Pmo_002658, Pmo_002658 (mRNA) Phagocata morgani

Overview
NamePmo_002658
Unique NamePmo_002658
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length3176
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_002658 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 341/480 (71.04%), Postives = 410/480 (85.42%), Query Frame = 1
Query: 1174 FLIKKKSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSF-INNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 2610
            F  ++KSN DLQKNLG +LKREPR+RLDDIPA+C+WI  S+ A+    +W LKI+N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + HEID+VI+DRNDF Y+ F+ DV+ ELRN+ ++A+V  V  CGPNDVE  LND  R      KMALVFVPDD+VYA+VK+FT+STGLLTQCVT RNGTN+ DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYHNK+ KKSIQASV+SINSTFTQY+SF +N+P+GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL
Sbjct:  354 FSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 414.075 bits (1063), Expect = 0.000e+0
Identity = 208/326 (63.80%), Postives = 255/326 (78.22%), Query Frame = 3
Query:  216 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEK 1190
            I+EPNLQP DITEK GNIG+TVKL SNF KFS+   + F MYD V S +G++PK KL+ I +V Q N + G FCFDGRRLFT EKWHGESDI EF+ D+KK+T+R ++ +   TEEYYQM+NV+ NN+QV +GQERIGK YFL  N  K +V + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQLIGRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++     +KK +E   E  +E     E +MTLNIPGELCFLCGFSDQEK
Sbjct:   34 IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEK 359          
BLAST of Pmo_002658 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 291/480 (60.62%), Postives = 376/480 (78.33%), Query Frame = 1
Query: 1174 FLIKKKSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 2610
            F   ++SN +LQKNLG +LKREPR+RL+DI  FC W G + K+  +MK W + IE +P+ I GREL PVD+ S   K+N +IPDDWKFG +KF       H   ++++DRN  ++  FI+DVK E+  L +N  + S+  C  N+VE+ L D +R S+  V MALVF+PDDKVYA+VKNFT+STGLLTQCVT RNG+N+ D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+H+KTGK+S+QASV+SI++ F+QY+SF+N+ +G+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  P  INDRIR+RLFYL
Sbjct:  334 FSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 328.946 bits (842), Expect = 0.000e+0
Identity = 165/325 (50.77%), Postives = 231/325 (71.08%), Query Frame = 3
Query:  216 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEK 1190
            I+EP LQP  +T+K+G  G+ V L SN+A F+I     FYMYDVV+ +  I  + KL+++     + N   PFCFDGRRLFT  KWH + D       D +++IR +T     +EEYYQM+N++FNNIQ+FMGQE+IG+ +FLG+N +   + +G  P++F+++NF++LGG+STT+ RGT  +G++STLLY+ERINRVLNEN+VV+ Y + + DQLIGRDIITKYNNKTYRISDIKEM V+++  L  +K+SY +YFK+RYNI L++  QPFV+      +  K+    P E+   EP    E + +L+IPGELC+LCGFSD E+
Sbjct:   25 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVI------SRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSER 339          
BLAST of Pmo_002658 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 327/512 (63.87%), Postives = 405/512 (79.10%), Query Frame = 1
Query: 1090 KSHHKNH-PKNLNLK*H*IFQVNCVSYVDFLI----KKKSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 2610
            K H++N  P++++L       +N    + FL     ++KSN DLQKNLG +LKR PR+RLDDIP+FCDWI  +  +     +W LKI+N PLEIEGRELP  DV+SGGQ++NE+I DDWKFG+V+F       HEID+VI+DRND  Y  F+ DV+ E++ L  +AK+  V  C  NDVE  LND+MR      K+ALVFVPDD+VYA+VK+FT+STGLLTQCVT RNGTN+ DKRRQVV+SK+VMQIFSKFGYDPW ++IK+RPTMIVG+DT+HNK  KKSI ASV+SINSTF+QY+SF N+P+G+QEFH+ L  NF AAL +F   Y+I P RIM+YRDGVGDSQ+ FTKQFE DA+KP++E +Y++ G  +PQIIYV+VKKRI TK F  G N  PGTIVDKE+VKPNF+EFFLVSQR T+GTASPTNYNVLEDT+   K G++E + PNELQ+ITYTLTHLYFNWMGTIRVP P HYAH+LAELIGK+HKG+ PA+IN+RIR+RLFYL
Sbjct:  313 KEHNENEAPEDMDL------TLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 378.252 bits (970), Expect = 7.175e-114
Identity = 185/325 (56.92%), Postives = 240/325 (73.85%), Query Frame = 3
Query:  216 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEK 1190
            I+EP+LQP +  +K+GN+GK V+L SNF KFS++  + + MYD   S +G++PK KL+I+ ++ +  N+ G FC+DGRRLFT + W   SDI EFT D+KKV++R ++     TEEYYQM+NV+ NN+Q+ MGQE+IGK YFLG+N++K +V K  GPT+FE NNF+VLGGF TTLQRGTRP+G  +TLLYIERINRVLN+NSV+  Y++   DQLIGRDI+TKYNNKTYRIS+IKEM+++E F++ GR LSY  YFKERYNI L    QPFVL      T  KK       +   E     + ++TLNI GELCFLCGFSDQEK
Sbjct:   27 IVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVL------TRVKKIARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEK 345          
BLAST of Pmo_002658 vs. uniprot
Match: gi|226701015|sp|A6N7Y9|PIWL1_CHICK (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 217.238 bits (552), Expect = 2.373e-57
Identity = 152/496 (30.65%), Postives = 245/496 (49.40%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQ--KVNERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVE-NILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNK-TGKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L +K  N+ ++ K+L    +  P QR  +I    D + K E     +++W L  ++  L   GR +    ++  G     N +  D  +  RV    +++      ++   RN       +Q++     ++ +   K T +E     +    +L   +    + V   L     DK  A  K       + +QCV  R  T    +    + +K  +Q+  K G + W+VEI L+  MIVG+D YH+  +GK+SI   V S+N   T++ S  +   RG QE  + L      AL+++    +  P RI++YRDGVGD Q+     +E       ++ + +D     P++  +VVKKR+ST+FF       +NP PGT+VD EV +P +Y+FF+VSQ    G  +PT+YNV+ DT  L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N       + DRL+YL
Sbjct:  392 LCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGIRMNKATMIEVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRG-QEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN---PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDTSKL---------KPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPNLL-----LSDRLYYL 867          

HSP 2 Score: 64.3142 bits (155), Expect = 4.252e-9
Identity = 63/278 (22.66%), Postives = 125/278 (44.96%), Query Frame = 3
Query:  255 KMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGE-SDISEFTE--DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            K G+ G  +KL +NF + +       Y Y V  +    A + +  ++   Q  + +     FDG  LF  ++   + +++   T   +D ++TI     +   +    Q  N++F  +   M  ++IG+ Y+     + +D      P     +   V  GF++++ +        S +L  +  +++L   +V++             +    + +LIG  ++TKYNN+TYR+ DI  + +    F  A G ++SY DY+K +YN  +   NQP ++
Sbjct:  112 KTGSSGAMIKLIANFFRLTSRPQWALYQYHVDYNPEMEARRLRSGLL--FQHEDLIGKTHAFDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYY-----NPKD------PVSIPNHRLMVWPGFTSSILQY-----EESIMLCADVSHKILRSETVLDFMYSLYEQVEERRFRDACAKELIGVIVLTKYNNRTYRVDDIDWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLI 371          
BLAST of Pmo_002658 vs. uniprot
Match: gi|74716803|sp|Q96J94|PIWL1_HUMAN (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 217.238 bits (552), Expect = 2.846e-57
Identity = 161/504 (31.94%), Postives = 253/504 (50.20%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD---DKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKT-GKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L  K  N+ ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     + +      ++   RN       IQ++      + +   K   +E    +  E  L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH+ T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  386 LCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEV--DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          

HSP 2 Score: 61.6178 bits (148), Expect = 3.081e-8
Identity = 61/280 (21.79%), Postives = 129/280 (46.07%), Query Frame = 3
Query:  255 KMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISE-FTE----DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            K G+ G  V+L++N  + +       Y Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    +D ++TI     +   +    Q  N++F  +   M  ++IG+ Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLV 363          
BLAST of Pmo_002658 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 342/480 (71.25%), Postives = 411/480 (85.62%), Query Frame = 1
Query: 1174 FLIKKKSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 2613
            F  ++KSN DLQKNLG +LKREPR+RLDDIPA+C+WI  S+ A+    +W LKI+N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + HEID+VI+DRNDF Y+ F+ DV+ ELRN+ ++A+V  V  CGPNDVE  LND  R      KMALVFVPDD+VYA+VK+FT+STGLLTQCVT RNGTN+ DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYHNK+ KKSIQASV+SINSTFTQY+SF+N+P+GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL*
Sbjct:  358 FSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          

HSP 2 Score: 412.92 bits (1060), Expect = 0.000e+0
Identity = 204/330 (61.82%), Postives = 255/330 (77.27%), Query Frame = 3
Query:  216 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----MTLNIPGELCFLCGFSDQEK 1190
            I+EPNLQP DITEK GNIG+TVKL SNF KFS+   + F MYD V S +G++PK KL+ I +V Q N + G FCFDGRRLFT EKWHGESDI EF+ D+KK+T+R ++ +   TEEYYQM+NV+ NN+QV +GQERIGK YFL  N  K +V + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQLIGRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++   R++K ++      ++  +  +       MTLNIPGELCFLCGFSDQEK
Sbjct:   34 IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEK 363          
BLAST of Pmo_002658 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 292/481 (60.71%), Postives = 377/481 (78.38%), Query Frame = 1
Query: 1174 FLIKKKSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 2613
            F   ++SN +LQKNLG +LKREPR+RL+DI  FC W G + K+  +MK W + IE +P+ I GREL PVD+ S   K+N +IPDDWKFG +KF       H   ++++DRN  ++  FI+DVK E+  L +N  + S+  C  N+VE+ L D +R S+  V MALVF+PDDKVYA+VKNFT+STGLLTQCVT RNG+N+ D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+H+KTGK+S+QASV+SI++ F+QY+SF+N+ +G+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  P  INDRIR+RLFYL*
Sbjct:  377 FSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          

HSP 2 Score: 328.561 bits (841), Expect = 0.000e+0
Identity = 165/325 (50.77%), Postives = 231/325 (71.08%), Query Frame = 3
Query:  216 ILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEK 1190
            I+EP LQP  +T+K+G  G+ V L SN+A F+I     FYMYDVV+ +  I  + KL+++     + N   PFCFDGRRLFT  KWH + D       D +++IR +T     +EEYYQM+N++FNNIQ+FMGQE+IG+ +FLG+N +   + +G  P++F+++NF++LGG+STT+ RGT  +G++STLLY+ERINRVLNEN+VV+ Y + + DQLIGRDIITKYNNKTYRISDIKEM V+++  L  +K+SY +YFK+RYNI L++  QPFV+      +  K+    P E+   EP    E + +L+IPGELC+LCGFSD E+
Sbjct:   68 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVI------SRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSER 382          
BLAST of Pmo_002658 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 180.644 bits (457), Expect = 2.836e-46
Identity = 141/485 (29.07%), Postives = 239/485 (49.28%), Query Frame = 1
Query: 1204 LQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRKNHEID--IVIIDRNDFN-YQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMA---LVFVPDDKVYARVKNFT-LSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGK-KSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFF----KN-GQ--NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 2613
            L + L    +  P++R + +  F D I   E+A   +  W + IE   + I   ++ P +++  G + +    +  +F +            I+  I+I  ++        +Q + ++   + V      + +   +  E  L ++ R     V++    L  V +D+ Y  +K F  +   + +Q V  +  T K   +   VA    +QI +K G + W V+I ++  M+VGLD +H+  G+ +S+ A V S N+  T++ S  +     +E   VL     + L+ +  +    P+ I +YRDGV D Q+ + ++ E +    + E    D     P ++Y VV+KRI+T+ +    KN GQ  NP PGTIVD  V + N Y+FFLVSQ   +GT +PT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVPAP  YAH+LA ++G+  K    A  ++ + DRLFYL*
Sbjct:  511 LMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK---PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLK----AEPSNLLCDRLFYL* 975          

HSP 2 Score: 57.7658 bits (138), Expect = 3.816e-8
Identity = 65/278 (23.38%), Postives = 120/278 (43.17%), Query Frame = 3
Query:  237 PTDITEKMG---NIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTN--NMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVT--VGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANT---DKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            PT I E      +   ++ L++N+ K   +     Y Y V  +    +   ++KI+  + +++   +     FDG  L+  +    +  I +  +   K  +      T  V   E   + NV+F  I+  +   +IG+ YF        D+R +    G     I NF   GG         +   + S    +  IN+ +N    +   +    +QL+G+ ++T +NN+ YRI+DI    +   +FD  G K+SY DYFK  Y ++++   QP ++
Sbjct:  195 PTQIKEPCNTRNDSSPSLTLSANYVKVRTTQ-PHIYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPG-YVTSIQNFD--GGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAA---INQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIV 465          
BLAST of Pmo_002658 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 120.168 bits (300), Expect = 2.038e-27
Identity = 117/448 (26.12%), Postives = 200/448 (44.64%), Query Frame = 1
Query: 1300 ASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDD--WKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQD-----VKNELRNLNVNAKVTSV-EKC------GPNDVENILNDIMRRSRDAVKMALVFVPDDK-VYARVKNFT-LSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPT------MIVGLDTYHNKTGKK---SIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFF---------KNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLA 2532
            A   ++ + + +  R  +I+GR +P   +  GG+   +  P    W     +F +       I+I +     F  Q+ +++        +L+ ++ +A +  V + C      G + VE +    ++ S   +++ +V +P    VYA VK    +  GL TQCV  +N    ++K      S   ++I  K G     +   +RP       + +G D  H   G K   SI A V S+++  ++Y + ++    RQE  + L       L QF+      P RI+ YRDGV + Q       E  A++    KL   YQ      P I +VVV+KR  T+ F         ++G  P  GT VD+ +  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +PAP +YAH +A
Sbjct:  459 ADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSG------IEIKVWAIACFAPQRTVREDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFR-YLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ------PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPA-GTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Pmo_002658 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 114.39 bits (285), Expect = 1.320e-25
Identity = 115/458 (25.11%), Postives = 204/458 (44.54%), Query Frame = 1
Query: 1297 KASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATNSRK--NHEIDIVIIDRNDFNYQKFIQDVKNEL----RNLNVNAKVTSVEKCGP-NDVENILNDIMRRSRDAVKMA--LVFVP-DDKVYARVKNF-TLSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVE-IKLR-------PTMIVGLDTYHNKTGK----KSIQASVYSINSTFTQYLSFINNPRGRQE------FHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQ--------NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKG 2559
            +   F++ + ++I+ + + ++ R L   + + GGQ+        W     KF     K  N  +  V  +R+     K + D++++L     N+ +    +      P  ++E +  D +R S    K    LVFV  +D+ Y  VK F  +  G++TQC+  +  T    K         ++++  K G   W +  I+ R         M+ G+D  H  + +    KS+ A V S+++  T Y + I     ++E        E+    +   +  + +  ++ P+R++ YRDGV + Q     + E  A++   +KL +D     P I Y+VV+KR   +FF   +        N   GT+VDK++     ++F+L S    +GT+ P +Y+VL D               +ELQ  TY L H+Y     ++  PAPT+YAH LA   G+   G
Sbjct:  536 RGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          
BLAST of Pmo_002658 vs. RefSeq Human
Match: gi|767975980|ref|XP_011537308.1| (PREDICTED: piwi-like protein 1 isoform X1 [Homo sapiens])

HSP 1 Score: 218.394 bits (555), Expect = 1.928e-60
Identity = 160/504 (31.75%), Postives = 253/504 (50.20%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD---DKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKT-GKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L  K  N+ ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     + +      ++   RN       IQ++      + +   K   +E    +  E  L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH+ T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:    6 LCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEV--DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 481          
BLAST of Pmo_002658 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 217.238 bits (552), Expect = 1.074e-57
Identity = 161/504 (31.94%), Postives = 253/504 (50.20%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD---DKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKT-GKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L  K  N+ ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     + +      ++   RN       IQ++      + +   K   +E    +  E  L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH+ T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  386 LCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEV--DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          

HSP 2 Score: 61.6178 bits (148), Expect = 1.163e-8
Identity = 61/280 (21.79%), Postives = 129/280 (46.07%), Query Frame = 3
Query:  255 KMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISE-FTE----DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            K G+ G  V+L++N  + +       Y Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    +D ++TI     +   +    Q  N++F  +   M  ++IG+ Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLV 363          
BLAST of Pmo_002658 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 217.238 bits (552), Expect = 1.074e-57
Identity = 161/504 (31.94%), Postives = 253/504 (50.20%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD---DKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKT-GKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L  K  N+ ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     + +      ++   RN       IQ++      + +   K   +E    +  E  L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH+ T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  386 LCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEV--DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          

HSP 2 Score: 61.6178 bits (148), Expect = 1.163e-8
Identity = 61/280 (21.79%), Postives = 129/280 (46.07%), Query Frame = 3
Query:  255 KMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISE-FTE----DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            K G+ G  V+L++N  + +       Y Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    +D ++TI     +   +    Q  N++F  +   M  ++IG+ Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLV 363          
BLAST of Pmo_002658 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 217.238 bits (552), Expect = 1.074e-57
Identity = 161/504 (31.94%), Postives = 253/504 (50.20%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD---DKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKT-GKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L  K  N+ ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     + +      ++   RN       IQ++      + +   K   +E    +  E  L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH+ T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  386 LCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEV--DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          

HSP 2 Score: 61.6178 bits (148), Expect = 1.163e-8
Identity = 61/280 (21.79%), Postives = 129/280 (46.07%), Query Frame = 3
Query:  255 KMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISE-FTE----DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            K G+ G  V+L++N  + +       Y Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    +D ++TI     +   +    Q  N++F  +   M  ++IG+ Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLV 363          
BLAST of Pmo_002658 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 217.238 bits (552), Expect = 1.074e-57
Identity = 161/504 (31.94%), Postives = 253/504 (50.20%), Query Frame = 1
Query: 1159 VSYVDFLIKKKSNN-DLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNA-KVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD---DKVYARVKNFTLSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKT-GKKSIQASVYSINSTFTQYLS-FINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            + Y+  L  K  N+ ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     + +      ++   RN       IQ++      + +   K   +E    +  E  L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH+ T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  386 LCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEV--DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          

HSP 2 Score: 61.6178 bits (148), Expect = 1.163e-8
Identity = 61/280 (21.79%), Postives = 129/280 (46.07%), Query Frame = 3
Query:  255 KMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISE-FTE----DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            K G+ G  V+L++N  + +       Y Y +  + L  A + +  ++   Q  + +     FDG  LF  ++   +  ++E F++    +D ++TI     +   +    Q  N++F  +   M  ++IG+ Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLV 363          
BLAST of Pmo_002658 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 201.445 bits (511), Expect = 2.642e-53
Identity = 139/458 (30.35%), Postives = 241/458 (52.62%), Query Frame = 1
Query: 1240 PRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV---NERIPDDWKFGRVKFATNSR-KNHEID---IVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGP--NDVENILNDIMRRSRD-------AVKMALVFVPDDKVYARVKNFT-LSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHN-KTGKKSIQASVYSINSTFT-QYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKG-FPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK 2547
            P +R++ +  F   +   +++   +K WN+++++  +EI  R LPP  ++ G QK+   + R   DW     +F T S  KN  I+   ++   RN    Q+F+Q       ++ +N        C P   ++ +  N    ++ D        + M ++  P+++ Y+ +K  T +   + +Q VT++    +  K   +  +A+K V+Q+ +K    PW V I L   M VG D  H+ K   KS  A V +++   + +Y S +N     QE  E +  N A AL+ +  ++   P+RI+ +RDGVGD Q++     E + LK  ++++Y+  G     ++ +++V KRI++++F   +NP PGT+VD  +  P  Y+FFLVSQ    GT SPT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVPA  HYAH+LA L+ +
Sbjct:  342 PDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTN---EFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          

HSP 2 Score: 60.8474 bits (146), Expect = 6.349e-9
Identity = 64/289 (22.15%), Postives = 123/289 (42.56%), Query Frame = 3
Query:  234 QPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTE--------DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ----------LIGRDIITKYNNKTYRISDIKEMSVS-EQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            +P  +T K G +G  + + +N+ K       T Y Y V  +    A + +    S + +   + G + FDG  +F   ++    D     E        ++ ++ I+ + +V     E +Q++N++       +  + + + Y+                    + NFR  +  G+ T++++       +  LL  E  ++V+   ++ N  S    D           ++G  I+T YNNKTYRI D+   S    +F     ++SY DY+K+RYNI ++   QP V+
Sbjct:   25 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRR---SFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-------------DPQAKINLENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVM 292          
BLAST of Pmo_002658 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 201.83 bits (512), Expect = 3.312e-53
Identity = 139/452 (30.75%), Postives = 240/452 (53.10%), Query Frame = 1
Query: 1240 PRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKV---NERIPDDWKFGRVKFATNSR-KNHEID---IVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDVENILN---DIMRRSRDAVKMALVFVPDDKVYARVKNFT-LSTGLLTQCVTVRNGTNKMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHN-KTGKKSIQASVYSINSTFT-QYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKG-FPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK 2547
            P +R++ +  F   +   +++   +K WN+++++  +EI  R LPP  ++ G QK+   + R   DW     +F T S  KN  I+   ++   RN    Q+F+Q       ++ +N      E+  P+D     +   D    +   + M ++  P+++ Y+ +K  T +   + +Q VT++    +  K   +  +A+K V+Q+ +K    PW V I L   M VG D  H+ K   KS  A V +++   + +Y S +N     QE  E +  N A AL+ +  ++   P+RI+ +RDGVGD Q++     E + LK  ++++Y+  G     ++ +++V KRI++++F   +NP PGT+VD  +  P  Y+FFLVSQ    GT SPT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVPA  HYAH+LA L+ +
Sbjct:  413 PDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTN---EFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEI-PDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          

HSP 2 Score: 60.4622 bits (145), Expect = 8.138e-9
Identity = 64/289 (22.15%), Postives = 123/289 (42.56%), Query Frame = 3
Query:  234 QPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTE--------DDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ----------LIGRDIITKYNNKTYRISDIKEMSVS-EQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            +P  +T K G +G  + + +N+ K       T Y Y V  +    A + +    S + +   + G + FDG  +F   ++    D     E        ++ ++ I+ + +V     E +Q++N++       +  + + + Y+                    + NFR  +  G+ T++++       +  LL  E  ++V+   ++ N  S    D           ++G  I+T YNNKTYRI D+   S    +F     ++SY DY+K+RYNI ++   QP V+
Sbjct:   96 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRR---SFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-------------DPQAKINLENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVM 363          
BLAST of Pmo_002658 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 198.364 bits (503), Expect = 3.862e-52
Identity = 143/472 (30.30%), Postives = 231/472 (48.94%), Query Frame = 1
Query: 1189 KSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWK--FGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV---ENILNDIMRRSRDAV----KMALVFVPDDKV--YARVKNFT-LSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHN-KTGKKSIQASVYSI----NSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIG 2544
            +SN  L + +    +  P+QR D + AF   +  + ++   +++WN++++    E++GR +   ++V    KV      DW+  F   +  T      +   VI        Q+   +++  L +L   A    +    P +    ++     +R   D V    K+ L  VP+D    Y+ +K    +   + TQ VT++   N+       +A+K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +    +FE   +K I+EKL   Y       PQ+ Y+VV + ++T+FF NGQNP PGTIVD  +  P  Y+F+LVSQ+  +GT SPT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVPA   YA +LA L+G
Sbjct:  378 RSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAP------QRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNR---SLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 2.240e-13
Identity = 66/288 (22.92%), Postives = 130/288 (45.14%), Query Frame = 3
Query:  228 NLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDK-----KVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRD----------IITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            N +P ++  K G  G  V L +NF +           Y V        P+ ++ ++S     N +   + FDG +LFT  K+  E +I+  +   K     K++I+F+  ++     + Q++N++       +  E +G+  F     D R  AK       EI  F+  +  G+ T++++  +       LL  E  ++V+   ++ +   +   +    +D          ++T YNN+TYRI+D+    +    F   GR +S+ +Y+  +YNI+++  NQP ++
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLS--NHANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF-----DPR--AK------IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLI 345          
BLAST of Pmo_002658 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 198.364 bits (503), Expect = 3.862e-52
Identity = 143/472 (30.30%), Postives = 231/472 (48.94%), Query Frame = 1
Query: 1189 KSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWK--FGRVKFATNSRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV---ENILNDIMRRSRDAV----KMALVFVPDDKV--YARVKNFT-LSTGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHN-KTGKKSIQASVYSI----NSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIG 2544
            +SN  L + +    +  P+QR D + AF   +  + ++   +++WN++++    E++GR +   ++V    KV      DW+  F   +  T      +   VI        Q+   +++  L +L   A    +    P +    ++     +R   D V    K+ L  VP+D    Y+ +K    +   + TQ VT++   N+       +A+K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +    +FE   +K I+EKL   Y       PQ+ Y+VV + ++T+FF NGQNP PGTIVD  +  P  Y+F+LVSQ+  +GT SPT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVPA   YA +LA L+G
Sbjct:  378 RSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAP------QRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNR---SLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 2.240e-13
Identity = 66/288 (22.92%), Postives = 130/288 (45.14%), Query Frame = 3
Query:  228 NLQPTDITEKMGNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDK-----KVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFR--VLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRD----------IITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVL 1037
            N +P ++  K G  G  V L +NF +           Y V        P+ ++ ++S     N +   + FDG +LFT  K+  E +I+  +   K     K++I+F+  ++     + Q++N++       +  E +G+  F     D R  AK       EI  F+  +  G+ T++++  +       LL  E  ++V+   ++ +   +   +    +D          ++T YNN+TYRI+D+    +    F   GR +S+ +Y+  +YNI+++  NQP ++
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLS--NHANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF-----DPR--AK------IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLI 345          
BLAST of Pmo_002658 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 196.823 bits (499), Expect = 1.848e-51
Identity = 139/492 (28.25%), Postives = 240/492 (48.78%), Query Frame = 1
Query: 1189 KSNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGR-VKFATNSRKNHEIDIVIIDR----NDFNYQK----FIQDVKNELRNLNVNAKVTSVEKCGPNDVENILNDIMRRSRDAVKMALVFVPD--DKVYARVKNFTLS-TGLLTQCVTVRNGTNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTGK-KSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 2610
            +S+N L + +    +  P QR   +  F + +  +  A   +  W L + N   +I GR++    +      V+         GR  +F+ ++  N  + +V + +    +  NY++     + ++K    +L +N    ++     + ++  +  + R      +M +    +  D  YA +K    S   + +Q +  +   N +  R   V  K V+Q+  K G   W V+I  +  MI G+D+YH+ + +  S+ A V SINS+++Q+ S       R+E    L  +F  AL+ +  +    P  I+IYRDG+GD Q++    +E     P  E +  ++     +I Y+VV+KRI+T+ F       +NP PGT+VD+ + K N Y+FFLVSQ   +GT +PT+Y VL D              P+ +QK++Y L  LY+NW GT+R+PA   YAH+LA LIG+ I +    A     + ++LFYL
Sbjct:  408 RSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSA--------GRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRS--VVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEA-----LSEKLFYL 867          

HSP 2 Score: 55.8398 bits (133), Expect = 2.227e-7
Identity = 53/270 (19.63%), Postives = 112/270 (41.48%), Query Frame = 3
Query:  261 GNIGKTVKLASNFAKFSISNIDTFYMYDVVLSDLGIAPKGKLKIISKVQQTNNMNGPFCFDGRRLFTGEKWHGESDISEFTEDDKKVTIRFITNVTVGTEEYYQMVNVMFNNIQVFMGQERIGKAYFLGANTDKRDVAKGSGPTYFEINNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSV-----------VNAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFV 1034
            G+ G +V +  N+ K +       + Y+V       +   ++K ++     + + G   FDG  L+       +  +     +D ++ IR +           Q+ N++F+ +   +   +  +  F             S P    +    V  G+ T +      +     +L  +  +R+L + +V           V  Y +     L+G  ++T+YNN+TY+I+DI  + + + QF++     SY +Y+K+ +NI ++  NQP +
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLN--DHKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-----------DPSRPKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLI 373          
The following BLAST results are available for this feature:
BLAST of Pmo_002658 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+071.04RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+060.63RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA7.175e-11463.87RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|226701015|sp|A6N7Y9|PIWL1_CHICK2.373e-5730.65RecName: Full=Piwi-like protein 1[more]
gi|74716803|sp|Q96J94|PIWL1_HUMAN2.846e-5731.94RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Pmo_002658 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+071.25SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261770.000e+060.71SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001112.836e-4629.07Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389362.038e-2726.12dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329881.320e-2525.11SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
BLAST of Pmo_002658 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767975980|ref|XP_011537308.1|1.928e-6031.75PREDICTED: piwi-like protein 1 isoform X1 [Homo sa... [more]
gi|66346725|ref|NP_004755.2|1.074e-5731.94piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|1.074e-5731.94PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|1.074e-5731.94PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|1.074e-5731.94PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Pmo_002658 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|161076864|ref|NP_001097144.1|2.642e-5330.35aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|3.312e-5330.75aubergine, isoform A [Drosophila melanogaster][more]
gi|17136736|ref|NP_476875.1|3.862e-5230.30piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|3.862e-5230.30piwi, isoform B [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|1.848e-5128.25argonaute 3, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_002658 ID=Pmo_002658|Name=Pmo_002658|organism=Phagocata morgani|type=mRNA|length=3176bp
GTAAGTTGCTATATGAATGTTAATATCTGATAAATTTCTTTAACTTCTTT
AAAAATTATCACTGTATATTTCAATTGTATTTGTTTAAACCTACTATATT
TATTTTTATTATGGAGGATTTAAACCCTCCAAAAATTCGAAAAACTGAAG
ATAGTGATGGAAGAGGAGGAAAGGGGTCCAGGGGGAGCCGAGGTGGCCTA
CAAAGAAGATTTAGAATTTTGGAACCCAACCTTCAACCAACTGACATCAC
TGAAAAAATGGGTAACATAGGCAAAACTGTGAAGCTTGCATCCAATTTTG
CCAAGTTTTCAATTTCCAACATTGATACATTCTATATGTATGATGTCGTT
TTAAGTGATCTTGGTATCGCTCCGAAAGGCAAGTTAAAAATTATTAGTAA
AGTACAACAAACGAACAATATGAATGGTCCGTTTTGTTTTGATGGTCGTC
GATTATTTACTGGTGAAAAATGGCACGGTGAAAGTGATATAAGTGAGTTT
ACCGAGGATGATAAGAAAGTTACGATTCGATTTATAACCAATGTGACTGT
TGGCACAGAAGAATATTATCAAATGGTAAACGTTATGTTTAATAATATTC
AAGTTTTTATGGGCCAAGAACGAATCGGTAAAGCGTATTTTTTGGGTGCA
AATACAGATAAACGTGATGTCGCTAAAGGATCTGGGCCAACTTATTTTGA
AATTAATAATTTTCGAGTACTTGGTGGTTTTTCAACAACATTACAAAGAG
GGACACGTCCTGATGGTTCCAGTTCAACATTATTATATATTGAACGAATA
AATCGTGTGCTAAATGAAAATAGCGTTGTCAATGCTTATAGTAAAGGTCG
TTCTGATCAACTTATTGGTCGTGATATTATAACCAAGTATAACAATAAAA
CTTATCGAATTAGTGATATTAAAGAAATGTCGGTAAGTGAACAATTTGAT
CTGGCTGGTCGAAAGTTATCATATTACGATTATTTCAAAGAACGATATAA
TATTAAGTTACAGCATTCTAATCAACCGTTCGTATTAACAAGAATGCGTA
GAACAACAATTCGAAAAAAGAAAACTGAAGAACCTTCCGAAGAGCCACCA
CAAGAACCACCCCAAGAACCTGAACCTGAAATGACACTAAATATTCCAGG
TGAATTGTGTTTCCTATGTGGATTTTCTGATCAAGAAAAAAAGCAATAAT
GATTTACAAAAGAATCTTGGTGGTATTTTAAAAAGAGAGCCGCGACAAAG
GTTAGATGATATTCCCGCGTTTTGTGATTGGATTGGGAAGAGCGAAAAGG
CCAGCAGTTTCATGAAGGAGTGGAATTTAAAAATTGAGAATCGTCCTCTA
GAAATTGAGGGGCGTGAATTGCCACCAGTTGACGTTGTTTCCGGTGGACA
GAAAGTCAATGAGCGGATTCCCGATGATTGGAAGTTTGGTCGCGTTAAAT
TTGCTACAAATAGTCGTAAAAATCATGAAATTGATATTGTTATTATTGAT
AGAAATGATTTCAATTATCAAAAGTTTATTCAAGATGTTAAAAATGAATT
ACGCAATTTAAATGTTAACGCTAAAGTTACGAGCGTGGAAAAATGTGGTC
CTAATGATGTTGAAAATATCCTTAATGACATAATGCGTCGATCTCGTGAT
GCTGTTAAGATGGCACTGGTCTTTGTACCAGATGATAAAGTATATGCACG
AGTGAAGAATTTTACGTTAAGTACTGGATTGTTGACACAGTGTGTTACTG
TGAGAAATGGTACTAATAAAATGGATAAACGTCGACAAGTTGTTGCAAGC
AAATCTGTTATGCAGATTTTTTCGAAGTTTGGCTACGATCCTTGGAATGT
TGAGATTAAACTTCGTCCGACGATGATTGTTGGTCTTGATACATATCATA
ATAAGACAGGTAAGAAATCAATTCAAGCATCAGTGTATTCGATTAATAGT
ACGTTTACGCAATATTTGAGCTTCATCAATAATCCTCGTGGGCGTCAGGA
GTTTCATGAAGTTCTGGGACGTAATTTCGCGGCTGCGTTGCAGCAATTTC
ATTCGAAGTATGAAATATATCCACAGCGTATAATGATTTATCGTGACGGT
GTTGGTGATTCTCAAATGTTCTTCACGAAACAATTTGAAGCAGATGCTCT
AAAACCGATCATGGAAAAGTTGTATCAAGATAAAGGGTTTCCCATACCCC
AAATTATTTATGTTGTTGTTAAGAAGCGTATTAGTACGAAATTTTTCAAA
AACGGTCAAAATCCGGAGCCAGGTACCATTGTTGATAAGGAGGTTGTTAA
ACCTAATTTTTATGAATTTTTCTTGGTGTCGCAAAGGACAACAAAAGGTA
CCGCCAGTCCTACTAATTATAATGTACTTGAAGACACTAAACTTTTAACA
AAGAAGGGTGTCATGGAGCCAATGGCTCCAAATGAGCTGCAGAAAATAAC
ATACACGCTCACCCACCTTTATTTTAATTGGATGGGTACCATCCGTGTAC
CTGCTCCAACTCATTATGCGCATCGATTGGCTGAATTGATTGGTAAAATT
CACAAAGGCACAAATCCGGCCGTTATTAATGATCGAATTCGCGATCGATT
ATTTTATCTATGACATGTCTCCATACGGTTATGGCATCTAATATTGTCGT
TGTTATATTATTATTATGAATATTATTAGGCCGTCGTTGTATTTTAATGT
CTCATTATTAAGTTCGGTTATTAAATTATGAATATTAATCAATTTTAGTA
CTATGTTAATTCGTTTCCTTTGGTAGAAATAAAATATTTGTATTTGTCTC
CGTCCTTTGGTGGATTTATTGGGCAAATACGGTGAGTCGATTGATTTTAT
TAACACGCTTCGATAACAAAGTATGAATTATGAGAATCGGAATTTGTAAT
GGTAACAATTACTCTTGCTTTTAATAATCATTTTTAGTACAAATTGGAAA
CCTTTATTGAGTTTAGCGCAATTGGATTGTTTTTAATTTGAAGATAATAT
GAATCGACCAACGAACTCGGAGGAATAACCCTAACGATAAATTCTAAACT
TTGATTTGTATAATATTGAGTGATTACTTTCATCTTGTGTTATTTATTGT
TCGTTATTGTATTAACGGTGTATACGGGGTAAATCTTTGGCGATAGTTTA
TAAAAATAAGTCAGGTTACAATCTTC

Design Primers for Pmo_002658

back to top

protein sequence

>Pmo_002658-protein ID=Pmo_002658-protein|Name=Pmo_002658|organism=Phagocata morgani|type=polypeptide|length=434bp
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
back to top

coding sequence

>Pmo_002658.1312.2613 ID=Pmo_002658.1312.2613|Name=Pmo_002658.1312.2613|organism=Phagocata morgani|type=CDS|length=1302bp
ATGAAGGAGTGGAATTTAAAAATTGAGAATCGTCCTCTAGAAATTGAGGG
GCGTGAATTGCCACCAGTTGACGTTGTTTCCGGTGGACAGAAAGTCAATG
AGCGGATTCCCGATGATTGGAAGTTTGGTCGCGTTAAATTTGCTACAAAT
AGTCGTAAAAATCATGAAATTGATATTGTTATTATTGATAGAAATGATTT
CAATTATCAAAAGTTTATTCAAGATGTTAAAAATGAATTACGCAATTTAA
ATGTTAACGCTAAAGTTACGAGCGTGGAAAAATGTGGTCCTAATGATGTT
GAAAATATCCTTAATGACATAATGCGTCGATCTCGTGATGCTGTTAAGAT
GGCACTGGTCTTTGTACCAGATGATAAAGTATATGCACGAGTGAAGAATT
TTACGTTAAGTACTGGATTGTTGACACAGTGTGTTACTGTGAGAAATGGT
ACTAATAAAATGGATAAACGTCGACAAGTTGTTGCAAGCAAATCTGTTAT
GCAGATTTTTTCGAAGTTTGGCTACGATCCTTGGAATGTTGAGATTAAAC
TTCGTCCGACGATGATTGTTGGTCTTGATACATATCATAATAAGACAGGT
AAGAAATCAATTCAAGCATCAGTGTATTCGATTAATAGTACGTTTACGCA
ATATTTGAGCTTCATCAATAATCCTCGTGGGCGTCAGGAGTTTCATGAAG
TTCTGGGACGTAATTTCGCGGCTGCGTTGCAGCAATTTCATTCGAAGTAT
GAAATATATCCACAGCGTATAATGATTTATCGTGACGGTGTTGGTGATTC
TCAAATGTTCTTCACGAAACAATTTGAAGCAGATGCTCTAAAACCGATCA
TGGAAAAGTTGTATCAAGATAAAGGGTTTCCCATACCCCAAATTATTTAT
GTTGTTGTTAAGAAGCGTATTAGTACGAAATTTTTCAAAAACGGTCAAAA
TCCGGAGCCAGGTACCATTGTTGATAAGGAGGTTGTTAAACCTAATTTTT
ATGAATTTTTCTTGGTGTCGCAAAGGACAACAAAAGGTACCGCCAGTCCT
ACTAATTATAATGTACTTGAAGACACTAAACTTTTAACAAAGAAGGGTGT
CATGGAGCCAATGGCTCCAAATGAGCTGCAGAAAATAACATACACGCTCA
CCCACCTTTATTTTAATTGGATGGGTACCATCCGTGTACCTGCTCCAACT
CATTATGCGCATCGATTGGCTGAATTGATTGGTAAAATTCACAAAGGCAC
AAATCCGGCCGTTATTAATGATCGAATTCGCGATCGATTATTTTATCTAT
GA
back to top
Gene Groups
Pmo_002658 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.