15005576 (SmedAsxldir_c106665_g2_i15|m.77482|m.8142)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 416/753 (55.25%), Postives = 552/753 (73.31%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKST------------------LGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXXEDTIQDXXXXXXXXXXXXXXXMSEFGVPNHISEPNRHCSHCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2269
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KST                  LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q L+S+L  KE+ +EQLM        +       +  V  +      + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMLCQNDRALVQSSKSFVNQFVQCE------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 744          

HSP 2 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 416/753 (55.25%), Postives = 552/753 (73.31%), Query Frame = -2
Query: 2464 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKST------------------LGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXAEDTIQDXXXXXXXXXXXXXXLMSEFGVPNHISEPNRHCSHCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 4662
            MS   S+++  SR SSPV+L VDKDTP+HV +DK +R    + FN        S   +RP+KP  N+ TS+LM   +  + R+RSMSPPWVPPP KTTK  KST                  LG +W EDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + +A+   ++ ++ELKQEID++EKEN +LR  L++  ++   + +SE LVQ LIETEL+  RC HQMQHVFD L+NI+ EGHK+S RDIDRI+  FHDTESR+F+FK+++N LR+LLK  Q REI  + S  ++N FL + R+EL++   +L+  + E++  IDDL++QL  KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAARAQKQRA KAE+T+Q L+S+L  KE+ +EQLM        +       +  V  +      + S+E+QE+L  +  I +EN  LH ++ N+  + +I SLK+ENENLRSIADQCE RL+DVE EM+++R  + +E D + +  + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMLCQNDRALVQSSKSFVNQFVQCE------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 744          
BLAST of Pmo_012872 vs. RefSeq Human
Match: gi|310750400|ref|NP_702913.1| (outer dense fiber protein 2 isoform 1 [Homo sapiens])

HSP 1 Score: 114.39 bits (285), Expect = 1.233e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2260
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  608 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 892          

HSP 2 Score: 114.39 bits (285), Expect = 1.233e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = -2
Query: 2473 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 3297
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  608 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 892          

HSP 3 Score: 93.5893 bits (231), Expect = 3.493e-18
Identity = 95/390 (24.36%), Postives = 189/390 (48.46%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            S+ P+++HVD++TP+HV + K  +    +            ++ R  K  ++N+  S           R+++ +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   94 STPPLHVHVDENTPVHVHIKKLPKPSATSS---------QKSHKRGMKGDTVNVRRSV----------RVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 458          

HSP 4 Score: 93.5893 bits (231), Expect = 3.493e-18
Identity = 95/390 (24.36%), Postives = 189/390 (48.46%), Query Frame = -2
Query: 3496 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4623
            S+ P+++HVD++TP+HV + K  +    +            ++ R  K  ++N+  S           R+++ +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   94 STPPLHVHVDENTPVHVHIKKLPKPSATSS---------QKSHKRGMKGDTVNVRRSV----------RVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 458          
BLAST of Pmo_012872 vs. RefSeq Human
Match: gi|767957560|ref|XP_011517032.1| (PREDICTED: outer dense fiber protein 2 isoform X8 [Homo sapiens])

HSP 1 Score: 114.39 bits (285), Expect = 1.255e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2260
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  627 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 911          

HSP 2 Score: 114.39 bits (285), Expect = 1.255e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = -2
Query: 2473 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 3297
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  627 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 911          

HSP 3 Score: 91.6633 bits (226), Expect = 1.374e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            S+ P+++HVD++TP+HV + K  +    +        ++ ++ N RR    S+ + T    M   K  +R +  +  +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   94 STPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 477          

HSP 4 Score: 91.6633 bits (226), Expect = 1.374e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = -2
Query: 3496 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4623
            S+ P+++HVD++TP+HV + K  +    +        ++ ++ N RR    S+ + T    M   K  +R +  +  +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   94 STPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 477          
BLAST of Pmo_012872 vs. RefSeq Human
Match: gi|334278913|ref|NP_001229281.1| (outer dense fiber protein 2 isoform 11 [Homo sapiens])

HSP 1 Score: 114.005 bits (284), Expect = 1.461e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2260
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  539 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 823          

HSP 2 Score: 114.005 bits (284), Expect = 1.461e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = -2
Query: 2473 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 3297
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  539 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 823          

HSP 3 Score: 91.6633 bits (226), Expect = 1.295e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            S+ P+++HVD++TP+HV + K  +    +        ++ ++ N RR    S+ + T    M   K  +R +  +  +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+    +E    E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:    6 STPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 389          

HSP 4 Score: 91.6633 bits (226), Expect = 1.295e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = -2
Query: 3496 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4623
            S+ P+++HVD++TP+HV + K  +    +        ++ ++ N RR    S+ + T    M   K  +R +  +  +PP    + PP+     S   L    TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+    +E    E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:    6 STPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 389          
BLAST of Pmo_012872 vs. RefSeq Human
Match: gi|310750408|ref|NP_702911.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 113.62 bits (283), Expect = 1.795e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2260
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          

HSP 2 Score: 113.62 bits (283), Expect = 1.795e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = -2
Query: 2473 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 3297
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          

HSP 3 Score: 77.0258 bits (188), Expect = 3.825e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          

HSP 4 Score: 77.0258 bits (188), Expect = 3.825e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = -2
Query: 3496 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4476
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          
BLAST of Pmo_012872 vs. RefSeq Human
Match: gi|334278916|ref|NP_001229282.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 113.62 bits (283), Expect = 1.795e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = 2
Query: 1436 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2260
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          

HSP 2 Score: 113.62 bits (283), Expect = 1.795e-24
Identity = 94/286 (32.87%), Postives = 161/286 (56.29%), Query Frame = -2
Query: 2473 DASESSSMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 3297
            D  +S  M++R E  E   Q+ R  +EN IL D++N    ++     + +  +L+ + D          +C+ +L+  E +   L   + D  SR +   ++L    +K ++S+  N+    +++ELERK++    QN++    + ++E     ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R+ Q++I DLE QL++ + E  + RRS ++ DR+   +LQD+K +LEQ+E+TNRSM  YVQFLK SYANVFGD P S  L++    +   P
Sbjct:  544 DNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          

HSP 3 Score: 77.0258 bits (188), Expect = 3.825e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          

HSP 4 Score: 77.0258 bits (188), Expect = 3.825e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = -2
Query: 3496 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 4476
            PS+ +  S   G K   V  RR +R  +  PW+PP     K S   +G  W                           TED+ D G  +  RY+ KI+ LMN VG L+ ++  + Q+ E + +   L+  ++ ++E+  E+   E EN +LRH ++R   +  F          E E L+  L+E E+       Q+  + D +   L+   +++  DI+ +         ++  F+  N  LR+LL+  +Q      E L +    L +R AE ++    L   + ++D  +++L +++  +  +    +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394          
The following BLAST results are available for this feature:
BLAST of Pmo_012872 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|74736013|sp|Q5BJF6|ODFP2_HUMAN4.757e-2432.87RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158513400|sp|A3KGV1|ODFP2_MOUSE1.555e-2332.86RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158564320|sp|Q6AYX5|ODFP2_RAT3.888e-2332.86RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82082176|sp|Q5ZKK5|ODFP2_CHICK6.926e-2340.88RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82179654|sp|Q5PQ23|ODFP2_XENLA3.481e-2025.85RecName: Full=Outer dense fiber protein 2; AltName... [more]
back to top
BLAST of Pmo_012872 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150055780.000e+054.76SmedAsxldir_c106665_g2_i9|m.77475|m.37289[more]
SMU150055770.000e+055.01SmedAsxldir_c106665_g2_i7|m.77472|m.45171[more]
SMU150017410.000e+054.18Asxlregen_comp65555_c0_seq4|m.19436|m.7732[more]
SMU150055760.000e+055.25SmedAsxldir_c106665_g2_i15|m.77482|m.8142[more]
back to top
BLAST of Pmo_012872 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|310750400|ref|NP_702913.1|1.233e-2432.87outer dense fiber protein 2 isoform 1 [Homo sapien... [more]
gi|767957560|ref|XP_011517032.1|1.255e-2432.87PREDICTED: outer dense fiber protein 2 isoform X8 ... [more]
gi|334278913|ref|NP_001229281.1|1.461e-2432.87outer dense fiber protein 2 isoform 11 [Homo sapie... [more]
gi|310750408|ref|NP_702911.1|1.795e-2432.87outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
gi|334278916|ref|NP_001229282.1|1.795e-2432.87outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
back to top
BLAST of Pmo_012872 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_012872 ID=Pmo_012872|Name=Pmo_012872|organism=Phagocata morgani|type=mRNA|length=4732bp
TTACATTGTAAATTTTACCATATAATTATAACTCTATAATTAACTCTTTT
AATTATTTACATTTGAAATTATGTCTTACAATTACTCAAGAAAATTGCCA
AATAGTCGTTCATCAAGTCCAGTTTATTTGCATGTTGATAAAGACACTCC
GATTCATGTATGTGTGGATAAAGATGAAAGAAGTGATACTAAAAATGGAT
TTAATGATGCAAGTGATAGATTAAGAAATAGTAATAATCCAAGAAGACCA
AAAAAACCTAGTATTAACATTGCGACATCAAAATTAATGGGCAAAAAGAA
AGTCGGAAGCAGACGAATCAGATCTATGTCACCACCATGGGTTCCACCAC
CTGCTAAAACTACAAAAGGATCCAAGTCCACATTGGGTCCATTTTGGACT
GAAGATGAGGCCGACATAGGTCAACAAGAACGTTATGAATCAAAGATTAA
TGAGCTGATGAATGAAGTTGGAGACTTGAGATATCAGCTGGAGAAAGAAA
AGCAGCGGGATGAATTACGGAGAAGTAATGAGGCTCTAAAGGCTCACGAG
GACACAATTGATGAATTAAAACAAGAGATTGATTTGGTGGAGAAGGAGAA
TGACATTCTGAGGCACGGCCTTGATCGCGGCCACAATGATCCAAAGTTTG
ATGAGTCAGAGACACTGGTTCAAGCGTTGATCGAGACCGAATTATCTGCG
GGTCGGTGTCAGCATCAGATGCAGCACGTGTTCGATAATTTGAAGAACAT
CCTTCGGGAAGGACACAAGATCAGCGGGAGAGATATCGATCGCATTAATG
GATTCTTCCACGATACAGAATCCCGGATGTTCGAGTTCAAGGCAGTGAAC
AATGAGCTGAGAAATTTGCTGAAGTGTTTCCAGCAGCGGGAGATCGTGGC
GCGCGAGTCTTTGGCCCAGGACAATTCCTTCTTACAGCAGAGACGGGCAG
AGTTAGAGAATTTGAATGACGAGTTACAGAGGGCCATGAACGAGCGAGAT
GTTACGATTGACGATCTGCGCAGACAATTGGCGAGGAAAAATGACGAGAC
TATCAACTTTGCGTCGACCCACGAGTCCCTGGAGAATGTCAAGGGGCACT
TGCAGCAGCAGTTGAAGCAAAAGTCCGGTGACATTAACCGCATGTCCGTT
CAAATCCGTACCCTTGAAAGTGAATTGGCAAAAGAACGTTTGGACAAAGA
ACATCTGATGGACATTTTGAAAAACAGCAAAGACCGAACCGGGGACGATA
GGGATGCATTGAAGAAGGCCGCTCGGGCGCAGAAACAGAGGGCTCAGAAG
GCAGAAGACACAATCCAAGATTTGTCATCTCTGCTTGCCGAGAAGGAGAA
GCAGCTAGAGCAATTGATGTCTGAATTTGGAGTTCCGAATCACATATCCG
AACCCAACCGTCATTGTTCCCACTGTGTCGACTATGATGCCTCAGAGTCG
TCTTCGATGGAAAGTCGAGAAAATCAGGAGCAACTTGGACAGATGAACAG
AATCGCTGAGGAGAACGATATTCTCCACGATAAGATCAACAATTCCCATT
ACGACAGCGTGATCCATTCATTGAAAAGAGAAAATGAGAACTTGCGATCA
ATAGCTGACCAGTGCGAGGTCAGACTAAAGGACGTAGAACTAGAGATGGA
GTCCCTACGACACAATCTTGGGGACGAAGACAGTAGGGATGACAGCAACT
TGGAGAGGTTGTCACAAATCCTTCAGAAGCTTGAGTCCTCAGAAAATGCC
AACCAAGTCAGTCAGACACGTATCGAAGAATTGGAAAGAAAGATAAAGAA
TTGTGAAAATCAAAATTTGGATCTAAAGCACAATGTTCAACAAAAGGAAA
GTAATGCCTTAGATAATCGTTGTAAAGCCGATGATTTAGCAAGGGAGAAT
GCGGGTCTTGTACGTCAACTGGAAGCTGCCTTGAATGATTCTCGCAGAAA
TGCTGACAATGCTCGAGAAAAGATCAACAGCAAAGATCGCAGTCTACAGT
CACGAATCCATGATTTGGAAGCCCAATTAGCTCAGCAAAGGGCCGAAGCA
ATGAAATGGCGGCGCAGTTGTGAAGAGAATGATCGGAAATGTAGTGGCAA
ATTGCAGGACATCAAGGTCCAATTGGAGCAAGCAGAGACCACCAATCGCA
GTATGCACACCTACGTACAGTTCCTGAAGAAGTCCTATGCCAATGTATTC
GGAGACATTCCGCTGTCAAATGGACTCAGTAATCCGAACACATCCAACCT
CGGTGGTCCGATATGCTTCTGAAGATATTCTATGCTACTGTTACCTTTCA
GTTATTAAATTTGATATTTTTAGTTGGGTTATACTCTTCGAATATATGTT
GATGTTTCGTAAAAAATTTTTTACGAAACATCAACATATATTCGAAGAGT
ATAACCCAACTAAAAATATCAAATTTAATAACTGAAAGGTAACAGTAGCA
TAGAATATCTTCAGAAGCATATCGGACCACCGAGGTTGGATGTGTTCGGA
TTACTGAGTCCATTTGACAGCGGAATGTCTCCGAATACATTGGCATAGGA
CTTCTTCAGGAACTGTACGTAGGTGTGCATACTGCGATTGGTGGTCTCTG
CTTGCTCCAATTGGACCTTGATGTCCTGCAATTTGCCACTACATTTCCGA
TCATTCTCTTCACAACTGCGCCGCCATTTCATTGCTTCGGCCCTTTGCTG
AGCTAATTGGGCTTCCAAATCATGGATTCGTGACTGTAGACTGCGATCTT
TGCTGTTGATCTTTTCTCGAGCATTGTCAGCATTTCTGCGAGAATCATTC
AAGGCAGCTTCCAGTTGACGTACAAGACCCGCATTCTCCCTTGCTAAATC
ATCGGCTTTACAACGATTATCTAAGGCATTACTTTCCTTTTGTTGAACAT
TGTGCTTTAGATCCAAATTTTGATTTTCACAATTCTTTATCTTTCTTTCC
AATTCTTCGATACGTGTCTGACTGACTTGGTTGGCATTTTCTGAGGACTC
AAGCTTCTGAAGGATTTGTGACAACCTCTCCAAGTTGCTGTCATCCCTAC
TGTCTTCGTCCCCAAGATTGTGTCGTAGGGACTCCATCTCTAGTTCTACG
TCCTTTAGTCTGACCTCGCACTGGTCAGCTATTGATCGCAAGTTCTCATT
TTCTCTTTTCAATGAATGGATCACGCTGTCGTAATGGGAATTGTTGATCT
TATCGTGGAGAATATCGTTCTCCTCAGCGATTCTGTTCATCTGTCCAAGT
TGCTCCTGATTTTCTCGACTTTCCATCGAAGACGACTCTGAGGCATCATA
GTCGACACAGTGGGAACAATGACGGTTGGGTTCGGATATGTGATTCGGAA
CTCCAAATTCAGACATCAATTGCTCTAGCTGCTTCTCCTTCTCGGCAAGC
AGAGATGACAAATCTTGGATTGTGTCTTCTGCCTTCTGAGCCCTCTGTTT
CTGCGCCCGAGCGGCCTTCTTCAATGCATCCCTATCGTCCCCGGTTCGGT
CTTTGCTGTTTTTCAAAATGTCCATCAGATGTTCTTTGTCCAAACGTTCT
TTTGCCAATTCACTTTCAAGGGTACGGATTTGAACGGACATGCGGTTAAT
GTCACCGGACTTTTGCTTCAACTGCTGCTGCAAGTGCCCCTTGACATTCT
CCAGGGACTCGTGGGTCGACGCAAAGTTGATAGTCTCGTCATTTTTCCTC
GCCAATTGTCTGCGCAGATCGTCAATCGTAACATCTCGCTCGTTCATGGC
CCTCTGTAACTCGTCATTCAAATTCTCTAACTCTGCCCGTCTCTGCTGTA
AGAAGGAATTGTCCTGGGCCAAAGACTCGCGCGCCACGATCTCCCGCTGC
TGGAAACACTTCAGCAAATTTCTCAGCTCATTGTTCACTGCCTTGAACTC
GAACATCCGGGATTCTGTATCGTGGAAGAATCCATTAATGCGATCGATAT
CTCTCCCGCTGATCTTGTGTCCTTCCCGAAGGATGTTCTTCAAATTATCG
AACACGTGCTGCATCTGATGCTGACACCGACCCGCAGATAATTCGGTCTC
GATCAACGCTTGAACCAGTGTCTCTGACTCATCAAACTTTGGATCATTGT
GGCCGCGATCAAGGCCGTGCCTCAGAATGTCATTCTCCTTCTCCACCAAA
TCAATCTCTTGTTTTAATTCATCAATTGTGTCCTCGTGAGCCTTTAGAGC
CTCATTACTTCTCCGTAATTCATCCCGCTGCTTTTCTTTCTCCAGCTGAT
ATCTCAAGTCTCCAACTTCATTCATCAGCTCATTAATCTTTGATTCATAA
CGTTCTTGTTGACCTATGTCGGCCTCATCTTCAGTCCAAAATGGACCCAA
TGTGGACTTGGATCCTTTTGTAGTTTTAGCAGGTGGTGGAACCCATGGTG
GTGACATAGATCTGATTCGTCTGCTTCCGACTTTCTTTTTGCCCATTAAT
TTTGATGTCGCAATGTTAATACTAGGTTTTTTTGGTCTTCTTGGATTATT
ACTATTTCTTAATCTATCACTTGCATCATTAAATCCATTTTTAGTATCAC
TTCTTTCATCTTTATCCACACATACATGAATCGGAGTGTCTTTATCAACA
TGCAAATAAACTGGACTTGATGAACGACTATTTGGCAATTTTCTTGAGTA
ATTGTAAGACATAATTTCAAATGTAAATAATTAAAAGAGTTAATTATAGA
GTTATAATTATATGGTAAAATTTACAATGTAA

Design Primers for Pmo_012872

back to top

protein sequence

>Pmo_012872-protein ID=Pmo_012872-protein|Name=Pmo_012872|organism=Phagocata morgani|type=polypeptide|length=734bp
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMSEFGVPNHISEPNRHCS
HCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHS
LKRENENLRSIADQCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQI
LQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNR
CKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDLE
AQLAQQRAEAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQ
FLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF*
back to top

coding sequence

>Pmo_012872.71.2272 ID=Pmo_012872.71.2272|Name=Pmo_012872.71.2272|organism=Phagocata morgani|type=CDS|length=2202bp
ATGTCTTACAATTACTCAAGAAAATTGCCAAATAGTCGTTCATCAAGTCC
AGTTTATTTGCATGTTGATAAAGACACTCCGATTCATGTATGTGTGGATA
AAGATGAAAGAAGTGATACTAAAAATGGATTTAATGATGCAAGTGATAGA
TTAAGAAATAGTAATAATCCAAGAAGACCAAAAAAACCTAGTATTAACAT
TGCGACATCAAAATTAATGGGCAAAAAGAAAGTCGGAAGCAGACGAATCA
GATCTATGTCACCACCATGGGTTCCACCACCTGCTAAAACTACAAAAGGA
TCCAAGTCCACATTGGGTCCATTTTGGACTGAAGATGAGGCCGACATAGG
TCAACAAGAACGTTATGAATCAAAGATTAATGAGCTGATGAATGAAGTTG
GAGACTTGAGATATCAGCTGGAGAAAGAAAAGCAGCGGGATGAATTACGG
AGAAGTAATGAGGCTCTAAAGGCTCACGAGGACACAATTGATGAATTAAA
ACAAGAGATTGATTTGGTGGAGAAGGAGAATGACATTCTGAGGCACGGCC
TTGATCGCGGCCACAATGATCCAAAGTTTGATGAGTCAGAGACACTGGTT
CAAGCGTTGATCGAGACCGAATTATCTGCGGGTCGGTGTCAGCATCAGAT
GCAGCACGTGTTCGATAATTTGAAGAACATCCTTCGGGAAGGACACAAGA
TCAGCGGGAGAGATATCGATCGCATTAATGGATTCTTCCACGATACAGAA
TCCCGGATGTTCGAGTTCAAGGCAGTGAACAATGAGCTGAGAAATTTGCT
GAAGTGTTTCCAGCAGCGGGAGATCGTGGCGCGCGAGTCTTTGGCCCAGG
ACAATTCCTTCTTACAGCAGAGACGGGCAGAGTTAGAGAATTTGAATGAC
GAGTTACAGAGGGCCATGAACGAGCGAGATGTTACGATTGACGATCTGCG
CAGACAATTGGCGAGGAAAAATGACGAGACTATCAACTTTGCGTCGACCC
ACGAGTCCCTGGAGAATGTCAAGGGGCACTTGCAGCAGCAGTTGAAGCAA
AAGTCCGGTGACATTAACCGCATGTCCGTTCAAATCCGTACCCTTGAAAG
TGAATTGGCAAAAGAACGTTTGGACAAAGAACATCTGATGGACATTTTGA
AAAACAGCAAAGACCGAACCGGGGACGATAGGGATGCATTGAAGAAGGCC
GCTCGGGCGCAGAAACAGAGGGCTCAGAAGGCAGAAGACACAATCCAAGA
TTTGTCATCTCTGCTTGCCGAGAAGGAGAAGCAGCTAGAGCAATTGATGT
CTGAATTTGGAGTTCCGAATCACATATCCGAACCCAACCGTCATTGTTCC
CACTGTGTCGACTATGATGCCTCAGAGTCGTCTTCGATGGAAAGTCGAGA
AAATCAGGAGCAACTTGGACAGATGAACAGAATCGCTGAGGAGAACGATA
TTCTCCACGATAAGATCAACAATTCCCATTACGACAGCGTGATCCATTCA
TTGAAAAGAGAAAATGAGAACTTGCGATCAATAGCTGACCAGTGCGAGGT
CAGACTAAAGGACGTAGAACTAGAGATGGAGTCCCTACGACACAATCTTG
GGGACGAAGACAGTAGGGATGACAGCAACTTGGAGAGGTTGTCACAAATC
CTTCAGAAGCTTGAGTCCTCAGAAAATGCCAACCAAGTCAGTCAGACACG
TATCGAAGAATTGGAAAGAAAGATAAAGAATTGTGAAAATCAAAATTTGG
ATCTAAAGCACAATGTTCAACAAAAGGAAAGTAATGCCTTAGATAATCGT
TGTAAAGCCGATGATTTAGCAAGGGAGAATGCGGGTCTTGTACGTCAACT
GGAAGCTGCCTTGAATGATTCTCGCAGAAATGCTGACAATGCTCGAGAAA
AGATCAACAGCAAAGATCGCAGTCTACAGTCACGAATCCATGATTTGGAA
GCCCAATTAGCTCAGCAAAGGGCCGAAGCAATGAAATGGCGGCGCAGTTG
TGAAGAGAATGATCGGAAATGTAGTGGCAAATTGCAGGACATCAAGGTCC
AATTGGAGCAAGCAGAGACCACCAATCGCAGTATGCACACCTACGTACAG
TTCCTGAAGAAGTCCTATGCCAATGTATTCGGAGACATTCCGCTGTCAAA
TGGACTCAGTAATCCGAACACATCCAACCTCGGTGGTCCGATATGCTTCT
GA
back to top
Gene Groups
Pmo_012872 is similar in sequence to the genes of this group: GG437
Gene NameGene ID
SMU15001741SMU15001741
SMU15005576SMU15005576
SMU15005577SMU15005577
SMU15005578SMU15005578
Ddo_003032Ddo_003032
Ddo_005045Ddo_005045
Ddo_009916Ddo_009916
Ddo_012914Ddo_012914
Gsp_000977Gsp_000977
Gsp_002888Gsp_002888
Gsp_019027Gsp_019027
Gsp_023053Gsp_023053
Pgr_024273Pgr_024273
Pmo_012872Pmo_012872
odf2Pmo_015154

Gene Group Protein Sequences

>SMU15001741

MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMI
NSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIAD
QCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQ
SSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENAS
LMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNK
WHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGD
MPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005576
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML
CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMA
NNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDK
SEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVL
QQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRD
RQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSE
ITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005577
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQED
QEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESR
LRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIR
IEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQL
EAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNC
EETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSN
GLSCPNPSYMGQSLSFNGF*
>SMU15005578
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSF
SNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLR
SIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSE
KSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELAR
ENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKA
ESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYAN
VFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>Ddo_003032 Ddo_003032
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLQSKSHADLEDGNDELLSKPLTELCDQCKLNSREYQQNLRHIDDIVE
ENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILR
KTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLE
GQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNAD
NVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQ
DLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQ
SSLNFGGF*
>Ddo_005045 Ddo_005045
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENL
RSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEAS
EKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLM
RENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQR
AETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYA
NVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Ddo_009916 Ddo_009916
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLLNSREYQQNLRHI
DDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKE
MKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKK
IRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDS
RRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKN
SSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNN
SFVPQSSLNFGGF*
>Ddo_012914 Ddo_012914
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGND
ELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEI
IIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINR
LSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSV
IDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRI
HDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQ
TYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Gsp_000977 Gsp_000977
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLIMNSREDQDNLRRMDEIIDE
NQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRR
TMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLEN
QNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADN
SREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQD
LKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQS
LSFGGF*
>Gsp_002888 Gsp_002888
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLISNQNQNETKSDSIPVIKSF
NNQYVQCEMNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRE
NDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEK
LETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKT
EELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQL
AQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLK
KSYANVFGDIPLSNGLSCPNPPYIGQSLSFGGF*
>Gsp_019027 Gsp_019027
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIS
NQNQNETKSDSIPVIKSFNNQYVQCEMNSREDQDNLRRMDEIIDENQHLH
RQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEE
NDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEM
KTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKT
VGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQL
EQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQSLSFGG
F*
>Gsp_023053 Gsp_023053
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIM
NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIAD
QCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQ
TSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENAS
LTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANK
WRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGD
IPLSNGLSCPNPPYIGQSLSFGGF*
>Pgr_024273 Pgr_024273
MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDG
LQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTR
GSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDEL
RRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLDESDHL
IQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDT
ESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLN
DTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLK
QKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSLKK
AARLQKQRAQKAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHC
AHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESV
IISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKL
SLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVI
DNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIH
DLEAQLAQQRAEAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHT
YVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF*
>Pmo_012872 Pmo_012872
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMSEFGVPNHISEPNRHCS
HCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHS
LKRENENLRSIADQCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQI
LQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNR
CKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDLE
AQLAQQRAEAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQ
FLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF*
>Pmo_015154 odf2
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMMESRENQEQLGQMNRIA
EENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESL
RHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCE
NQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNAD
NAREKINSKDRSLQSRIHDLEAQLAQQRAEAMKWRRSCEENDRKCSGKLQ
DIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGG
PICF*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.