Pmo_008579, Pmo_008579 (mRNA) Phagocata morgani

Overview
NamePmo_008579
Unique NamePmo_008579
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length768
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_008579 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 136.732 bits (343), Expect = 5.263e-36
Identity = 83/253 (32.81%), Postives = 146/253 (57.71%), Query Frame = 1
Query:    1 KLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLG 759
            KL++ ++  I+ +  ++V+ K Y   P+ C++    +    E Y ENYCWV  T  +   + IP N   +A  +N R+I YYQWVPF+L L+ ++FY+P I+W+L+ +   G ++++LV  A  +  +    R   ++ IA  +E+ L+     +H  ++  R +L    N  + ++  G  +   Y+ +K LYT N++ Q++++ +FLG  S  K +G  VL++++ G+EW ESG FPRVT C   E++ LG
Sbjct:   26 KLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHN---YAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALH----VKHQVMSGNRLKLL---NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRS--KWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLG 262          
BLAST of Pmo_008579 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 125.176 bits (313), Expect = 1.738e-31
Identity = 80/255 (31.37%), Postives = 134/255 (52.55%), Query Frame = 1
Query:    1 KLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYR--HGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLG 759
            KL++ ++  IL    ++V+ K Y   P+ C++    + +  E Y ENYCWV  T  +   E IP+           R+I YYQWVPFIL ++ ++FY+P I+W+ + Y   G NL+ LV  A  A  +    +   V  +AR ++D +      R  H +      QL   C      +H G ++ + Y+ +K LY+ N++ Q +++   LG N     +G+++L +++   EW ++G+FPRVT C   E+R LG
Sbjct:  144 KLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYS----RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANC-----GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLG 385          
BLAST of Pmo_008579 vs. uniprot
Match: gi|10719983|sp|Q27295|EAT5_CAEEL (RecName: Full=Innexin eat-5; AltName: Full=Abnormal pharyngeal pumping eat-5)

HSP 1 Score: 122.094 bits (305), Expect = 1.375e-30
Identity = 72/234 (30.77%), Postives = 119/234 (50.85%), Query Frame = 1
Query:   61 KSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRH-GKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLG 759
            + Y   PL C++    + + +E Y E+YC+V+ T  + P +K+P   E       ++++ YYQW PFI+ ++   FY+P I W ++   K G N+  LV  A  A      ERK +++ I R I + L + R+     K+A ++R         +F    G ++   Y++ K +Y  N   Q Y    FLG N     +G  +LD+I++G +W  SG FPR+  C   ++R LG
Sbjct:   42 RQYVGSPLQCWVPAQFTKA-WEQYAEDYCFVYNTYWVKPNDKVPLTVEERV----SQQLIYYQWAPFIMAIEAAFFYLPVIFWSMLS-TKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRRNEEETTKMAKIQR---------IFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPY--WGMRILDDILKGTDWEHSGNFPRIAMCDF-QVRVLG 257          
BLAST of Pmo_008579 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 115.161 bits (287), Expect = 3.307e-28
Identity = 80/242 (33.06%), Postives = 122/242 (50.41%), Query Frame = 1
Query:   61 KSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPP-AERKDKVEGIARTIEDMLYQH----RDYRHGKIADMRRQLFEKCNFCVFSKHL-GTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            K Y   P+ C++    S  + E Y+E+YCW+  T  I   E +P +          ++I YYQWVPFIL  + +MF +P I W+L C  + G N++TL+  A  A  +   ++R+  VE I     D L       R    G IA ++           FS+ L G  + + Y   K LY+ N+++Q +I+ + L  +S    FG+ VL +I  G+ W E+G FPRVT C   E+R+L   N
Sbjct:   46 KQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTA----REEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLN 268          
BLAST of Pmo_008579 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 113.62 bits (283), Expect = 1.487e-27
Identity = 79/242 (32.64%), Postives = 122/242 (50.41%), Query Frame = 1
Query:   61 KSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLV-ANANSANEIPPAERKDKVEGIARTIEDMLYQH----RDYRHGKIADMRRQLFEKCNFCVFSKHL-GTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            K Y   P+ C++    S  + E Y+E+YCW+  T  I   E +P +          ++I YYQWVPFIL  + +MF +P I W+L C  + G N++TL+ A  +    +  ++R+  VE I     D L       R    G IA ++           FS+ L G  L + +   K LY+ N+++Q  I+ + L  +S    FG+ VL++I  G+ W E+G FPRVT C   E+R+L   N
Sbjct:   62 KQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTA----REEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLN 284          
BLAST of Pmo_008579 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 401.364 bits (1030), Expect = 1.281e-138
Identity = 186/256 (72.66%), Postives = 221/256 (86.33%), Query Frame = 1
Query:    1 KLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            KLSFLFSV +LI+SMM+VT+KSY FKPLACY AT P GSNFENYLENYCWVHGTIT LPGE IPQND  WA  D+TRRI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK GTNLE++V +AN+AN  PP ERKDK+E IARTIEDML+QHRDYR G  A +RR+++  CNFCVFSKH+GTWL+LSY+L+KFLY  N+I QL+IMK FLGFN++  +FGYTVL N++ GKEWH++GIFPRVTYC++  I+H+G +N
Sbjct:   27 KLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVAN 282          
BLAST of Pmo_008579 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 358.221 bits (918), Expect = 7.925e-122
Identity = 165/256 (64.45%), Postives = 211/256 (82.42%), Query Frame = 1
Query:    1 KLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            +L+F+FSVVIL +SM+IVT K+YFFKPL+CY+AT PSG NF+ Y+ENYCWVHGTI  L  E+IP   E WA+ D  +RITYYQWVPFILGLQCI+FYIP+++W++ICYNK+GTNLETL+  A  ++++PP+ERK  +  I R IED+LYQHRDYR GK+A  RR+++E CNFCVFSKHLGTWLV +Y  +K LY  N+I QLY+MKSFLGFNSSM +FGYT+L++I+ GK WHE+  FPRV+YC+  +I+HLGA N
Sbjct:   27 RLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVN 282          
BLAST of Pmo_008579 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 265.003 bits (676), Expect = 1.897e-85
Identity = 128/256 (50.00%), Postives = 182/256 (71.09%), Query Frame = 1
Query:    1 KLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            K+S +FSV+IL + + IVT+KSY  KP++CY++  PSG NF++Y+ENYCW+HGTI + P +K+  N  GW  L+ T++I YYQWVPFILGLQCIMFYIP++IWQ+ C+N+ GTNL+T++  +    EIP +ER+ + E IA+ IE+ML  HRD+R  KIA++RR ++ KC+  + SK LGT +V SY + K LY  N I QL++++S LGF + + TFG  +   IV G E      FPRV +C++  IRH+G  N
Sbjct:   27 KMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQN 282          
BLAST of Pmo_008579 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 251.906 bits (642), Expect = 5.356e-80
Identity = 128/256 (50.00%), Postives = 175/256 (68.36%), Query Frame = 1
Query:    1 KLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            K +FLF+V++L+I   IVT+K Y  KP++CYI+T+ SG+N   Y+ENYCWV GTI I    KIP  +E WA L N  +I YYQWVPF+L LQ IMFYIPR+IWQ+ CYN  GT++  L+ +AN A       R   V  IA+TIE MLYQHRD R+G++A  RR L++ C FC+ SK  GT L+  Y ++KFLY  N I QLY MK FLG N +   FG+ ++ NI+ G++W  + +FPRV YC++  ++++G +N
Sbjct:   27 KFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAEL-NKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTN 279          
BLAST of Pmo_008579 vs. Smed Unigenes AA
Match: SMU15018264 (SmedSxldir_c107242_g1_i1|m.71544|m.38668)

HSP 1 Score: 244.202 bits (622), Expect = 1.725e-77
Identity = 110/238 (46.22%), Postives = 161/238 (67.65%), Query Frame = 1
Query:   61 KSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGF--NSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASN 768
            K+Y  KPL+CY A  P+GSNF+ YL NYCW+ GT+  +PG+K PQ  +   + D+ ++I YYQWVPF+L LQCIMFY+PR+ WQL+ YNK+G +LE +  +A+SA+    A RK K +GIA+ + ++ + HRDY++G  A+ RR++F+  +F + SK LGTWL   Y +MK ++  N + QLY+++ FLGF  N+  +T      D++V G +W  S +FPRVT C I  I+ LG  N
Sbjct:   47 KTYILKPLSCYTAISPTGSNFDGYLRNYCWITGTVPWVPGDKFPQVGDDMKLDDSLKKINYYQWVPFVLALQCIMFYLPRLFWQLMSYNKIGIDLELIFKDASSASNDDEAARKKKAKGIAKNLANVFFFHRDYKYGTWANFRRKIFKFASFFMMSKRLGTWLTYWYFVMKLMFLANAVGQLYLIQRFLGFHGNNIFET-SRVFFDSLVNGVQWTTSRLFPRVTVCSIDNIKLLGVEN 283          
BLAST of Pmo_008579 vs. RefSeq Drosophila melanogaster
Match: gi|161077972|ref|NP_608410.2| (shaking B, isoform D [Drosophila melanogaster])

HSP 1 Score: 62.3882 bits (150), Expect = 7.439e-11
Identity = 59/238 (24.79%), Postives = 94/238 (39.50%), Query Frame = 1
Query:   61 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITILP------GEKIP----QNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYC 732
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +G   L   +   YYQWV F L  Q I+FY PR +W+     K+   +  L     S  E          +   + + D L+++  Y +                         W    Y + + L   N+I Q+++M  F  F+    TFG  V+D +   +E        IFPR+T C
Sbjct:  204 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAE---------KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKC 399          
BLAST of Pmo_008579 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 61.6178 bits (148), Expect = 1.229e-10
Identity = 59/238 (24.79%), Postives = 94/238 (39.50%), Query Frame = 1
Query:   61 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITILP------GEKIP----QNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYC 732
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +G   L   +   YYQWV F L  Q I+FY PR +W+     K+   +  L     S  E          +   + + D L+++  Y +                         W    Y + + L   N+I Q+++M  F  F+    TFG  V+D +   +E        IFPR+T C
Sbjct:   33 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAE---------KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKC 228          
BLAST of Pmo_008579 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 61.6178 bits (148), Expect = 1.251e-10
Identity = 59/238 (24.79%), Postives = 94/238 (39.50%), Query Frame = 1
Query:   61 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITILP------GEKIP----QNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYC 732
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +G   L   +   YYQWV F L  Q I+FY PR +W+     K+   +  L     S  E          +   + + D L+++  Y +                         W    Y + + L   N+I Q+++M  F  F+    TFG  V+D +   +E        IFPR+T C
Sbjct:   49 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAE---------KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKC 244          
BLAST of Pmo_008579 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 61.6178 bits (148), Expect = 1.251e-10
Identity = 59/238 (24.79%), Postives = 94/238 (39.50%), Query Frame = 1
Query:   61 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITILP------GEKIP----QNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYC 732
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +G   L   +   YYQWV F L  Q I+FY PR +W+     K+   +  L     S  E          +   + + D L+++  Y +                         W    Y + + L   N+I Q+++M  F  F+    TFG  V+D +   +E        IFPR+T C
Sbjct:   49 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAE---------KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKC 244          
BLAST of Pmo_008579 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 61.6178 bits (148), Expect = 1.251e-10
Identity = 59/238 (24.79%), Postives = 94/238 (39.50%), Query Frame = 1
Query:   61 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITILP------GEKIP----QNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLISQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYC 732
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +G   L   +   YYQWV F L  Q I+FY PR +W+     K+   +  L     S  E          +   + + D L+++  Y +                         W    Y + + L   N+I Q+++M  F  F+    TFG  V+D +   +E        IFPR+T C
Sbjct:   49 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAE---------KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKC 244          
The following BLAST results are available for this feature:
BLAST of Pmo_008579 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL5.263e-3632.81RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.738e-3131.37RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|10719983|sp|Q27295|EAT5_CAEEL1.375e-3030.77RecName: Full=Innexin eat-5; AltName: Full=Abnorma... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR3.307e-2833.06RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL1.487e-2732.64RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
back to top
BLAST of Pmo_008579 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008371.281e-13872.66Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006577.925e-12264.45Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150281811.897e-8550.00SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
SMU150331265.356e-8050.00SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150182641.725e-7746.22SmedSxldir_c107242_g1_i1|m.71544|m.38668[more]
back to top
BLAST of Pmo_008579 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pmo_008579 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|161077972|ref|NP_608410.2|7.439e-1124.79shaking B, isoform D [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|1.229e-1024.79shaking B, isoform C [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|1.251e-1024.79shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|1.251e-1024.79shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|1.251e-1024.79shaking B, isoform I [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_008579 ID=Pmo_008579|Name=Pmo_008579|organism=Phagocata morgani|type=mRNA|length=768bp
AAACTGAGCTTCTTGTTCAGTGTCGTCATCTTGATTATATCTATGATGAT
AGTCACAGTTAAGTCGTATTTCTTTAAACCTCTCGCATGTTATATAGCGA
CTGTTCCAAGTGGTTCTAATTTTGAAAACTATTTGGAAAATTATTGTTGG
GTTCATGGAACAATTACAATTTTACCAGGTGAAAAAATTCCCCAAAATGA
TGAAGGATGGGCGATGTTGGACAATACGAGAAGAATAACATATTATCAAT
GGGTTCCATTCATTCTTGGTTTGCAATGCATCATGTTTTATATTCCCCGA
ATCATATGGCAACTTATATGTTATAATAAAGTTGGTACAAATTTGGAAAC
TCTAGTAGCTAACGCAAACTCTGCCAACGAGATCCCACCTGCAGAAAGGA
AAGATAAAGTTGAAGGAATCGCTCGAACGATTGAAGATATGCTGTATCAA
CATAGGGATTATCGTCACGGTAAAATAGCTGACATGAGAAGACAATTATT
TGAAAAATGTAACTTTTGTGTGTTCTCAAAACATCTTGGCACCTGGCTTG
TATTATCGTATATGTTAATGAAGTTTCTGTACACATTTAATTTAATCAGT
CAGCTGTATATAATGAAAAGTTTCTTGGGTTTTAACAGTTCAATGAAGAC
GTTTGGTTACACAGTGCTGGATAATATTGTTCAAGGAAAGGAATGGCATG
AAAGTGGAATATTTCCTCGAGTTACCTATTGTCACATTGGCGAAATCAGA
CATTTAGGGGCAAGTAAC

Design Primers for Pmo_008579

back to top

protein sequence

>Pmo_008579-protein ID=Pmo_008579-protein|Name=Pmo_008579|organism=Phagocata morgani|type=polypeptide|length=256bp
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
back to top

coding sequence

>Pmo_008579.1.768 ID=Pmo_008579.1.768|Name=Pmo_008579.1.768|organism=Phagocata morgani|type=CDS|length=768bp
AAACTGAGCTTCTTGTTCAGTGTCGTCATCTTGATTATATCTATGATGAT
AGTCACAGTTAAGTCGTATTTCTTTAAACCTCTCGCATGTTATATAGCGA
CTGTTCCAAGTGGTTCTAATTTTGAAAACTATTTGGAAAATTATTGTTGG
GTTCATGGAACAATTACAATTTTACCAGGTGAAAAAATTCCCCAAAATGA
TGAAGGATGGGCGATGTTGGACAATACGAGAAGAATAACATATTATCAAT
GGGTTCCATTCATTCTTGGTTTGCAATGCATCATGTTTTATATTCCCCGA
ATCATATGGCAACTTATATGTTATAATAAAGTTGGTACAAATTTGGAAAC
TCTAGTAGCTAACGCAAACTCTGCCAACGAGATCCCACCTGCAGAAAGGA
AAGATAAAGTTGAAGGAATCGCTCGAACGATTGAAGATATGCTGTATCAA
CATAGGGATTATCGTCACGGTAAAATAGCTGACATGAGAAGACAATTATT
TGAAAAATGTAACTTTTGTGTGTTCTCAAAACATCTTGGCACCTGGCTTG
TATTATCGTATATGTTAATGAAGTTTCTGTACACATTTAATTTAATCAGT
CAGCTGTATATAATGAAAAGTTTCTTGGGTTTTAACAGTTCAATGAAGAC
GTTTGGTTACACAGTGCTGGATAATATTGTTCAAGGAAAGGAATGGCATG
AAAGTGGAATATTTCCTCGAGTTACCTATTGTCACATTGGCGAAATCAGA
CATTTAGGGGCAAGTAAC
back to top
Gene Groups
Pmo_008579 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.