Pmo_009451, Pmo_009451 (mRNA) Phagocata morgani

Overview
NamePmo_009451
Unique NamePmo_009451
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length3079
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_009451 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 1165.6 bits (3014), Expect = 0.000e+0
Identity = 546/802 (68.08%), Postives = 660/802 (82.29%), Query Frame = 3
Query:  189 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTR----MRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSF-INNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 2579
            I+EPNLQP DITEK GNIG+TVKL SNF KFS+ + + F MYD V S +G++PK KL+ I +V Q N L G FCFDGRRLFT EKWHGESDI EF+ DEKK+T+R ++ +   TEEYYQM+NV+ NN+QV +GQERIG+ YFL  N  K +V + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQL+GRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR    MRR   RKKK E+  E  +E     E +MTLNIPGELCFLCGFSDQEK N DLQKNLG +LKREPR+RLDDIPA+C+WI  S+ A+    +W LKI+N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + HEID+V++DRNDF Y+ F+ DV+ ELRN+ ++A+V  V  CGPND+E  LND  R      KMALVFV DD++YA+VK+FT++TGLLTQCVT RN TNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ KKSIQASV+SINSTFTQY+SF +N+PKGRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL
Sbjct:   34 IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRE--RKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of Pmo_009451 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 499/797 (62.61%), Postives = 627/797 (78.67%), Query Frame = 3
Query:  189 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 2579
            I+EP+LQP +  +K+GN+GK V+L SNF KFS+ + + + MYD   S +G++PK KL+I+ ++ +  NL G FC+DGRRLFT + W   SDI EFT DEKK+++R ++     TEEYYQM+NV+ NN+Q+ MGQE+IG+ YFLG+N++K +V K  GPT+FE NNF+VLGGF TTLQRGTRP+G  +TLLYIERINRVLN+NSV+  Y++   DQL+GRDI+TKYNNKTYRIS+IKEM+++E F++ GR LSY  YFKERYNI L    QPFVLTR+++   R K+ E  E    E        +TLNI GELCFLCGFSDQEK N DLQKNLG +LKR PR+RLDDIP+FCDWI  +  +     +W LKI+N PLEIEGRELP  DV+SGGQ++NE+I DDWKFG+V+F       HEID+V++DRND  Y  F+ DV+ E++ L  +AK+  V  C  ND+E  LND+MR      K+ALVFV DD++YA+VK+FT++TGLLTQCVT RN TNR DKRRQVV+SK+VMQIFSKFGYDPW ++IK+RPTMIVG+DT+H+K  KKSI ASV+SINSTF+QY+SF N+PKG+QEFH+ L  NF AAL +F   Y+I P RIM+YRDGVGDSQ+ FTKQFE DA+KP++E +Y++ G  +PQIIYV+VKKRI TK F  G N  PGTIVDKE+VKPNF+EFFLVSQR T+GTASPTNYNVLEDT+   K G++E + PNELQ+ITYTLTHLYFNWMGTIRVP P HYAH+LAELIGK+HKG+ PA+IN+RIR+RLFYL
Sbjct:   27 IVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMD-----LTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of Pmo_009451 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 451/798 (56.52%), Postives = 604/798 (75.69%), Query Frame = 3
Query:  189 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 2579
            I+EP LQP  +T+K+G  G+ V L SN+A F+I     F+MYDVV+ +  +  + KL+++     + N   PFCFDGRRLFT  KWH + D       + +I+IR +T     +EEYYQM+N++FNNIQ+FMGQE+IGR +FLG+N +   + +G  P++F+++NF++LGG+STT+ RGT  +G++STLLY+ERINRVLNEN+VV+ Y + + DQL+GRDIITKYNNKTYRISDIKEM V+++  L  +K+SY +YFK+RYNI L++  QPFV++R++R+ +R K+  + E              +L+IPGELC+LCGFSD E+ N +LQKNLG +LKREPR+RL+DI  FC W G + K+  +MK W + IE +P+ I GREL PVD+ S   K+N +IPDDWKFG +KF       H   ++V+DRN  ++  FI+DVK E+  L +N  + S+  C  N++E+ L D +R S+  V MALVF+ DDK+YA+VKNFT++TGLLTQCVTQRN +NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+HSKTGK+S+QASV+SI++ F+QY+SF+N+ KG+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  P  INDRIR+RLFYL
Sbjct:   25 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETD-----QSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of Pmo_009451 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 277.715 bits (709), Expect = 1.214e-77
Identity = 234/825 (28.36%), Postives = 375/825 (45.45%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKV--QQTNNLRGPFCFDGRRLFTGEKWHGESDI--SEFTEDEK-KITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDI--------------ENILNDIMRRSRDAVKMALVFVS---DDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYH-SKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFK--NGQ--NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G  G  ++L +NF +     +   + Y V        P    ++ S +  Q    L     FDG  LF   K      +  SE    EK +IT+     +   +    Q  N++F  I   +  ++IGR Y+   N D         P     +   +  GF TT+ +       SS +L  +  ++VL   +V++             + +  + +LVG  I+TKYNNKTYRI DI  + + +  F     ++S+ +YFK +Y + +   NQ  +++ ++R                 P   P P   + +P E C+L G +D+ + + ++ K+L    +  P QR   I      I ++    + +  W L  EN+ L + GR LP   ++ GG+       + W      ++   R    I  + +D     Y +   DV   L  L    KV+     GP  I              E++L  + +      +M +V +     DK     K   +     +QCV  R  +    +    VA+K  +Q+  K G + W+VEI LR  MIVG+D YH +  GK+SI A V S+N   +++ S        QE  + L  +   AL+ +       P RI++YRDGVGD  +     +E   +   ++ + QD     P++  VVVKKRIS++FF   +G+  NP PGT++D EV +P +Y+FF+VSQ    G  +PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVPAP  YAH+LA L+G+ IHK  N   +N  + D L+YL
Sbjct:  102 KTGVSGTAIELRANFMRLLSRPMWALYQYHVDYK----PPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---NPDD--------PFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRL---------------GPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEY---NPWT---ADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSL--LQTLNKVS-----GPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE---PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN---MN--LDDFLYYL 858          
BLAST of Pmo_009451 vs. uniprot
Match: gi|74716803|sp|Q96J94|PIWL1_HUMAN (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 273.092 bits (697), Expect = 4.678e-76
Identity = 224/820 (27.32%), Postives = 395/820 (48.17%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISE-FTE----DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM--NERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKM--YARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G+ G  V+L++N  + +       + Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    ++ +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V++             + +  S +L+G  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R                  P    P   + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      ++   RN       IQ++      + +  +   + +   +  E  L  + ++     ++ +  +S ++   Y  +K +  T     +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---------------RRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pmo_009451 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 1169.07 bits (3023), Expect = 0.000e+0
Identity = 542/804 (67.41%), Postives = 659/804 (81.97%), Query Frame = 3
Query:  189 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMR------RTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 2582
            I+EPNLQP DITEK GNIG+TVKL SNF KFS+ + + F MYD V S +G++PK KL+ I +V Q N L G FCFDGRRLFT EKWHGESDI EF+ DEKK+T+R ++ +   TEEYYQM+NV+ NN+QV +GQERIG+ YFL  N  K +V + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQL+GRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR++      R    ++  EK +E   E     E +MTLNIPGELCFLCGFSDQEK N DLQKNLG +LKREPR+RLDDIPA+C+WI  S+ A+    +W LKI+N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + HEID+V++DRNDF Y+ F+ DV+ ELRN+ ++A+V  V  CGPND+E  LND  R      KMALVFV DD++YA+VK+FT++TGLLTQCVT RN TNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ KKSIQASV+SINSTFTQY+SF+N+PKGRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL*
Sbjct:   34 IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          
BLAST of Pmo_009451 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 955.666 bits (2469), Expect = 0.000e+0
Identity = 452/799 (56.57%), Postives = 605/799 (75.72%), Query Frame = 3
Query:  189 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 2582
            I+EP LQP  +T+K+G  G+ V L SN+A F+I     F+MYDVV+ +  +  + KL+++     + N   PFCFDGRRLFT  KWH + D       + +I+IR +T     +EEYYQM+N++FNNIQ+FMGQE+IGR +FLG+N +   + +G  P++F+++NF++LGG+STT+ RGT  +G++STLLY+ERINRVLNEN+VV+ Y + + DQL+GRDIITKYNNKTYRISDIKEM V+++  L  +K+SY +YFK+RYNI L++  QPFV++R++R+ +R K+  + E              +L+IPGELC+LCGFSD E+ N +LQKNLG +LKREPR+RL+DI  FC W G + K+  +MK W + IE +P+ I GREL PVD+ S   K+N +IPDDWKFG +KF       H   ++V+DRN  ++  FI+DVK E+  L +N  + S+  C  N++E+ L D +R S+  V MALVF+ DDK+YA+VKNFT++TGLLTQCVTQRN +NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+HSKTGK+S+QASV+SI++ F+QY+SF+N+ KG+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  P  INDRIR+RLFYL*
Sbjct:   68 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETD-----QSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          
BLAST of Pmo_009451 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 231.106 bits (588), Expect = 7.295e-63
Identity = 212/817 (25.95%), Postives = 378/817 (46.27%), Query Frame = 3
Query:  210 PTDITEKMG---NIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTN--NLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGT--EEYYQMVNVMFNNIQVFMGQERIGRAYFLGANT---DKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMR-RTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRKNHEID--IVVIDRNDFNYQK-FIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSD--DKMYARVKNFT-LTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFF----KN-GQ--NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 2582
            PT I E      +   ++ L++N+ K    Q    + Y V  +    +   ++KI+  + +++   ++    FDG  L+  +    +  I +  +   K  +      T      E   + NV+F  I+  +   +IGR YF        D+R +    G     + NF   GG         +   + S    +  IN+ +N    +   +    +QL+G+ ++T +NN+ YRI+DI    +   +FD  G K+SY DYFK  Y ++++   QP ++++   R+G         +    +   E +  +   IP ELC L G +D    +  L + L    +  P++R + +  F D I   E+A   +  W + IE   + I   ++ P +++  G + +    +  +F +            I+  I++  ++        +Q + ++   + V      + +   +  E  L ++ R     V++ +  +S   +  Y  +K F  +   + +Q V  +  T +   +   VA    +QI +K G + W V+I ++  M+VGLD +H   G+ +S+ A V S N+  T++ S  +  +  +E   VL     + L+ +  +    P+ I +YRDGV D Q+ + ++ E +    + E    D     P ++Y VV+KRI+T+ +    KN GQ  NP PGTIVD  V + N Y+FFLVSQ   +GT +PT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVPAP  YAH+LA ++G+  K    A  ++ + DRLFYL*
Sbjct:  195 PTQIKEPCNTRNDSSPSLTLSANYVKVRTTQ-PHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPG-YVTSIQNFD--GGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAA---INQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSG---------KNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK---PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLK----AEPSNLLCDRLFYL* 975          
BLAST of Pmo_009451 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 125.561 bits (314), Expect = 3.822e-29
Identity = 139/587 (23.68%), Postives = 242/587 (41.23%), Query Frame = 3
Query:  870 KTYRISDIKEMSV-SEQFDLAGRK-----LSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSE-KASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDD--WKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQD-----VKNELRNLNVNAKVTSV-EKC------GPNDIENILNDIMRRSRDAVKMALVFVSDDKMYARVKNF-TLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPT------MIVGLDTYHSKTG---KKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFF---------KNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLA 2501
            + YR+ ++   S  S+ F L   +      +   YF++RY +KLQH + P +     +                             +P E+C +       K   D+Q +   ++K   R   D      + + +S   A   ++ + + +  R  +I+GR +P   +  GG+   +  P    W     +F +       I+I V     F  Q+ +++        +L+ ++ +A +  V + C      G + +E +   +         + +V      +YA VK    +  GL TQCV  +N    ++K      S   ++I  K G     +   +RP       + +G D  H   G   K SI A V S+++  ++Y + ++    RQE  + L       L QF+      P RI+ YRDGV + Q       E  A++    KL   YQ      P I +VVV+KR  T+ F         ++G  P  GT VD+ +  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +PAP +YAH +A
Sbjct:  346 RKYRVCNVTRRSAQSQTFPLQSEQGQTIECTVTKYFQDRYGMKLQHPHLPCLQVGQEQKHTY-------------------------LPLEVCNIVSGQRCIKKLTDMQTST--MIKATARSAPDREKEINNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSG------IEIKVWAIACFAPQRTVREDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ------PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPA-GTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Pmo_009451 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 120.168 bits (300), Expect = 1.914e-27
Identity = 146/624 (23.40%), Postives = 263/624 (42.15%), Query Frame = 3
Query:  759 YIERI---NRVLNENSVVNAYSKGRSDQLVG---RDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSSRK--NHEIDIVVIDRNDFNYQKFIQDVKNEL----RNLNVNAKVTSVEKCGP-NDIENILNDIMRRSRDAVKMA--LVFVS-DDKMYARVKNF-TLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVE-IKLR-------PTMIVGLDTYHSKTGK----KSIQASVYSINSTFTQYLSFINNPKGRQE------FHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQ--------NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLA 2501
            YI +I   NR LN N++ N   K ++ ++     ++   K  ++ Y I      S  E+  +  + L+   YF++ YNIKL++ N P V T   +                             +P EL  +       + +  + + +          RL  + +    +    +   F++ + ++I+ + + ++ R L   + + GGQ+        W     KF     K  N  +  V  +R+     K + D++++L     N+ +    +      P  +IE +  D +R S    K    LVFV  +D+ Y  VK F  +  G++TQC+  + AT    K         ++++  K G   W +  I+ R         M+ G+D  H  + +    KS+ A V S+++  T Y + I     ++E        E+    +   +  + +  ++ P+R++ YRDGV + Q     + E  A++   +KL +D     P I Y+VV+KR   +FF   +        N   GT+VDK++     ++F+L S    +GT+ P +Y+VL D               +ELQ  TY L H+Y     ++  PAPT+YAH  A
Sbjct:  389 YISKIMDPNR-LNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREE-KIVEKNLTIEQYFQKEYNIKLKYPNLPMVKTSPNKPTF--------------------------VPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAA 970          
BLAST of Pmo_009451 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 273.092 bits (697), Expect = 1.766e-76
Identity = 224/820 (27.32%), Postives = 395/820 (48.17%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISE-FTE----DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM--NERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKM--YARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G+ G  V+L++N  + +       + Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    ++ +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V++             + +  S +L+G  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R                  P    P   + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      ++   RN       IQ++      + +  +   + +   +  E  L  + ++     ++ +  +S ++   Y  +K +  T     +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---------------RRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pmo_009451 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.092 bits (697), Expect = 1.766e-76
Identity = 224/820 (27.32%), Postives = 395/820 (48.17%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISE-FTE----DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM--NERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKM--YARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G+ G  V+L++N  + +       + Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    ++ +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V++             + +  S +L+G  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R                  P    P   + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      ++   RN       IQ++      + +  +   + +   +  E  L  + ++     ++ +  +S ++   Y  +K +  T     +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---------------RRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pmo_009451 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.092 bits (697), Expect = 1.766e-76
Identity = 224/820 (27.32%), Postives = 395/820 (48.17%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISE-FTE----DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM--NERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKM--YARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G+ G  V+L++N  + +       + Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    ++ +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V++             + +  S +L+G  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R                  P    P   + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      ++   RN       IQ++      + +  +   + +   +  E  L  + ++     ++ +  +S ++   Y  +K +  T     +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---------------RRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pmo_009451 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.092 bits (697), Expect = 1.766e-76
Identity = 224/820 (27.32%), Postives = 395/820 (48.17%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISE-FTE----DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM--NERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKM--YARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G+ G  V+L++N  + +       + Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    ++ +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V++             + +  S +L+G  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R                  P    P   + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      ++   RN       IQ++      + +  +   + +   +  E  L  + ++     ++ +  +S ++   Y  +K +  T     +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---------------RRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pmo_009451 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.092 bits (697), Expect = 1.766e-76
Identity = 224/820 (27.32%), Postives = 395/820 (48.17%), Query Frame = 3
Query:  228 KMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISE-FTE----DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM--NERIPDDWKFGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSDDKM--YARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            K G+ G  V+L++N  + +       + Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    ++ +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V++             + +  S +L+G  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R                  P    P   + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      ++   RN       IQ++      + +  +   + +   +  E  L  + ++     ++ +  +S ++   Y  +K +  T     +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---------------RRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pmo_009451 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 263.077 bits (671), Expect = 1.303e-73
Identity = 215/807 (26.64%), Postives = 375/807 (46.47%), Query Frame = 3
Query:  201 NLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDI---SEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRD----------IITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWK--FGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDI---ENILNDIMRRSRDAV----KMALVFVSDD--KMYARVKNFT-LTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHS-KTGKKSIQASVYSI----NSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIG 2513
            N +P ++  K G  G  V L +NF +           Y V        P+ ++ ++S     N L   + FDG +LFT  K+  E  +       + E KI+I+F+  ++     + Q++N++       +  E +GR  F     D R  AK       E+  F+  +  G+ T++++  +       LL  E  ++V+   ++ +   +   +    +D          ++T YNN+TYRI+D+    +    F   GR +S+ +Y+  +YNI+++  NQP ++++ R   ++    E                + + IP ELC + G + + + N  L + +    +  P+QR D + AF   +  + ++   +++W+++++    E++GR +   ++V    K+      DW+  F   +  T+     +   V+        Q+   +++  L +L   A    +    P +    ++     +R   D V    K+ L  V +D  + Y+ +K    +   + TQ VT +   NR       +A+K  +Q+  K GY PW +E+ L   M +G D   S +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +    +FE   +K I+EKL   Y       PQ+ Y+VV + ++T+FF NGQNP PGTIVD  +  P  Y+F+LVSQ+  +GT SPT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVPA   YA +LA L+G
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLS--NHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF-----DPR--AK------IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASE----------------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAP------QRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNR---SLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of Pmo_009451 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 263.077 bits (671), Expect = 1.303e-73
Identity = 215/807 (26.64%), Postives = 375/807 (46.47%), Query Frame = 3
Query:  201 NLQPTDITEKMGNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDI---SEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRD----------IITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWK--FGRVKFATSSRKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDI---ENILNDIMRRSRDAV----KMALVFVSDD--KMYARVKNFT-LTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHS-KTGKKSIQASVYSI----NSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIG 2513
            N +P ++  K G  G  V L +NF +           Y V        P+ ++ ++S     N L   + FDG +LFT  K+  E  +       + E KI+I+F+  ++     + Q++N++       +  E +GR  F     D R  AK       E+  F+  +  G+ T++++  +       LL  E  ++V+   ++ +   +   +    +D          ++T YNN+TYRI+D+    +    F   GR +S+ +Y+  +YNI+++  NQP ++++ R   ++    E                + + IP ELC + G + + + N  L + +    +  P+QR D + AF   +  + ++   +++W+++++    E++GR +   ++V    K+      DW+  F   +  T+     +   V+        Q+   +++  L +L   A    +    P +    ++     +R   D V    K+ L  V +D  + Y+ +K    +   + TQ VT +   NR       +A+K  +Q+  K GY PW +E+ L   M +G D   S +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +    +FE   +K I+EKL   Y       PQ+ Y+VV + ++T+FF NGQNP PGTIVD  +  P  Y+F+LVSQ+  +GT SPT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVPA   YA +LA L+G
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLS--NHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF-----DPR--AK------IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASE----------------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAP------QRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNR---SLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of Pmo_009451 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 250.751 bits (639), Expect = 7.733e-70
Identity = 215/819 (26.25%), Postives = 378/819 (46.15%), Query Frame = 3
Query:  207 QPTDITEKMGNIGKTVKLASNFAK------FSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTE--------DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ----------LVGRDIITKYNNKTYRISDIKEMSVS-EQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM---NERIPDDWKFGRVKFATSSR-KNHEID---IVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGP--NDIENILNDIMRRSRD-------AVKMALVFVSDDKMYARVKNFTLTT-GLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFT-QYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPI-PQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK 2516
            +P  +T K G +G  + + +N+ K      ++I Q    F  DV  + L           S + +   + G + FDG  +F   ++    D     E        +  +I I+ + +V     E +Q++N++       +  + + R Y+                    + NFR  +  G+ T++++       +  LL  E  ++V+   ++ N  S    D           ++G  I+T YNNKTYRI D+   S    +F     ++SY DY+K+RYNI ++   QP V++R     IR    +                  + I  EL    G +D  + +    + +    +  P +R++ +  F   +   +++   +K W++++++  +EI  R LPP  ++ G QK+   + R   DW     +F T S  KN  I+   ++   RN    Q+F+Q       ++ +N        C P   +I +  N    ++ D        + M ++   +++ Y+ +K  T     + +Q VT +    R  K   +  +A+K V+Q+ +K    PW V I L   M VG D  HS   K KS  A V +++   + +Y S +N     QE  E +  N A AL+ +  ++   P+RI+ +RDGVGD Q++     E + LK  ++++Y+  G     ++ +++V KRI++++F   +NP PGT+VD  +  P  Y+FFLVSQ    GT SPT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVPA  HYAH+LA L+ +
Sbjct:   25 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRR---------SFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-------------DPQAKINLENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQ-----------------AIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTN---EFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          
BLAST of Pmo_009451 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 251.521 bits (641), Expect = 1.042e-69
Identity = 215/819 (26.25%), Postives = 378/819 (46.15%), Query Frame = 3
Query:  207 QPTDITEKMGNIGKTVKLASNFAK------FSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTE--------DEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ----------LVGRDIITKYNNKTYRISDIKEMSVS-EQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDVVSGGQKM---NERIPDDWKFGRVKFATSSR-KNHEID---IVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGP--NDIENILNDIMRRSRD-------AVKMALVFVSDDKMYARVKNFTLTT-GLLTQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFT-QYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPI-PQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK 2516
            +P  +T K G +G  + + +N+ K      ++I Q    F  DV  + L           S + +   + G + FDG  +F   ++    D     E        +  +I I+ + +V     E +Q++N++       +  + + R Y+                    + NFR  +  G+ T++++       +  LL  E  ++V+   ++ N  S    D           ++G  I+T YNNKTYRI D+   S    +F     ++SY DY+K+RYNI ++   QP V++R     IR    +                  + I  EL    G +D  + +    + +    +  P +R++ +  F   +   +++   +K W++++++  +EI  R LPP  ++ G QK+   + R   DW     +F T S  KN  I+   ++   RN    Q+F+Q       ++ +N        C P   +I +  N    ++ D        + M ++   +++ Y+ +K  T     + +Q VT +    R  K   +  +A+K V+Q+ +K    PW V I L   M VG D  HS   K KS  A V +++   + +Y S +N     QE  E +  N A AL+ +  ++   P+RI+ +RDGVGD Q++     E + LK  ++++Y+  G     ++ +++V KRI++++F   +NP PGT+VD  +  P  Y+FFLVSQ    GT SPT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVPA  HYAH+LA L+ +
Sbjct:   96 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRR---------SFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-------------DPQAKINLENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQ-----------------AIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTN---EFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          
BLAST of Pmo_009451 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 249.98 bits (637), Expect = 3.919e-69
Identity = 203/817 (24.85%), Postives = 365/817 (44.68%), Query Frame = 3
Query:  234 GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSV-----------VNAYSKGRSDQLVGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTGIRXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWSLKIENRPLEIEGRELPPVDV------VSGGQKMNERIPDDWKFGRVKFATSSRKNHEIDIVVIDR----NDFNYQK----FIQDVKNELRNLNVNAKVTSVEKCGPNDIENILNDIMRRSRDAVKMALVFVSD--DKMYARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2579
            G+ G +V +  N+ K +  +    F Y+V       +   ++K ++     + L G   FDG  L+       +  +     ++ ++ IR +           Q+ N++F+ +   +   +  R  F             S P    +    V  G+ T +      +     +L  +  +R+L + +V           V  Y +     LVG  ++T+YNN+TY+I+DI  + + + QF++     SY +Y+K+ +NI ++  NQP + +  +  GI                P     +   +  ELC+L G  D+ + +N L + +    +  P QR   +  F + +  +  A   +  W L + N   +I GR++    +      VS G+               +F+  +  N  + +V + +    +  NY++     + ++K    +L +N    ++     + I+  +  + R      +M +    +  D  YA +K    +   + +Q +  +   N +  R   V  K V+Q+  K G   W V+I  +  MI G+D+YH  + +  S+ A V SINS+++Q+ S       R+E    L  +F  AL+ +  +    P  I+IYRDG+GD Q++    +E     P  E +  ++     +I Y+VV+KRI+T+ F       +NP PGT+VD+ + K N Y+FFLVSQ   +GT +PT+Y VL D              P+ +QK++Y L  LY+NW GT+R+PA   YAH+LA LIG+ I +    A     + ++LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLN--DHKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-----------DPSRPKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------------PAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRS-------------AEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRS--VVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEA-----LSEKLFYL 867          
The following BLAST results are available for this feature:
BLAST of Pmo_009451 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+068.08RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+062.61RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+056.52RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE1.214e-7728.36RecName: Full=Piwi-like protein 1[more]
gi|74716803|sp|Q96J94|PIWL1_HUMAN4.678e-7627.32RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Pmo_009451 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+067.41SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261770.000e+056.57SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001117.295e-6325.95Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389363.822e-2923.68dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329881.914e-2723.40SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
BLAST of Pmo_009451 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|1.766e-7627.32piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|1.766e-7627.32PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|1.766e-7627.32PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|1.766e-7627.32PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|1.766e-7627.32PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Pmo_009451 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|1.303e-7326.64piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|1.303e-7326.64piwi, isoform B [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|7.733e-7026.25aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|1.042e-6926.25aubergine, isoform A [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|3.919e-6924.85argonaute 3, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_009451 ID=Pmo_009451|Name=Pmo_009451|organism=Phagocata morgani|type=mRNA|length=3079bp
CTTGTTATAATCTCAGTCTTTATTTCTAATCGTTGTTTTATTGTTTTATT
TTAAAGTTTCATTTTGTAATTAAAAGATAAAAAATGGAGGATTTAAATCC
GGCTAAAATAAGAAAAACTGAAGACAGTGACGGTAGAGGTGGTAAAGGTT
CCAGAGGTTCTCGAGGAGGTCTTCAAAGGAGATTTCGAATTTTGGAGCCT
AACCTACAGCCTACCGATATAACGGAAAAAATGGGCAATATCGGGAAAAC
TGTAAAACTGGCATCCAATTTTGCAAAGTTTTCGATATGTCAAGTCGATA
CCTTTTTCATGTATGATGTTGTTTTGAGTGACCTAGGTGTTGCTCCAAAA
GGAAAGCTGAAAATAATCAGTAAAGTTCAACAAACTAATAATTTACGTGG
GCCATTTTGCTTTGACGGACGTCGTTTATTTACAGGAGAAAAATGGCACG
GCGAAAGTGACATAAGTGAATTTACTGAAGATGAAAAAAAAATTACAATT
CGATTTATAACAAATGTTACGGGCGGCACTGAAGAATATTATCAAATGGT
AAATGTAATGTTTAATAACATTCAAGTTTTCATGGGCCAAGAAAGGATAG
GGCGTGCATATTTCTTAGGGGCTAATACTGATAAACGTGATGTTGCAAAG
GGTTCCGGTCCAACATACTTTGAAGTTAATAATTTTCGGGTACTCGGAGG
ATTTTCTACAACATTACAAAGAGGTACACGGCCCGACGGTTCCAGTTCAA
CCTTATTATACATTGAAAGAATCAATCGTGTATTAAACGAAAATAGTGTT
GTAAATGCATATAGTAAAGGTCGATCAGATCAACTTGTTGGTAGAGATAT
AATCACCAAATACAATAATAAGACCTACAGAATTAGTGACATTAAAGAAA
TGTCTGTTAGCGAACAATTTGATTTGGCCGGAAGAAAATTGTCTTATTAT
GATTATTTTAAAGAGCGATATAACATTAAATTACAACATTCTAACCAGCC
ATTTGTACTTACTCGAATGCGTAGAACTGGAATTAGAAAAAAGAAACCTG
AAAAGCCAGAGGAGGCCCCTGAAGAACCACCGCCCGAGCCTGAACCAGAA
ATGACTCTAAACATTCCAGGTGAGTTGTGCTTTTTGTGCGGTTTTTCTGA
TCAAGAAAAAGGTAATAATGACCTTCAAAAAAATCTTGGAGGTATTTTAA
AACGTGAACCCAGGCAAAGGTTAGATGATATTCCTGCCTTTTGTGACTGG
ATTGGGAAAAGTGAAAAGGCTAGCAGCTTTATGAAGGAATGGAGTTTAAA
AATTGAAAACCGTCCTTTGGAGATAGAAGGGCGTGAATTGCCGCCAGTAG
ATGTTGTTTCAGGTGGTCAAAAAATGAATGAACGTATTCCAGATGATTGG
AAGTTTGGCAGAGTAAAATTCGCGACTAGTAGCCGTAAGAATCATGAAAT
TGACATTGTAGTTATCGACAGGAATGACTTCAACTATCAAAAATTCATTC
AAGATGTCAAGAACGAACTTCGTAATCTTAATGTTAATGCTAAAGTAACA
AGTGTTGAAAAATGTGGTCCAAATGATATCGAAAATATTTTGAATGATAT
AATGCGTCGATCTAGAGATGCCGTTAAAATGGCATTGGTCTTTGTCTCTG
ATGATAAAATGTACGCTCGTGTTAAAAATTTTACGTTAACTACAGGTCTT
TTGACACAATGTGTAACTCAGAGAAACGCAACAAATCGTATGGATAAACG
TCGCCAGGTAGTTGCAAGTAAGTCTGTAATGCAAATATTCAGCAAGTTTG
GATACGATCCTTGGAATGTTGAAATTAAGCTTAGGCCTACTATGATTGTC
GGACTCGATACTTATCATAGTAAAACAGGGAAAAAGTCAATTCAAGCTTC
GGTCTATTCAATAAATAGCACGTTTACTCAATATTTAAGTTTCATTAATA
ACCCTAAGGGTCGTCAGGAGTTCCATGAAGTTCTCGGCAGAAACTTTGCA
GCTGCATTGCAACAGTTTCATTCAAAGTATGAAATTTACCCCCAGAGGAT
AATGATATATCGAGATGGTGTTGGTGATTCGCAAATGTTTTTTACCAAAC
AATTTGAAGCGGACGCATTGAAGCCTATTATGGAGAAGCTCTATCAAGAC
AAAGGTTTTCCAATTCCGCAGATCATTTACGTTGTCGTCAAGAAGCGGAT
CAGTACCAAGTTCTTTAAAAATGGACAGAACCCTGAGCCTGGTACGATAG
TTGACAAAGAGGTTGTAAAGCCCAATTTCTATGAATTCTTTCTTGTTTCG
CAAAGAACTACGAAAGGTACGGCTAGTCCTACTAATTATAATGTACTCGA
GGATACAAAACTGTTAACAAAGAAGGGCGTTATGGAACCGATGGCTCCAA
ATGAGCTTCAAAAAATAACGTATACGCTTACTCATCTTTATTTCAATTGG
ATGGGTACAATTAGAGTTCCAGCACCTACTCATTACGCACATCGTTTGGC
AGAGCTCATTGGTAAAATTCACAAGGGCACTAATCCTGCGGTAATTAATG
ACCGTATTCGAGATCGATTGTTCTATCTCTGAGCAGAATGGTCGCATTCA
AAGTCGTTGTTACTATTATTATTATTATTTGTATGGATATTTTAGGCTAT
CTTTGTTGTATCTGAATGTTTAAGTTTAGCATCGTTACAAATACATAATT
ATAAATTATTAGTATCACCATTATTTATTATCGTGTTTACATTTATATTT
CAATAATAATAAAGTATTGTATTCATTTAGTTGTTGAATGGCGGAATCAT
TATACGTGAACATTTATTGTAAAATCATGTGATTTTTAAACTCGTGTTAT
TCAGTCGATTTTAACCAATTGCATTGAATATATTATTAGTAGCTTTTAGT
GATTGGATAGACTGGGGTTAAAGTGTTAGGACAATATTGATTATATTCTT
GATATTTGCAAGCATTTAATTGTGAATATCTATTAAAGGAGTATGTTATC
GAATTATTTGTTGCCATATTAATTTCTTACAATTTTTATTGAAAAGTTAG
TAATTTTGTTATATTTATCACAGTATTAG

Design Primers for Pmo_009451

back to top

protein sequence

>Pmo_009451-protein ID=Pmo_009451-protein|Name=Pmo_009451|organism=Phagocata morgani|type=polypeptide|length=833bp
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
back to top

coding sequence

>Pmo_009451.84.2582 ID=Pmo_009451.84.2582|Name=Pmo_009451.84.2582|organism=Phagocata morgani|type=CDS|length=2499bp
ATGGAGGATTTAAATCCGGCTAAAATAAGAAAAACTGAAGACAGTGACGG
TAGAGGTGGTAAAGGTTCCAGAGGTTCTCGAGGAGGTCTTCAAAGGAGAT
TTCGAATTTTGGAGCCTAACCTACAGCCTACCGATATAACGGAAAAAATG
GGCAATATCGGGAAAACTGTAAAACTGGCATCCAATTTTGCAAAGTTTTC
GATATGTCAAGTCGATACCTTTTTCATGTATGATGTTGTTTTGAGTGACC
TAGGTGTTGCTCCAAAAGGAAAGCTGAAAATAATCAGTAAAGTTCAACAA
ACTAATAATTTACGTGGGCCATTTTGCTTTGACGGACGTCGTTTATTTAC
AGGAGAAAAATGGCACGGCGAAAGTGACATAAGTGAATTTACTGAAGATG
AAAAAAAAATTACAATTCGATTTATAACAAATGTTACGGGCGGCACTGAA
GAATATTATCAAATGGTAAATGTAATGTTTAATAACATTCAAGTTTTCAT
GGGCCAAGAAAGGATAGGGCGTGCATATTTCTTAGGGGCTAATACTGATA
AACGTGATGTTGCAAAGGGTTCCGGTCCAACATACTTTGAAGTTAATAAT
TTTCGGGTACTCGGAGGATTTTCTACAACATTACAAAGAGGTACACGGCC
CGACGGTTCCAGTTCAACCTTATTATACATTGAAAGAATCAATCGTGTAT
TAAACGAAAATAGTGTTGTAAATGCATATAGTAAAGGTCGATCAGATCAA
CTTGTTGGTAGAGATATAATCACCAAATACAATAATAAGACCTACAGAAT
TAGTGACATTAAAGAAATGTCTGTTAGCGAACAATTTGATTTGGCCGGAA
GAAAATTGTCTTATTATGATTATTTTAAAGAGCGATATAACATTAAATTA
CAACATTCTAACCAGCCATTTGTACTTACTCGAATGCGTAGAACTGGAAT
TAGAAAAAAGAAACCTGAAAAGCCAGAGGAGGCCCCTGAAGAACCACCGC
CCGAGCCTGAACCAGAAATGACTCTAAACATTCCAGGTGAGTTGTGCTTT
TTGTGCGGTTTTTCTGATCAAGAAAAAGGTAATAATGACCTTCAAAAAAA
TCTTGGAGGTATTTTAAAACGTGAACCCAGGCAAAGGTTAGATGATATTC
CTGCCTTTTGTGACTGGATTGGGAAAAGTGAAAAGGCTAGCAGCTTTATG
AAGGAATGGAGTTTAAAAATTGAAAACCGTCCTTTGGAGATAGAAGGGCG
TGAATTGCCGCCAGTAGATGTTGTTTCAGGTGGTCAAAAAATGAATGAAC
GTATTCCAGATGATTGGAAGTTTGGCAGAGTAAAATTCGCGACTAGTAGC
CGTAAGAATCATGAAATTGACATTGTAGTTATCGACAGGAATGACTTCAA
CTATCAAAAATTCATTCAAGATGTCAAGAACGAACTTCGTAATCTTAATG
TTAATGCTAAAGTAACAAGTGTTGAAAAATGTGGTCCAAATGATATCGAA
AATATTTTGAATGATATAATGCGTCGATCTAGAGATGCCGTTAAAATGGC
ATTGGTCTTTGTCTCTGATGATAAAATGTACGCTCGTGTTAAAAATTTTA
CGTTAACTACAGGTCTTTTGACACAATGTGTAACTCAGAGAAACGCAACA
AATCGTATGGATAAACGTCGCCAGGTAGTTGCAAGTAAGTCTGTAATGCA
AATATTCAGCAAGTTTGGATACGATCCTTGGAATGTTGAAATTAAGCTTA
GGCCTACTATGATTGTCGGACTCGATACTTATCATAGTAAAACAGGGAAA
AAGTCAATTCAAGCTTCGGTCTATTCAATAAATAGCACGTTTACTCAATA
TTTAAGTTTCATTAATAACCCTAAGGGTCGTCAGGAGTTCCATGAAGTTC
TCGGCAGAAACTTTGCAGCTGCATTGCAACAGTTTCATTCAAAGTATGAA
ATTTACCCCCAGAGGATAATGATATATCGAGATGGTGTTGGTGATTCGCA
AATGTTTTTTACCAAACAATTTGAAGCGGACGCATTGAAGCCTATTATGG
AGAAGCTCTATCAAGACAAAGGTTTTCCAATTCCGCAGATCATTTACGTT
GTCGTCAAGAAGCGGATCAGTACCAAGTTCTTTAAAAATGGACAGAACCC
TGAGCCTGGTACGATAGTTGACAAAGAGGTTGTAAAGCCCAATTTCTATG
AATTCTTTCTTGTTTCGCAAAGAACTACGAAAGGTACGGCTAGTCCTACT
AATTATAATGTACTCGAGGATACAAAACTGTTAACAAAGAAGGGCGTTAT
GGAACCGATGGCTCCAAATGAGCTTCAAAAAATAACGTATACGCTTACTC
ATCTTTATTTCAATTGGATGGGTACAATTAGAGTTCCAGCACCTACTCAT
TACGCACATCGTTTGGCAGAGCTCATTGGTAAAATTCACAAGGGCACTAA
TCCTGCGGTAATTAATGACCGTATTCGAGATCGATTGTTCTATCTCTGA
back to top
Gene Groups
Pmo_009451 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.