Pmo_002029, Pmo_002029 (mRNA) Phagocata morgani

Overview
NamePmo_002029
Unique NamePmo_002029
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1497
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_002029 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 188.734 bits (478), Expect = 9.934e-53
Identity = 118/363 (32.51%), Postives = 199/363 (54.82%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLF-QRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRKVND 1351
            +S K+Y+   + C++P   + E  + Y +NYCWV  T     ++ IP   A+       R++ YYQWVPFVL L+ +LFY+P ++W+++ +  SG  ++SLV  A  +     + R   +  IA  +E+ L  + +V+  ++  LL    ++  C+R +G  +   Y  +KILY +N +GQI+L+  FL     + +  +G+ +L D++ G  W ++  FPRV  C    + ++G  + +  QC L INM NEKI++FLWFW   +   T+ S+  W+Y +S V  R+L          +  K    + L +FV  FLR DGVF+LR+++ +AG+L   ++   LW    N+Y D    K++D
Sbjct:   43 VSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIY-ISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLW----NNYCDNKEGKMHD 385          
BLAST of Pmo_002029 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 185.267 bits (469), Expect = 2.831e-50
Identity = 123/381 (32.28%), Postives = 210/381 (55.12%), Query Frame = 2
Query:  200 EDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFC-------CSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKE--VLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQN 1315
            +D  DK ++ ++  +L  F+L++S K+Y+   + C++P   + +  + Y +NYCWV  T      E IP+     +     R++ YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+ LV  A  A     + +T T+  +A  ++D + Q   +D   H       S F        C R  G ++   Y  IK+LY  N + Q +L+ H L  G+  L  A+G ++L+D++    W    +FPRV  C    + ++G  + +  QC L INM NEKI++FLWFW +   I+T+ +   W+  M    +   FV+K+L+V  D+  +   +   L KF   FLR DGVF+LR+IS +AG+L++++++  LW+ + N
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFT-DAMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEV-QLTNIDRQGH-----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 503          
BLAST of Pmo_002029 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 163.31 bits (412), Expect = 3.849e-43
Identity = 117/397 (29.47%), Postives = 203/397 (51.13%), Query Frame = 2
Query:  173 FKVATYVGVEDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSER-RLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIY-QNSYLDTDFRKVNDSK 1357
            FK  T+   +D  D+ S++ +  LL  FS+++S K+Y+ +++ C++P+   G  ++ Y ++YC++  T        IP       + D ++  + YYQWVP VL +Q  +FYLP  IW   +Y   G D  S++  A+   +Q  + RT+ ++++ + + D+L  R   ++ +    R         +  G      Y  IK++YL N   Q  ++  FL   T      +G     D+ AG  W D+ +FPRV  C    +  +   + Y  QC L INM NEKIY+F+WFW V VLI T ++    +YR+SF   R  +++  L    +  K + K ++  F    L+ DGV ++R I  +AG ++T +I  +L++ + +N   + DF   + +K
Sbjct:   15 FKPKTF---DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGD-----VEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWS-SLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETF----LWGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDE-KAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTK 388          
BLAST of Pmo_002029 vs. uniprot
Match: gi|44889063|sp|Q23027|INX5_CAEEL (RecName: Full=Innexin-5; AltName: Full=Protein opu-5 [Caenorhabditis elegans])

HSP 1 Score: 157.147 bits (396), Expect = 7.077e-41
Identity = 101/375 (26.93%), Postives = 191/375 (50.93%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGT--IP--FRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYN--LSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLW--VYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRKVNDSKYMA 1366
            ++  +Y+   + C++P   +   ++ Y + YC++ GT  +P  F S   +  T     +  + + + YYQW+P VL LQ  LFYLP +IW+    +  L   +L ++  +++K  + + DD      Q+        F +++   ++ P+ ++  S+      +G FL + Y ++KILYL N + Q +++ +FL   +      +G    +D++AG  W    IFPRV  C    M +    + +  QC + INML EK+Y+F WFW + V ++T+ S+  W  +Y +  V +  ++       +   ++++   V   FV   L  DGVFI R++  N+GDL T+ ++ +++ +Y+    +   +K +DS   A
Sbjct:   41 MAASQYVGRPIQCWVPAQFT-RTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQ-VGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDD------QVKATKFGRYFFKKLNFRNESPVFKETGSVVA----SGKFLPALYLLVKILYLANIVLQFWILTYFLETKS----WMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTSVHD-HSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYRAREAEKAHKKDDDSALPA 398          
BLAST of Pmo_002029 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 156.377 bits (394), Expect = 1.594e-40
Identity = 109/371 (29.38%), Postives = 174/371 (46.90%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIP--QTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRM-----SXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIY--QNSYLDTDFRKVND 1351
            IS K++    + C  P    G  ++ Y +NYCW   T      + +   + E ++     +R+L+YYQWVPF L LQ   F  P  +W+    N SG  +  +V  AK + N   + R + I  +   L   L  R   +  +  +   +   F   + +  F+   Y   K+LY LN   Q+YLM +FL     H    +G  +++DI+ G  W  +  FPR A C    +  V     Y  QC L IN+ NEKI++ LWFW V +L+ + +S+  W   +     S    ++      L+     + ++    + KFV  +L  DGVF+LR++S +AG +  TD+V  L+E Y  Q+   D     V+D
Sbjct:   42 ISFKQFGGRPIECMFPNKFPGS-WEQYAENYCWSQDTYFVEPTQDVSLLKKEERYT---PDRQLSYYQWVPFFLLLQAAFFRAPSYLWKY-FSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSAL--RFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHW---YGFGVVQDIVQGEPWERSGYFPRAAVCDFE-VRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSD 401          
BLAST of Pmo_002029 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 265/394 (67.26%), Postives = 324/394 (82.23%), Query Frame = 2
Query:  161 QFSEFKVATYVGVEDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK 1342
            +FS F V  YVGVEDGADKASFLFSVV+LVV ++++STK+YI   ++CYIPI+ +GEK +DY+QNYCW HGTIPFR NET+PQ    W+  D +RRLNYYQWVPFVLGLQGVLFYLPR+IW+ +IYNLSGNDLE LVVSAKKA NQ+G+ R ETI Q+A+CLED+  QRRVL H+K P+LRQ+ S+ CC RRTGVF +S Y VIK+LYL NAI QI LMQ+FL+ G + LN AFG TIL+DI++G  WNDN++FPRV++C+I  ++ V  KN ++AQCALPINMLNEKIYIFLWFWTVGVL +TI+SIPLW+YRM+F RKR+ F+K+FLK+K  Y K K K ++ +FV  FLRHDG+FIL IISLNAGDLI TDIV++LWEIY   YL  DFRK
Sbjct:    7 EFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Pmo_002029 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 326/395 (82.53%), Query Frame = 2
Query:  158 TQFSEFKVATYVGVEDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK 1342
            +QF+ F+   YVG+ED ADKASFLFSV++LVV S+++STK+YI   +SCYIP++ SG   D YV+NYCWVHGTIPF +NET+PQT+ +W+I D+ R++NYYQWVPFVLGLQGVLFYLPR+IW+ +IYNLSGNDLE LVVSAKKA NQ+G+ R ETI Q+A+CLED+  QRRVL H+K P+LRQ+ S+ CC RRTGVF +S Y VIK+LYL NAI QI LMQ+FL+ G + LN AFG TIL+DI++G  WNDN++FPRV++C+I  ++ V  KN ++AQCALPINMLNEKIYIFLWFWTVGVL +TI+SIPLW+YRM+F RKR+ F+K+FLK+K  Y K K K ++ +FV  FLRHDG+FIL IISLNAGDLI TDIV++LWEIY   YL  DFRK
Sbjct:    6 SQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Pmo_002029 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 377.481 bits (968), Expect = 8.403e-126
Identity = 201/395 (50.89%), Postives = 271/395 (68.61%), Query Frame = 2
Query:  167 SEFKVATYVGVEDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRA---SIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK 1342
            +++K A +VG+ED ADK SF  S  +L++ +LVI+ K Y+L S++CYIPI  SG+ FDD++++YCWVHGTIP + N  +P     W  MD   R+NYYQWVPFVL LQG+LFYLPR+IWQ++ YNLSG DLE LV  A  A NQ G  ++ET+DQIA  LE++LF  R ++    P++ + +   S  C  +R+G  L + Y  IK+LY++NA GQ++LMQ+FL  G  H   +FG  +L++I+ G  WND MIFPRV YCY+  +  V  KN YLAQC LPINMLNEKIYIFLWFWTV V+  T +S+  W+YR++    +  F+KKFL+++  Y  +    VL  F   FLR DGVFILR+ S+NAGDLIT DIV  LW IY+  + + +F K
Sbjct:   11 TKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFG--HKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDC-SVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK 400          
BLAST of Pmo_002029 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 367.466 bits (942), Expect = 1.103e-121
Identity = 193/395 (48.86%), Postives = 271/395 (68.61%), Query Frame = 2
Query:  167 SEFKVATYVGVEDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFC--C--SRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFR 1339
             +FK++TYVG+ED ADK SFLFSV LL++  +V++ K Y+   ++CY      G  F++Y++NYCWVHGTI F   E IPQ +  W   D  RR+NYYQWVPF+LGLQ ++FY+P++IWQI+ YN SG +LES+V  A  A N    +R + I++IA  +EDMLFQ R         LR++    C  C  S+  G +L+  Y +IK LY LN IGQ+++M+ FL  G  +   +FG T+L ++I+G  W+   IFPRV YCY+  +  VG  N Y+AQCALP+NMLNEKIY+FLWFW V V I+T +SIPLW YRM+F+ +R  F+K+FL +  +Y++   K +++ F+  FLRHDGVF++R++ +NAGD+IT DIVN+L EIY+ +Y   DFR
Sbjct:   11 GQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSD-KPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFR 402          
BLAST of Pmo_002029 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 345.125 bits (884), Expect = 4.905e-113
Identity = 179/398 (44.97%), Postives = 267/398 (67.09%), Query Frame = 2
Query:  170 EFKVATYVGVEDGADKAXXXXXXXXXXXXXXXISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFC--C--SRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMSXXXXXXXXXXXXXXXXCDYDKQKHKEVLDKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRKVND 1351
            +FK+++Y G+ED AD+ +F+FSVV+L +  ++++ K Y    +SCY+    SG  FD Y++NYCWVHGTIPF  NE IP     W I D+++R+ YYQWVPF+LGLQ +LFY+P+++W+I+ YN  G +LE+L+ +A  +      +R   ++ I   +ED+L+Q R     K    R+R   +C  C  S+  G +L+S YF IK LY +N IGQ+YLM+ FL   ++    +FG TIL DII+G +W++   FPRV+YCY   +  +G  N Y+AQC LP+NMLNEKIYIFLWFW + V IIT+LSI  WV R+ F+ KR +F KK LK+   Y + ++  V + F+  +LR+DG+F++R+I +N+GD++  +I+N LWE Y+N Y++ DF   N+
Sbjct:   12 QFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSM--SSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTV-NHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNN 406          
BLAST of Pmo_002029 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 92.0485 bits (227), Expect = 6.753e-20
Identity = 79/296 (26.69%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGT--IPFR------SNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDN-------MIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMS 1108
            +++++YI + + C +  +  G      +  YCW++ T  +P R       +   P   +     D  +   YYQWV FVL  Q +LFY+PR +W+    +  G  L+ LV+     +  + D          EC  D   ++ ++D+    L R              F    +FV + L  +N IGQIY +  FL       +G F  T   D++  T    +        +FP+V  C        G+   +   C LP+N++NEKIY+FLWFW    +I++I+S    +YR++
Sbjct:   42 VTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPI--VND----------ECKNDR--KKILVDYFIGNLNRHN------------FYAFRFFVCEALNFVNVIGQIYFVDFFL-------DGEFS-TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW---FIILSIMSGISLIYRIA 291          
BLAST of Pmo_002029 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 92.0485 bits (227), Expect = 6.753e-20
Identity = 79/296 (26.69%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGT--IPFR------SNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDN-------MIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMS 1108
            +++++YI + + C +  +  G      +  YCW++ T  +P R       +   P   +     D  +   YYQWV FVL  Q +LFY+PR +W+    +  G  L+ LV+     +  + D          EC  D   ++ ++D+    L R              F    +FV + L  +N IGQIY +  FL       +G F  T   D++  T    +        +FP+V  C        G+   +   C LP+N++NEKIY+FLWFW    +I++I+S    +YR++
Sbjct:   42 VTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPI--VND----------ECKNDR--KKILVDYFIGNLNRHN------------FYAFRFFVCEALNFVNVIGQIYFVDFFL-------DGEFS-TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW---FIILSIMSGISLIYRIA 291          
BLAST of Pmo_002029 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 92.0485 bits (227), Expect = 6.753e-20
Identity = 79/296 (26.69%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGT--IPFR------SNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDN-------MIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMS 1108
            +++++YI + + C +  +  G      +  YCW++ T  +P R       +   P   +     D  +   YYQWV FVL  Q +LFY+PR +W+    +  G  L+ LV+     +  + D          EC  D   ++ ++D+    L R              F    +FV + L  +N IGQIY +  FL       +G F  T   D++  T    +        +FP+V  C        G+   +   C LP+N++NEKIY+FLWFW    +I++I+S    +YR++
Sbjct:   42 VTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPI--VND----------ECKNDR--KKILVDYFIGNLNRHN------------FYAFRFFVCEALNFVNVIGQIYFVDFFL-------DGEFS-TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW---FIILSIMSGISLIYRIA 291          
BLAST of Pmo_002029 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 92.0485 bits (227), Expect = 6.753e-20
Identity = 79/296 (26.69%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGT--IPFR------SNETIPQTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIAGTTWNDN-------MIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFWTVGVLIITILSIPLWVYRMS 1108
            +++++YI + + C +  +  G      +  YCW++ T  +P R       +   P   +     D  +   YYQWV FVL  Q +LFY+PR +W+    +  G  L+ LV+     +  + D          EC  D   ++ ++D+    L R              F    +FV + L  +N IGQIY +  FL       +G F  T   D++  T    +        +FP+V  C        G+   +   C LP+N++NEKIY+FLWFW    +I++I+S    +YR++
Sbjct:   42 VTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPI--VND----------ECKNDR--KKILVDYFIGNLNRHN------------FYAFRFFVCEALNFVNVIGQIYFVDFFL-------DGEFS-TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW---FIILSIMSGISLIYRIA 291          
BLAST of Pmo_002029 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 85.1149 bits (209), Expect = 1.256e-17
Identity = 72/277 (25.99%), Postives = 118/277 (42.60%), Query Frame = 2
Query:  266 ISTKEYILNSMSCYIPIMASGEKFDDYVQNYCWVHGTIPF------RSNETIP---QTEAQWLIMDSERRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAVNQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTGVFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDII--AGTTWNDNM-----IFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLWFW 1048
            ++T++Y+ N + C    + + +  +D +  YCW+H T         +    +P      +Q     + +   YYQWV F L  Q +LFY PR +W+    +  G  + +L++     +    + + +    +    E++ +         H     R                 Y+V ++L L+N IGQ++LM  F        +G F IT    +I    T   D M     IFPR+  C        G    + A C LP+N++NEKIYIFLWFW
Sbjct:   46 VTTRQYVGNPIDC----VHTRDIPEDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRY---------HNWWAYR-----------------YYVCELLALINVIGQMFLMNRFF-------DGEF-ITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280          
The following BLAST results are available for this feature:
BLAST of Pmo_002029 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL9.934e-5332.51RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL2.831e-5032.28RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|12643734|sp|Q19746|INX3_CAEEL3.849e-4329.47RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|44889063|sp|Q23027|INX5_CAEEL7.077e-4126.93RecName: Full=Innexin-5; AltName: Full=Protein opu... [more]
gi|10720052|sp|Q23157|INX11_CAEEL1.594e-4029.38RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
back to top
BLAST of Pmo_002029 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150036490.000e+067.26SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150036480.000e+066.08SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150009188.403e-12650.89Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150008371.103e-12148.86Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006574.905e-11344.97Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Pmo_002029 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pmo_002029 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|6.753e-2026.69innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|6.753e-2026.69innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|6.753e-2026.69innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|6.753e-2026.69innexin 2, isoform D [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|1.256e-1725.99shaking B, isoform G [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_002029 ID=Pmo_002029|Name=Pmo_002029|organism=Phagocata morgani|type=mRNA|length=1497bp
TAGCAAACAAGATTAGCATTTTCACCGCACCACCACTACCATCATCACAA
CGTCTACTGTGGTGTTGTAATTCGATTCATTTGAGATCCATTGTTCTACT
TGTTGTTGATTACCACTACTTCATCGATTGTTACTTGTGTAAATGGAGTC
TTTGCTGACCCAATTTTCAGAGTTCAAAGTCGCTACCTACGTCGGCGTCG
AAGATGGCGCCGACAAGGCCAGTTTTCTGTTCAGTGTGGTGCTGCTCGTT
GTCTTCTCCTTAGTAATATCGACCAAGGAGTACATTCTCAATTCAATGTC
ATGTTACATTCCAATTATGGCGTCTGGTGAAAAATTTGATGATTACGTGC
AAAACTATTGCTGGGTTCACGGAACGATTCCTTTTCGAAGCAATGAGACA
ATTCCACAAACTGAAGCTCAATGGTTGATTATGGACTCTGAAAGAAGATT
AAATTATTACCAATGGGTGCCTTTCGTTCTCGGCCTACAAGGGGTCCTGT
TTTATTTGCCACGAATGATATGGCAAATCGTCATCTACAATCTCAGCGGT
AACGATTTAGAAAGCCTCGTCGTCAGCGCCAAAAAAGCAGTGAATCAAAT
CGGTGATGACAGAACCGAAACTATCGACCAAATTGCTGAATGTCTCGAAG
ATATGCTCTTCCAACGACGAGTCCTTGACCATTCCAAACATCCTTTATTG
AGGCAGCGGGCATCGATATTCTGTTGCAGTCGTCGCACTGGAGTGTTCTT
ATTGAGCTTCTATTTTGTTATTAAAATTCTTTATCTCTTGAATGCTATTG
GTCAGATTTATTTGATGCAACATTTTCTACGAATTGGAACCACACATTTA
AATGGTGCATTTGGAATAACGATTTTGAGAGATATTATTGCCGGAACGAC
ATGGAACGATAATATGATATTTCCCAGGGTGGCTTACTGCTACATCGGTG
GCATGACAATGGTTGGCACAAAAAATCCATATTTAGCACAGTGTGCACTG
CCAATAAATATGCTCAACGAAAAAATTTACATTTTTCTGTGGTTCTGGAC
TGTCGGGGTTCTTATTATAACAATACTTAGTATACCTCTGTGGGTCTATC
GAATGAGCTTTGTTCGGAAACGTAGGTTATTCGTTAAAAAGTTTCTCAAG
GTCAAATGCGATTACGATAAACAGAAGCACAAAGAGGTCCTCGACAAGTT
TGTCGGTATGTTTCTAAGACATGATGGTGTATTTATTCTAAGAATCATTT
CCCTAAACGCCGGAGATTTGATTACTACAGATATTGTAAACAAACTATGG
GAAATATACCAAAATTCCTATCTGGATACTGATTTTAGAAAAGTGAATGA
TTCGAAATACATGGCTTAAGAATATTTCAATAATAACATTACGTAGAATA
TGGAGAATTTGACATTTTATCACTCGGAGTATATTAAGGCATGCTTTATT
AAAACTACGATCATTTATTAATCAGTTAATAAAATAATTATATTCTT

Design Primers for Pmo_002029

back to top

protein sequence

>Pmo_002029-protein ID=Pmo_002029-protein|Name=Pmo_002029|organism=Phagocata morgani|type=polypeptide|length=409bp
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
back to top

coding sequence

>Pmo_002029.143.1369 ID=Pmo_002029.143.1369|Name=Pmo_002029.143.1369|organism=Phagocata morgani|type=CDS|length=1227bp
ATGGAGTCTTTGCTGACCCAATTTTCAGAGTTCAAAGTCGCTACCTACGT
CGGCGTCGAAGATGGCGCCGACAAGGCCAGTTTTCTGTTCAGTGTGGTGC
TGCTCGTTGTCTTCTCCTTAGTAATATCGACCAAGGAGTACATTCTCAAT
TCAATGTCATGTTACATTCCAATTATGGCGTCTGGTGAAAAATTTGATGA
TTACGTGCAAAACTATTGCTGGGTTCACGGAACGATTCCTTTTCGAAGCA
ATGAGACAATTCCACAAACTGAAGCTCAATGGTTGATTATGGACTCTGAA
AGAAGATTAAATTATTACCAATGGGTGCCTTTCGTTCTCGGCCTACAAGG
GGTCCTGTTTTATTTGCCACGAATGATATGGCAAATCGTCATCTACAATC
TCAGCGGTAACGATTTAGAAAGCCTCGTCGTCAGCGCCAAAAAAGCAGTG
AATCAAATCGGTGATGACAGAACCGAAACTATCGACCAAATTGCTGAATG
TCTCGAAGATATGCTCTTCCAACGACGAGTCCTTGACCATTCCAAACATC
CTTTATTGAGGCAGCGGGCATCGATATTCTGTTGCAGTCGTCGCACTGGA
GTGTTCTTATTGAGCTTCTATTTTGTTATTAAAATTCTTTATCTCTTGAA
TGCTATTGGTCAGATTTATTTGATGCAACATTTTCTACGAATTGGAACCA
CACATTTAAATGGTGCATTTGGAATAACGATTTTGAGAGATATTATTGCC
GGAACGACATGGAACGATAATATGATATTTCCCAGGGTGGCTTACTGCTA
CATCGGTGGCATGACAATGGTTGGCACAAAAAATCCATATTTAGCACAGT
GTGCACTGCCAATAAATATGCTCAACGAAAAAATTTACATTTTTCTGTGG
TTCTGGACTGTCGGGGTTCTTATTATAACAATACTTAGTATACCTCTGTG
GGTCTATCGAATGAGCTTTGTTCGGAAACGTAGGTTATTCGTTAAAAAGT
TTCTCAAGGTCAAATGCGATTACGATAAACAGAAGCACAAAGAGGTCCTC
GACAAGTTTGTCGGTATGTTTCTAAGACATGATGGTGTATTTATTCTAAG
AATCATTTCCCTAAACGCCGGAGATTTGATTACTACAGATATTGTAAACA
AACTATGGGAAATATACCAAAATTCCTATCTGGATACTGATTTTAGAAAA
GTGAATGATTCGAAATACATGGCTTAA
back to top
Gene Groups
Pmo_002029 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.