Pmo_000476, Pmo_000476 (mRNA) Phagocata morgani

Overview
NamePmo_000476
Unique NamePmo_000476
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length5252
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of Pmo_000476 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 1232.62 bits (3188), Expect = 0.000e+0
Identity = 576/794 (72.54%), Postives = 688/794 (86.65%), Query Frame = 2
Query: 2732 RRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNN-QPFCFDGRRLFTSSQWHK-EDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 5107
            RRGGLQ+RF IIEP+LQP++V DK+GK+G+ V+LKSNYANF +  +GPFYMYDV M  KS+R KL++L + A++KNN QPFCFDGRRLFT+S+WH  ED E   IK+ EISIR L +F++N+EEYYQM+NI+FNNIQ+FMGQE+IGR +FLGSN      + GPSFFK DNFKILGG+STT+TRGT+++GTASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITK+NNKTYRISDIKE+DV ++++L   KISY++YFKQRYNI L N KQPFVISR+KR  +  KE  ENEPE P E D+SLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPRERL DI DFC WT  GK+  +M  WG+ ++ QPITI GREL  V++ SN+ +IN K  DDWKFGE+KFD+P G  HRF VLVV+RNPS FN FI+DVKRE+GRLR+N+ ++++ SCR+NE+ED L+DFIRV KVHMALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTMIVGLDTFHSKTGKRS+QASVFSIS+KFSQY+SFVNSSKGKNE+H+NL +NF  A+ TF+ KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K +E +YEN+TLPQ+IYV+VKKRISVKFFKDG+NPNPGT+VDEKIVKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+K+ E + + PS LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG  PP I+DRIRERLFYL
Sbjct:   15 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 1232.62 bits (3188), Expect = 0.000e+0
Identity = 576/794 (72.54%), Postives = 688/794 (86.65%), Query Frame = -2
Query:  146 RRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNN-QPFCFDGRRLFTSSQWHK-EDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2521
            RRGGLQ+RF IIEP+LQP++V DK+GK+G+ V+LKSNYANF +  +GPFYMYDV M  KS+R KL++L + A++KNN QPFCFDGRRLFT+S+WH  ED E   IK+ EISIR L +F++N+EEYYQM+NI+FNNIQ+FMGQE+IGR +FLGSN      + GPSFFK DNFKILGG+STT+TRGT+++GTASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITK+NNKTYRISDIKE+DV ++++L   KISY++YFKQRYNI L N KQPFVISR+KR  +  KE  ENEPE P E D+SLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPRERL DI DFC WT  GK+  +M  WG+ ++ QPITI GREL  V++ SN+ +IN K  DDWKFGE+KFD+P G  HRF VLVV+RNPS FN FI+DVKRE+GRLR+N+ ++++ SCR+NE+ED L+DFIRV KVHMALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTMIVGLDTFHSKTGKRS+QASVFSIS+KFSQY+SFVNSSKGKNE+H+NL +NF  A+ TF+ KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K +E +YEN+TLPQ+IYV+VKKRISVKFFKDG+NPNPGT+VDEKIVKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+K+ E + + PS LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG  PP I+DRIRERLFYL
Sbjct:   15 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of Pmo_000476 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 451/803 (56.16%), Postives = 592/803 (73.72%), Query Frame = 2
Query: 2732 RRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSL--RGKLDVLNSIASTKN-NQPFCFDGRRLFTSSQWHK-EDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNE--ATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWT-TEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK--VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENE--TLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 5107
            RRGGLQKRF I+EP LQP    DK+G  GK V L+SN+  F +     + MYD       L  + KL +L  I    N    FC+DGRRLFTS  W +  DI+ FTI E ++S+R +++F+ +TEEYYQM+N++ NN+Q+ MGQE+IG+ YFLGSNSN+       GP+FF+ +NFK+LGGF TTL RGT  +G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD++TK+NNKTYRIS+IKE+++ E  E+ G  +SY  YFK+RYNI L   +QPFV++R+K++    K    NE EAP++ D +L+I GELCFLCGFSD E+SN++LQK+LG VLKR PRERL DI  FC W  T   +     KWG+++DN P+ I GREL   +VIS  +RIN+K  DDWKFG+V+F++  G +H   V++V+RN SQ+  F++DV+ E+ +LR +  I  V+ C  N++E  L+D +R       +ALVF+ DD+ YA+VK+FTISTGLLTQCVT RNGTNR+D+RR+VV+ K+VMQ+F+K GYDPW +++KM PTMIVG+DTFH+K  K+SI ASVFSI+S FSQY+SF NS KGK E+HD L+ NFKAA+  FK  +  LP R ++YRDGVGDSQL FTK++E DA+   +E++Y+     +PQ+IYVIVKKRI  K F  G N NPGTIVD++IVKPNF+EF+LVSQR T+GTA+PTNYNVL DT+  N K+G    I P++LQ ITY LTHLYFNWMGTIRVPVP HYAH+LAEL+G VH+G+ P +I++RIR RLFYL
Sbjct:   17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 451/803 (56.16%), Postives = 592/803 (73.72%), Query Frame = -2
Query:  146 RRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSL--RGKLDVLNSIASTKN-NQPFCFDGRRLFTSSQWHK-EDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNE--ATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWT-TEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK--VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENE--TLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2521
            RRGGLQKRF I+EP LQP    DK+G  GK V L+SN+  F +     + MYD       L  + KL +L  I    N    FC+DGRRLFTS  W +  DI+ FTI E ++S+R +++F+ +TEEYYQM+N++ NN+Q+ MGQE+IG+ YFLGSNSN+       GP+FF+ +NFK+LGGF TTL RGT  +G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD++TK+NNKTYRIS+IKE+++ E  E+ G  +SY  YFK+RYNI L   +QPFV++R+K++    K    NE EAP++ D +L+I GELCFLCGFSD E+SN++LQK+LG VLKR PRERL DI  FC W  T   +     KWG+++DN P+ I GREL   +VIS  +RIN+K  DDWKFG+V+F++  G +H   V++V+RN SQ+  F++DV+ E+ +LR +  I  V+ C  N++E  L+D +R       +ALVF+ DD+ YA+VK+FTISTGLLTQCVT RNGTNR+D+RR+VV+ K+VMQ+F+K GYDPW +++KM PTMIVG+DTFH+K  K+SI ASVFSI+S FSQY+SF NS KGK E+HD L+ NFKAA+  FK  +  LP R ++YRDGVGDSQL FTK++E DA+   +E++Y+     +PQ+IYVIVKKRI  K F  G N NPGTIVD++IVKPNF+EF+LVSQR T+GTA+PTNYNVL DT+  N K+G    I P++LQ ITY LTHLYFNWMGTIRVPVP HYAH+LAEL+G VH+G+ P +I++RIR RLFYL
Sbjct:   17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of Pmo_000476 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/812 (55.17%), Postives = 598/812 (73.65%), Query Frame = 2
Query: 2735 RGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQ---PFCFDGRRLFTSSQWHKE-DIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSN--SNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKEN---------LENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFM-GKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK--VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSF-VNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENE--TLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 5107
            RGGL+  F I+EP+LQP  + +K G  G+ V L+SN+  F +     F MYD       L  K+ +   +   + N+    FCFDGRRLFTS +WH E DI+ F+  E ++++R +++ +  TEEYYQM+N++ NN+QV +GQERIG+ YFL  N   +E     GP+FF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD+ITK+NNKTYRIS+IKE++V E+ E+ G  +SY +YFK+RYNI L  G QPFV++R+K+    R+E           E E EAP+E D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI  +C+W     AA  M  KW +++DN+P+ I GREL   +VIS   +IN+K  DDWKFG V+FDI    +H   V++V+RN  Q+  F++DV++E+  +R++  +  V +C  N++E  L+D  R       MALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTMIVG+DT+H+K+ K+SIQASVFSI+S F+QY+SF VNS KG+ E+H+ L +NF  A++ FK++++ LPQR +++RDGVGD+QL FTK +E DA+   +E++Y+     +PQ+IYVIVKKR+  K F  G+NPNPGT+VD++IVKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L  +K G   P+ P++LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP  I++RIR RLFYL
Sbjct:   25 RGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKP--MRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/812 (55.17%), Postives = 598/812 (73.65%), Query Frame = -2
Query:  146 RGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQ---PFCFDGRRLFTSSQWHKE-DIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSN--SNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKEN---------LENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFM-GKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK--VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSF-VNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENE--TLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2518
            RGGL+  F I+EP+LQP  + +K G  G+ V L+SN+  F +     F MYD       L  K+ +   +   + N+    FCFDGRRLFTS +WH E DI+ F+  E ++++R +++ +  TEEYYQM+N++ NN+QV +GQERIG+ YFL  N   +E     GP+FF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD+ITK+NNKTYRIS+IKE++V E+ E+ G  +SY +YFK+RYNI L  G QPFV++R+K+    R+E           E E EAP+E D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI  +C+W     AA  M  KW +++DN+P+ I GREL   +VIS   +IN+K  DDWKFG V+FDI    +H   V++V+RN  Q+  F++DV++E+  +R++  +  V +C  N++E  L+D  R       MALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTMIVG+DT+H+K+ K+SIQASVFSI+S F+QY+SF VNS KG+ E+H+ L +NF  A++ FK++++ LPQR +++RDGVGD+QL FTK +E DA+   +E++Y+     +PQ+IYVIVKKR+  K F  G+NPNPGT+VD++IVKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L  +K G   P+ P++LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP  I++RIR RLFYL
Sbjct:   25 RGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKP--MRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of Pmo_000476 vs. uniprot
Match: gi|226701015|sp|A6N7Y9|PIWL1_CHICK (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 285.034 bits (728), Expect = 2.040e-78
Identity = 232/814 (28.50%), Postives = 386/814 (47.42%), Query Frame = 2
Query: 2801 KVGKEGKAVALKSNYANFKLAPKGPFYMYDV----KMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKHNNKTYRISDIKEIDVTEQIEL---NGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVI--SNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK---------VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFH-SKTGKRSIQASVFSISSKFSQYLS-FVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            K G  G  + L +N+      P+   Y Y V    +M A+ LR  L   +     K +    FDG  LF   +   +  E ++   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N  +  S             +  GF++++ +        S +L  +  +++L   +V    Y++Y + +           LIG  V+TK+NN+TYR+ DI + D   Q      +G++ISY+DY+K++YN  +++  QP +IS+ +R    ++ N+   P         + IP ELC+L G ++  R++ N+ K L    +  P +R R+I        + +     +  WG+  D+  ++  GR +   +++   N    N + +D  +   V   I A     + ++   RN    N  + +   V   MG +R+N    T++     E++D    ++RV +         V   L     DK  A  K       + +QCV  R  T    +    +  K  +QM  K+G + W VE+ +   MIVG+D +H + +GK+SI   V S++ K +++ S  V  S+G+ E  D L    + A++ + +    LP R I+YRDGVGD QL     YE    L  +++V ++   P+L  ++VKKR+S +FF        NP PGT+VD ++ +P +Y+F++VSQ    G   PT+YNV+ DT          + + P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N  ++SD    RL+YL
Sbjct:  112 KTGSSGAMIKLIANFFRLTSRPQWALYQYHVDYNPEMEARRLRSGLLFQHEDLIGKTH---AFDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYY---NPKDPVS------IPNHRLMVWPGFTSSILQYEE-----SIMLCADVSHKILRSETVLDFMYSLYEQVEERRFRDACAKELIGVIVLTKYNNRTYRVDDI-DWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRR----KRGNVTVGP--------VVLIP-ELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMG-IRMNK--ATMI-----EVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQ-EIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN-PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDT----------SKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPN-LLLSD----RLYYL 867          

HSP 2 Score: 285.034 bits (728), Expect = 2.040e-78
Identity = 232/814 (28.50%), Postives = 386/814 (47.42%), Query Frame = -2
Query:  146 KVGKEGKAVALKSNYANFKLAPKGPFYMYDV----KMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKHNNKTYRISDIKEIDVTEQIEL---NGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVI--SNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK---------VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFH-SKTGKRSIQASVFSISSKFSQYLS-FVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2452
            K G  G  + L +N+      P+   Y Y V    +M A+ LR  L   +     K +    FDG  LF   +   +  E ++   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N  +  S             +  GF++++ +        S +L  +  +++L   +V    Y++Y + +           LIG  V+TK+NN+TYR+ DI + D   Q      +G++ISY+DY+K++YN  +++  QP +IS+ +R    ++ N+   P         + IP ELC+L G ++  R++ N+ K L    +  P +R R+I        + +     +  WG+  D+  ++  GR +   +++   N    N + +D  +   V   I A     + ++   RN    N  + +   V   MG +R+N    T++     E++D    ++RV +         V   L     DK  A  K       + +QCV  R  T    +    +  K  +QM  K+G + W VE+ +   MIVG+D +H + +GK+SI   V S++ K +++ S  V  S+G+ E  D L    + A++ + +    LP R I+YRDGVGD QL     YE    L  +++V ++   P+L  ++VKKR+S +FF        NP PGT+VD ++ +P +Y+F++VSQ    G   PT+YNV+ DT          + + P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N  ++SD    RL+YL
Sbjct:  112 KTGSSGAMIKLIANFFRLTSRPQWALYQYHVDYNPEMEARRLRSGLLFQHEDLIGKTH---AFDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYY---NPKDPVS------IPNHRLMVWPGFTSSILQYEE-----SIMLCADVSHKILRSETVLDFMYSLYEQVEERRFRDACAKELIGVIVLTKYNNRTYRVDDI-DWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRR----KRGNVTVGP--------VVLIP-ELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMG-IRMNK--ATMI-----EVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQ-EIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN-PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDT----------SKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPN-LLLSD----RLYYL 867          
BLAST of Pmo_000476 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 284.648 bits (727), Expect = 2.244e-78
Identity = 231/816 (28.31%), Postives = 381/816 (46.69%), Query Frame = 2
Query: 2735 RGGLQKRFY---IIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMY--DVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDI----ETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYN-IYNKNQ-----------LDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNG-TKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCS-WTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRV------QKVHMALVFIGDDKA--YARVKNF-TISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFH-SKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFK--DG--SNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTN 5062
            RGG ++ F+   +    L       K G  G A+ L++N+      P    Y Y  D K P +S R +  +L     T   +   FDG  LF  ++    +     ET   ++ EI++        ++    Q  NI+F  I   +  ++IGR Y+   N ++      P    +    I  GF TT+ +  S     S +L  +  ++VL   +V + +Y+  Q              L+G  ++TK+NNKTYRI DI            G T+IS+ +YFK +Y + + +G Q  ++S +KR+G + +               ++ +P E C+L G +D  R++ N+ K L S  +  P +R   I+   S     G     +  WG+  +N+ +++ GR L    +I   R    N  T+D  K       I   +   + +    RN       +  + +  G + +      ++     E ED     +R       ++  M +V +  ++   Y  VK +  +     +QCV  R  T    +    VA K  +QM  K+G + W VE+ +   MIVG+D +H +  GKRSI A V S++   S++ S         E  D L  + + A++ + +  N+LP R I+YRDGVGD  L     YE   +++ ++++ ++   P+L  V+VKKRIS +FF   DG  +NP PGT++D ++ +P +Y+F++VSQ    G   PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G +RVP P  YAH+LA LVG ++H+  N
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLG-KAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---NPDD------PFNIPQHRLTIWPGFMTTILQYES-----SIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGR----------PPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMI-----EYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN------SGLK----PDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          

HSP 2 Score: 284.648 bits (727), Expect = 2.244e-78
Identity = 231/816 (28.31%), Postives = 381/816 (46.69%), Query Frame = -2
Query:  191 RGGLQKRFY---IIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMY--DVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDI----ETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYN-IYNKNQ-----------LDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNG-TKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCS-WTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRV------QKVHMALVFIGDDKA--YARVKNF-TISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFH-SKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFK--DG--SNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTN 2518
            RGG ++ F+   +    L       K G  G A+ L++N+      P    Y Y  D K P +S R +  +L     T   +   FDG  LF  ++    +     ET   ++ EI++        ++    Q  NI+F  I   +  ++IGR Y+   N ++      P    +    I  GF TT+ +  S     S +L  +  ++VL   +V + +Y+  Q              L+G  ++TK+NNKTYRI DI            G T+IS+ +YFK +Y + + +G Q  ++S +KR+G + +               ++ +P E C+L G +D  R++ N+ K L S  +  P +R   I+   S     G     +  WG+  +N+ +++ GR L    +I   R    N  T+D  K       I   +   + +    RN       +  + +  G + +      ++     E ED     +R       ++  M +V +  ++   Y  VK +  +     +QCV  R  T    +    VA K  +QM  K+G + W VE+ +   MIVG+D +H +  GKRSI A V S++   S++ S         E  D L  + + A++ + +  N+LP R I+YRDGVGD  L     YE   +++ ++++ ++   P+L  V+VKKRIS +FF   DG  +NP PGT++D ++ +P +Y+F++VSQ    G   PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G +RVP P  YAH+LA LVG ++H+  N
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLG-KAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---NPDD------PFNIPQHRLTIWPGFMTTILQYES-----SIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGR----------PPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMI-----EYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN------SGLK----PDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of Pmo_000476 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 1232.24 bits (3187), Expect = 0.000e+0
Identity = 577/795 (72.58%), Postives = 689/795 (86.67%), Query Frame = 2
Query: 2732 RRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNN-QPFCFDGRRLFTSSQWHK-EDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 5110
            RRGGLQ+RF IIEP+LQP++V DK+GK+G+ V+LKSNYANF +  +GPFYMYDV M  KS+R KL++L + A++KNN QPFCFDGRRLFT+S+WH  ED E   IK+ EISIR L +F++N+EEYYQM+NI+FNNIQ+FMGQE+IGR +FLGSN      + GPSFFK DNFKILGG+STT+TRGT+++GTASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITK+NNKTYRISDIKE+DV ++++L   KISY++YFKQRYNI L N KQPFVISR+KR  +  KE  ENEPE P E D+SLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPRERL DI DFC WT  GK+  +M  WG+ ++ QPITI GREL  V++ SN+ +IN K  DDWKFGE+KFD+P G  HRF VLVV+RNPS FN FI+DVKRE+GRLR+N+ ++++ SCR+NE+ED L+DFIRV KVHMALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTMIVGLDTFHSKTGKRS+QASVFSIS+KFSQY+SFVNSSKGKNE+H+NL +NF  A+ TF+ KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K +E +YEN+TLPQ+IYV+VKKRISVKFFKDG+NPNPGT+VDEKIVKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+K+ E + + PS LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG  PP I+DRIRERLFYL*
Sbjct:   58 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          

HSP 2 Score: 1232.24 bits (3187), Expect = 0.000e+0
Identity = 577/795 (72.58%), Postives = 689/795 (86.67%), Query Frame = -2
Query:  143 RRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNN-QPFCFDGRRLFTSSQWHK-EDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2521
            RRGGLQ+RF IIEP+LQP++V DK+GK+G+ V+LKSNYANF +  +GPFYMYDV M  KS+R KL++L + A++KNN QPFCFDGRRLFT+S+WH  ED E   IK+ EISIR L +F++N+EEYYQM+NI+FNNIQ+FMGQE+IGR +FLGSN      + GPSFFK DNFKILGG+STT+TRGT+++GTASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITK+NNKTYRISDIKE+DV ++++L   KISY++YFKQRYNI L N KQPFVISR+KR  +  KE  ENEPE P E D+SLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPRERL DI DFC WT  GK+  +M  WG+ ++ QPITI GREL  V++ SN+ +IN K  DDWKFGE+KFD+P G  HRF VLVV+RNPS FN FI+DVKRE+GRLR+N+ ++++ SCR+NE+ED L+DFIRV KVHMALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTMIVGLDTFHSKTGKRS+QASVFSIS+KFSQY+SFVNSSKGKNE+H+NL +NF  A+ TF+ KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K +E +YEN+TLPQ+IYV+VKKRISVKFFKDG+NPNPGT+VDEKIVKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+K+ E + + PS LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG  PP I+DRIRERLFYL*
Sbjct:   58 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          
BLAST of Pmo_000476 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 444/816 (54.41%), Postives = 598/816 (73.28%), Query Frame = 2
Query: 2735 RGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQ---PFCFDGRRLFTSSQWHKE-DIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSN--SNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEA-------------DESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFM-GKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK--VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENE--TLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 5110
            RGGL++ F I+EP+LQP  + +K G  G+ V L+SN+  F +     F MYD       L  K+ +   +   + N+    FCFDGRRLFTS +WH E DI+ F+  E ++++R +++ +  TEEYYQM+N++ NN+QV +GQERIG+ YFL  N   +E     GP+FF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD+ITK+NNKTYRIS+IKE++V E+ E+ G  +SY +YFK+RYNI L  G QPFV++R+K+    R+E  + + E  ++              D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI  +C+W     AA  M  KW +++DN+P+ I GREL   +VIS   +IN+K  DDWKFG V+FDI    +H   V++V+RN  Q+  F++DV++E+  +R++  +  V +C  N++E  L+D  R       MALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTMIVG+DT+H+K+ K+SIQASVFSI+S F+QY+SFVNS KG+ E+H+ L +NF  A++ FK++++ LPQR +++RDGVGD+QL FTK +E DA+   +E++Y+     +PQ+IYVIVKKR+  K F  G+NPNPGT+VD++IVKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L  +K G   P+ P++LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP  I++RIR RLFYL*
Sbjct:   25 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKP--MRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          

HSP 2 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 444/816 (54.41%), Postives = 598/816 (73.28%), Query Frame = -2
Query:  143 RGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQ---PFCFDGRRLFTSSQWHKE-DIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSN--SNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEA-------------DESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPFM-GKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIRVQK--VHMALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENE--TLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2518
            RGGL++ F I+EP+LQP  + +K G  G+ V L+SN+  F +     F MYD       L  K+ +   +   + N+    FCFDGRRLFTS +WH E DI+ F+  E ++++R +++ +  TEEYYQM+N++ NN+QV +GQERIG+ YFL  N   +E     GP+FF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD+ITK+NNKTYRIS+IKE++V E+ E+ G  +SY +YFK+RYNI L  G QPFV++R+K+    R+E  + + E  ++              D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI  +C+W     AA  M  KW +++DN+P+ I GREL   +VIS   +IN+K  DDWKFG V+FDI    +H   V++V+RN  Q+  F++DV++E+  +R++  +  V +C  N++E  L+D  R       MALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTMIVG+DT+H+K+ K+SIQASVFSI+S F+QY+SFVNS KG+ E+H+ L +NF  A++ FK++++ LPQR +++RDGVGD+QL FTK +E DA+   +E++Y+     +PQ+IYVIVKKR+  K F  G+NPNPGT+VD++IVKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L  +K G   P+ P++LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP  I++RIR RLFYL*
Sbjct:   25 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKP--MRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          
BLAST of Pmo_000476 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 256.144 bits (653), Expect = 1.184e-69
Identity = 201/713 (28.19%), Postives = 342/713 (47.97%), Query Frame = 2
Query: 3086 NTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIY--------NKNQL-----DLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRM-KRVGINRKENLENEPEAPKEADESLS--IPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCS--WTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEV-ISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNP-SQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR-----VQKVHMALVFIGDDKAYARVKNFT-ISTGLLTQCV---TVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDG-------SNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 5110
            N  E   + N++F  I+  +   +IGR YF                  +   +I  G+ T++     Q+     LL  +  ++V+  +SVY+I         NK Q+     + L+G+ V+T HNN+ YRI+DI    +   + +  G KISY DYFK  Y + + + +QP ++S+   R G NR       P+  KE D  L   IP ELC L G +D    +  L + L    +  P++R   + +F    ++ E +A   +G WG+ ++   + I   ++N   +   N+  ++     ++K       +  G +    +L+  ++  ++ N  +  +  +  R+ V      +V    +  E++L +  R     VQ V   L  + +D+ Y  +K F  +   + +Q V   T++ G   +      VA    +Q+ AKLG + W V++ +   M+VGLD +H   G+ RS+ A V S ++  +++ S  +  +   E    L     + ++ + E+ N LP+   +YRDGV D QL + +K E +   K  ES +  +  P ++Y +V+KRI+ + +          +NPNPGTIVD  + + N Y+F+LVSQ   +GT TPT+Y VL D           +   P Q+Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG   +     ++ D    RLFYL*
Sbjct:  306 NFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKK---------IVLDRRRMEIWPGYVTSI-----QNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRG------PKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-----VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFES-FSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975          

HSP 2 Score: 256.144 bits (653), Expect = 1.184e-69
Identity = 201/713 (28.19%), Postives = 342/713 (47.97%), Query Frame = -2
Query:  143 NTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIY--------NKNQL-----DLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRM-KRVGINRKENLENEPEAPKEADESLS--IPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCS--WTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEV-ISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNP-SQFNQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR-----VQKVHMALVFIGDDKAYARVKNFT-ISTGLLTQCV---TVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDG-------SNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2167
            N  E   + N++F  I+  +   +IGR YF                  +   +I  G+ T++     Q+     LL  +  ++V+  +SVY+I         NK Q+     + L+G+ V+T HNN+ YRI+DI    +   + +  G KISY DYFK  Y + + + +QP ++S+   R G NR       P+  KE D  L   IP ELC L G +D    +  L + L    +  P++R   + +F    ++ E +A   +G WG+ ++   + I   ++N   +   N+  ++     ++K       +  G +    +L+  ++  ++ N  +  +  +  R+ V      +V    +  E++L +  R     VQ V   L  + +D+ Y  +K F  +   + +Q V   T++ G   +      VA    +Q+ AKLG + W V++ +   M+VGLD +H   G+ RS+ A V S ++  +++ S  +  +   E    L     + ++ + E+ N LP+   +YRDGV D QL + +K E +   K  ES +  +  P ++Y +V+KRI+ + +          +NPNPGTIVD  + + N Y+F+LVSQ   +GT TPT+Y VL D           +   P Q+Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG   +     ++ D    RLFYL*
Sbjct:  306 NFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKK---------IVLDRRRMEIWPGYVTSI-----QNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRG------PKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-----VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFES-FSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975          
BLAST of Pmo_000476 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 113.235 bits (282), Expect = 7.604e-25
Identity = 118/454 (25.99%), Postives = 194/454 (42.73%), Query Frame = 2
Query: 3815 FMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVV--ERNPSQFNQFIDDVKREMGRLRVNHLIETVVS-----CRTNEIEDFLSDFIR-----VQKVHMALVFIGDDKAYARVKNF-TISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPT------------MIVGLDTFHSKTGK----RSIQASVFSISSKFSQYLSFVNSSKGKNE---------YHD---NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFF----KDG----SNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLA 5029
            F+  + +E+D + I +  R L+G E I   +R        W     KF  P      +A+  V  ER+  + ++ + D++ ++     N  I    S          IE   +D IR      +K+ + +  + +D+ Y  VK F  +  G++TQC+  +  T    +         ++++  KLG    GV  ++ P             M+ G+D  H  + +    +S+ A V S+ +  + Y + +     K E           D   NL   F  A +  K      P+R I YRDGV + Q     K+E  A+    + + E +  P + Y++V+KR  ++FF    KDG     N   GT+VD+ I     ++FYL S    +GT+ P +Y+VL D    N  S E        LQ  TY L H+Y     ++  P PT+YAH  A
Sbjct:  540 FLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLG----GVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLK------PKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAHLAA 970          

HSP 2 Score: 113.235 bits (282), Expect = 7.604e-25
Identity = 118/454 (25.99%), Postives = 194/454 (42.73%), Query Frame = -2
Query:  224 FMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVV--ERNPSQFNQFIDDVKREMGRLRVNHLIETVVS-----CRTNEIEDFLSDFIR-----VQKVHMALVFIGDDKAYARVKNF-TISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPT------------MIVGLDTFHSKTGK----RSIQASVFSISSKFSQYLSFVNSSKGKNE---------YHD---NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFF----KDG----SNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLA 1438
            F+  + +E+D + I +  R L+G E I   +R        W     KF  P      +A+  V  ER+  + ++ + D++ ++     N  I    S          IE   +D IR      +K+ + +  + +D+ Y  VK F  +  G++TQC+  +  T    +         ++++  KLG    GV  ++ P             M+ G+D  H  + +    +S+ A V S+ +  + Y + +     K E           D   NL   F  A +  K      P+R I YRDGV + Q     K+E  A+    + + E +  P + Y++V+KR  ++FF    KDG     N   GT+VD+ I     ++FYL S    +GT+ P +Y+VL D    N  S E        LQ  TY L H+Y     ++  P PT+YAH  A
Sbjct:  540 FLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLG----GVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLK------PKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAHLAA 970          
BLAST of Pmo_000476 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 107.842 bits (268), Expect = 2.890e-23
Identity = 89/316 (28.16%), Postives = 142/316 (44.94%), Query Frame = 2
Query: 4160 MALVFIGDDKAYARVKNF-TISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPT----------MIVGLDTFHSKTG---KRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF---MESVYENETLPQLIYVIVKKRISVKFF---------KDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLA 5029
            + +V  G    YA VK    I  GL TQCV  +N            + +++  +  K+     G+   +VP+          + +G D  H   G   K SI A V S+ +  S+Y + V+    + E   +LA   K  +  F +     P R I YRDGV + Q      +E  A+ +    +E  Y+    P + +V+V+KR   + F         + G+ P  GT VD+ I  P  ++FYL S    +GT+ P++Y+VL D    NR S +       ++Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  587 IVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKNVNKP--------SPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ----PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPA-GTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD---DNRFSAD-------EIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          

HSP 2 Score: 107.842 bits (268), Expect = 2.890e-23
Identity = 89/316 (28.16%), Postives = 142/316 (44.94%), Query Frame = -2
Query:  224 MALVFIGDDKAYARVKNF-TISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPT----------MIVGLDTFHSKTG---KRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF---MESVYENETLPQLIYVIVKKRISVKFF---------KDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLA 1093
            + +V  G    YA VK    I  GL TQCV  +N            + +++  +  K+     G+   +VP+          + +G D  H   G   K SI A V S+ +  S+Y + V+    + E   +LA   K  +  F +     P R I YRDGV + Q      +E  A+ +    +E  Y+    P + +V+V+KR   + F         + G+ P  GT VD+ I  P  ++FYL S    +GT+ P++Y+VL D    NR S +       ++Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  587 IVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKNVNKP--------SPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ----PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPA-GTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD---DNRFSAD-------EIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Pmo_000476 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = 2
Query: 2801 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          

HSP 2 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = -2
Query:  146 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2452
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          
BLAST of Pmo_000476 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = 2
Query: 2801 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          

HSP 2 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = -2
Query:  146 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2452
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          
BLAST of Pmo_000476 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = 2
Query: 2801 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          

HSP 2 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = -2
Query:  146 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2452
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          
BLAST of Pmo_000476 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = 2
Query: 2801 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          

HSP 2 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = -2
Query:  146 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2452
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          
BLAST of Pmo_000476 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = 2
Query: 2801 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          

HSP 2 Score: 273.863 bits (699), Expect = 3.448e-75
Identity = 229/813 (28.17%), Postives = 374/813 (46.00%), Query Frame = -2
Query:  146 KVGKEGKAVALKSNYANFKLAPKGPFYMYDVK----MPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED----EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKHNNKTYRISDIKEIDVTEQI--ELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAAPF-MGKWGVELDNQPITIMGRELNGVEVISNKRRI--NDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDD---VKREMG-RLRVNHLIETVVSCRTNEIEDFLSDFIRV--QKV----HMALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2452
            K G  G  V L +N+      P+   Y Y +     M A+ LR  L   +     K +    FDG  LF   +  ++  E F+   +     I+I         +    Q  NIIF  +   M  ++IGR Y+   N N+      P         I  GF+T++ +  +     S +L  +  ++VL   +V    +N Y++ +           LIG  V+TK+NNKTYR+ DI      +    + +G+++S+++Y++++YN  + + KQP ++S+ KR    R+      P        ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++     +  +       +  WG+  D+  ++  GR L   ++    +    N + +D  K       I       + ++   RN    N  I +   V   MG ++R   +IE         ++D    ++RV  QKV     + +  +     DK  A  K         +QCV  R  T    +    +A K  +QM  K+G + W V++ +   MIVG+D +H  T G+RSI   V SI+   +++ S         E  D L    +AA++ +      +P R I+YRDGVGD QL     YE    L  ++S+      P+L  ++VKKR++ +FF        NP PGT++D ++ +P +Y+F++VSQ    G+ +PT+YNV+ D       SG K    P  +Q +TY L H+Y+NW G IRVP P  YAH+LA LVG ++HR  N       +  RL+YL
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH---AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR----RRGPGGTLP------GPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIE---------VDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN------SGLK----PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861          
BLAST of Pmo_000476 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 279.641 bits (714), Expect = 8.260e-78
Identity = 228/794 (28.72%), Postives = 388/794 (48.87%), Query Frame = 2
Query: 2780 QPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKM-PA-KSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIK-----EDEISIRFLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQ-IELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER---LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWK--FGEVK-FDIPAGAQHRFAVLVVERNPSQFNQFIDDVKRE---MGRLRVNHLIETVV-SCRTNEIEDFLSDFIRVQ-KVHMALVFIGDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETL--PQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 5044
            +P  +V K G +G  V L++N+   K  P+     Y V+  P+ ++ R ++ VL++ A+   +  + FDG +LFT+ ++ +E I   + K     E +ISI+F+  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL+    V+T +NN+TYRI+D+      +      G  IS+V+Y+  +YNI + +  QP +IS+      NR + L+        A E + +  ELC + G +   RSN  L +++ S  +  P++R   LR  +     T E  +   +  W +ELD     + GR +    ++ +  ++    + DW+  F + +    P+    R+AV+  +RN  +    +D + R    MG LR+    E ++   RT      + D +R   K+ + LV   + + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +EL +   M +G D   S +  KR+  A + S+   + S Y S V      +   + L      A++ ++ +   LP R + YRDGV    L    ++E   +++ +++ Y    L  PQL Y++V + ++ +FF +G NP PGTIVD+ I  P  Y+FYLVSQ+  +GT +PT+YNVL  +            + P ++Q +TY + HLY+NW GT RVP    YA +LA LVGT
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG-YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTN------ASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPE--SVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826          

HSP 2 Score: 279.641 bits (714), Expect = 8.260e-78
Identity = 228/794 (28.72%), Postives = 388/794 (48.87%), Query Frame = -2
Query:  209 QPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKM-PA-KSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIK-----EDEISIRFLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQ-IELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER---LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWK--FGEVK-FDIPAGAQHRFAVLVVERNPSQFNQFIDDVKRE---MGRLRVNHLIETVV-SCRTNEIEDFLSDFIRVQ-KVHMALVFIGDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETL--PQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2473
            +P  +V K G +G  V L++N+   K  P+     Y V+  P+ ++ R ++ VL++ A+   +  + FDG +LFT+ ++ +E I   + K     E +ISI+F+  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL+    V+T +NN+TYRI+D+      +      G  IS+V+Y+  +YNI + +  QP +IS+      NR + L+        A E + +  ELC + G +   RSN  L +++ S  +  P++R   LR  +     T E  +   +  W +ELD     + GR +    ++ +  ++    + DW+  F + +    P+    R+AV+  +RN  +    +D + R    MG LR+    E ++   RT      + D +R   K+ + LV   + + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +EL +   M +G D   S +  KR+  A + S+   + S Y S V      +   + L      A++ ++ +   LP R + YRDGV    L    ++E   +++ +++ Y    L  PQL Y++V + ++ +FF +G NP PGTIVD+ I  P  Y+FYLVSQ+  +GT +PT+YNVL  +            + P ++Q +TY + HLY+NW GT RVP    YA +LA LVGT
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG-YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTN------ASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPE--SVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826          
BLAST of Pmo_000476 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 279.641 bits (714), Expect = 8.260e-78
Identity = 228/794 (28.72%), Postives = 388/794 (48.87%), Query Frame = 2
Query: 2780 QPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKM-PA-KSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIK-----EDEISIRFLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQ-IELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER---LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWK--FGEVK-FDIPAGAQHRFAVLVVERNPSQFNQFIDDVKRE---MGRLRVNHLIETVV-SCRTNEIEDFLSDFIRVQ-KVHMALVFIGDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETL--PQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 5044
            +P  +V K G +G  V L++N+   K  P+     Y V+  P+ ++ R ++ VL++ A+   +  + FDG +LFT+ ++ +E I   + K     E +ISI+F+  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL+    V+T +NN+TYRI+D+      +      G  IS+V+Y+  +YNI + +  QP +IS+      NR + L+        A E + +  ELC + G +   RSN  L +++ S  +  P++R   LR  +     T E  +   +  W +ELD     + GR +    ++ +  ++    + DW+  F + +    P+    R+AV+  +RN  +    +D + R    MG LR+    E ++   RT      + D +R   K+ + LV   + + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +EL +   M +G D   S +  KR+  A + S+   + S Y S V      +   + L      A++ ++ +   LP R + YRDGV    L    ++E   +++ +++ Y    L  PQL Y++V + ++ +FF +G NP PGTIVD+ I  P  Y+FYLVSQ+  +GT +PT+YNVL  +            + P ++Q +TY + HLY+NW GT RVP    YA +LA LVGT
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG-YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTN------ASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPE--SVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826          

HSP 2 Score: 279.641 bits (714), Expect = 8.260e-78
Identity = 228/794 (28.72%), Postives = 388/794 (48.87%), Query Frame = -2
Query:  209 QPESVVDKVGKEGKAVALKSNYANFKLAPKGPFYMYDVKM-PA-KSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIK-----EDEISIRFLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKHNNKTYRISDIKEIDVTEQ-IELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER---LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWK--FGEVK-FDIPAGAQHRFAVLVVERNPSQFNQFIDDVKRE---MGRLRVNHLIETVV-SCRTNEIEDFLSDFIRVQ-KVHMALVFIGDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETL--PQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2473
            +P  +V K G +G  V L++N+   K  P+     Y V+  P+ ++ R ++ VL++ A+   +  + FDG +LFT+ ++ +E I   + K     E +ISI+F+  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL+    V+T +NN+TYRI+D+      +      G  IS+V+Y+  +YNI + +  QP +IS+      NR + L+        A E + +  ELC + G +   RSN  L +++ S  +  P++R   LR  +     T E  +   +  W +ELD     + GR +    ++ +  ++    + DW+  F + +    P+    R+AV+  +RN  +    +D + R    MG LR+    E ++   RT      + D +R   K+ + LV   + + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +EL +   M +G D   S +  KR+  A + S+   + S Y S V      +   + L      A++ ++ +   LP R + YRDGV    L    ++E   +++ +++ Y    L  PQL Y++V + ++ +FF +G NP PGTIVD+ I  P  Y+FYLVSQ+  +GT +PT+YNVL  +            + P ++Q +TY + HLY+NW GT RVP    YA +LA LVGT
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG-YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTN------ASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPE--SVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826          
BLAST of Pmo_000476 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 266.544 bits (680), Expect = 2.698e-73
Identity = 216/799 (27.03%), Postives = 368/799 (46.06%), Query Frame = 2
Query: 2807 GKEGKAVALKSNYANFKLAPKGPFYMYDVKM--PAKSLRGKLDVLNS----IASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED-EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQF-NQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR--VQKVHMALVFIGD--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            G +G +V +  NY           + Y+V+   P  S+  ++  LN     +  TK      FDG  L+       +     +  ED E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  V+T++NN+TY+I+DI  + + T Q E+     SYV+Y+KQ +NI + +  QP + S  K  GI           A +E  +   IP ELC+L G  D  RS+  L + + +  +  P +R   ++ F    +   AA   +  WG+ L N    I GR+++  ++  +K  ++   S ++    V  ++         +++  RN  Q     +D++K+    L +N    T++S   + I+ ++    R       M +    +  D  YA +K    S   + +Q +  +   N      + V  K V+QM  KLG   W V++     MI G+D++H  + +  S+ A V SI+S +SQ+ S       + E  + L+ +F+ A++ ++++   LP   IIYRDG+GD QLY    YE    +   E V  N    ++ Y++V+KRI+ + F        NP PGT+VD+ I K N Y+F+LVSQ   +GT TPT+Y VL D               P  +Q ++Y L  LY+NW GT+R+P    YAH+LA L+G ++ R      +++ + E+LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867          

HSP 2 Score: 266.544 bits (680), Expect = 2.698e-73
Identity = 216/799 (27.03%), Postives = 368/799 (46.06%), Query Frame = -2
Query:  146 GKEGKAVALKSNYANFKLAPKGPFYMYDVKM--PAKSLRGKLDVLNS----IASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED-EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQF-NQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR--VQKVHMALVFIGD--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2446
            G +G +V +  NY           + Y+V+   P  S+  ++  LN     +  TK      FDG  L+       +     +  ED E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  V+T++NN+TY+I+DI  + + T Q E+     SYV+Y+KQ +NI + +  QP + S  K  GI           A +E  +   IP ELC+L G  D  RS+  L + + +  +  P +R   ++ F    +   AA   +  WG+ L N    I GR+++  ++  +K  ++   S ++    V  ++         +++  RN  Q     +D++K+    L +N    T++S   + I+ ++    R       M +    +  D  YA +K    S   + +Q +  +   N      + V  K V+QM  KLG   W V++     MI G+D++H  + +  S+ A V SI+S +SQ+ S       + E  + L+ +F+ A++ ++++   LP   IIYRDG+GD QLY    YE    +   E V  N    ++ Y++V+KRI+ + F        NP PGT+VD+ I K N Y+F+LVSQ   +GT TPT+Y VL D               P  +Q ++Y L  LY+NW GT+R+P    YAH+LA L+G ++ R      +++ + E+LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867          
BLAST of Pmo_000476 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 266.544 bits (680), Expect = 2.698e-73
Identity = 216/799 (27.03%), Postives = 368/799 (46.06%), Query Frame = 2
Query: 2807 GKEGKAVALKSNYANFKLAPKGPFYMYDVKM--PAKSLRGKLDVLNS----IASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED-EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQF-NQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR--VQKVHMALVFIGD--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            G +G +V +  NY           + Y+V+   P  S+  ++  LN     +  TK      FDG  L+       +     +  ED E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  V+T++NN+TY+I+DI  + + T Q E+     SYV+Y+KQ +NI + +  QP + S  K  GI           A +E  +   IP ELC+L G  D  RS+  L + + +  +  P +R   ++ F    +   AA   +  WG+ L N    I GR+++  ++  +K  ++   S ++    V  ++         +++  RN  Q     +D++K+    L +N    T++S   + I+ ++    R       M +    +  D  YA +K    S   + +Q +  +   N      + V  K V+QM  KLG   W V++     MI G+D++H  + +  S+ A V SI+S +SQ+ S       + E  + L+ +F+ A++ ++++   LP   IIYRDG+GD QLY    YE    +   E V  N    ++ Y++V+KRI+ + F        NP PGT+VD+ I K N Y+F+LVSQ   +GT TPT+Y VL D               P  +Q ++Y L  LY+NW GT+R+P    YAH+LA L+G ++ R      +++ + E+LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867          

HSP 2 Score: 266.544 bits (680), Expect = 2.698e-73
Identity = 216/799 (27.03%), Postives = 368/799 (46.06%), Query Frame = -2
Query:  146 GKEGKAVALKSNYANFKLAPKGPFYMYDVKM--PAKSLRGKLDVLNS----IASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED-EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQF-NQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR--VQKVHMALVFIGD--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2446
            G +G +V +  NY           + Y+V+   P  S+  ++  LN     +  TK      FDG  L+       +     +  ED E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  V+T++NN+TY+I+DI  + + T Q E+     SYV+Y+KQ +NI + +  QP + S  K  GI           A +E  +   IP ELC+L G  D  RS+  L + + +  +  P +R   ++ F    +   AA   +  WG+ L N    I GR+++  ++  +K  ++   S ++    V  ++         +++  RN  Q     +D++K+    L +N    T++S   + I+ ++    R       M +    +  D  YA +K    S   + +Q +  +   N      + V  K V+QM  KLG   W V++     MI G+D++H  + +  S+ A V SI+S +SQ+ S       + E  + L+ +F+ A++ ++++   LP   IIYRDG+GD QLY    YE    +   E V  N    ++ Y++V+KRI+ + F        NP PGT+VD+ I K N Y+F+LVSQ   +GT TPT+Y VL D               P  +Q ++Y L  LY+NW GT+R+P    YAH+LA L+G ++ R      +++ + E+LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867          
BLAST of Pmo_000476 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 266.544 bits (680), Expect = 2.698e-73
Identity = 216/799 (27.03%), Postives = 368/799 (46.06%), Query Frame = 2
Query: 2807 GKEGKAVALKSNYANFKLAPKGPFYMYDVKM--PAKSLRGKLDVLNS----IASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED-EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQF-NQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR--VQKVHMALVFIGD--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 5107
            G +G +V +  NY           + Y+V+   P  S+  ++  LN     +  TK      FDG  L+       +     +  ED E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  V+T++NN+TY+I+DI  + + T Q E+     SYV+Y+KQ +NI + +  QP + S  K  GI           A +E  +   IP ELC+L G  D  RS+  L + + +  +  P +R   ++ F    +   AA   +  WG+ L N    I GR+++  ++  +K  ++   S ++    V  ++         +++  RN  Q     +D++K+    L +N    T++S   + I+ ++    R       M +    +  D  YA +K    S   + +Q +  +   N      + V  K V+QM  KLG   W V++     MI G+D++H  + +  S+ A V SI+S +SQ+ S       + E  + L+ +F+ A++ ++++   LP   IIYRDG+GD QLY    YE    +   E V  N    ++ Y++V+KRI+ + F        NP PGT+VD+ I K N Y+F+LVSQ   +GT TPT+Y VL D               P  +Q ++Y L  LY+NW GT+R+P    YAH+LA L+G ++ R      +++ + E+LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867          

HSP 2 Score: 266.544 bits (680), Expect = 2.698e-73
Identity = 216/799 (27.03%), Postives = 368/799 (46.06%), Query Frame = -2
Query:  146 GKEGKAVALKSNYANFKLAPKGPFYMYDVKM--PAKSLRGKLDVLNS----IASTKNNQPFCFDGRRLFTSSQWHKEDIETFTIKED-EISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKHNNKTYRISDIK-EIDVTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLENEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDISDFCSWTTEGKAA-PFMGKWGVELDNQPITIMGRELNGVEVISNKRRINDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQF-NQFIDDVKREMGRLRVNHLIETVVSCRTNEIEDFLSDFIR--VQKVHMALVFIGD--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXRKVVADKSVMQMFAKLGYDPWGVELKMVPTMIVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSSKGKNEYHDNLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKFMESVYENETLPQLIYVIVKKRISVKFFKDGS----NPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2446
            G +G +V +  NY           + Y+V+   P  S+  ++  LN     +  TK      FDG  L+       +     +  ED E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  V+T++NN+TY+I+DI  + + T Q E+     SYV+Y+KQ +NI + +  QP + S  K  GI           A +E  +   IP ELC+L G  D  RS+  L + + +  +  P +R   ++ F    +   AA   +  WG+ L N    I GR+++  ++  +K  ++   S ++    V  ++         +++  RN  Q     +D++K+    L +N    T++S   + I+ ++    R       M +    +  D  YA +K    S   + +Q +  +   N      + V  K V+QM  KLG   W V++     MI G+D++H  + +  S+ A V SI+S +SQ+ S       + E  + L+ +F+ A++ ++++   LP   IIYRDG+GD QLY    YE    +   E V  N    ++ Y++V+KRI+ + F        NP PGT+VD+ I K N Y+F+LVSQ   +GT TPT+Y VL D               P  +Q ++Y L  LY+NW GT+R+P    YAH+LA L+G ++ R      +++ + E+LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867          
The following BLAST results are available for this feature:
BLAST of Pmo_000476 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+072.54RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+056.16RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+055.17RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|226701015|sp|A6N7Y9|PIWL1_CHICK2.040e-7828.50RecName: Full=Piwi-like protein 1[more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE2.244e-7828.31RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Pmo_000476 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150261770.000e+072.58SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159470.000e+054.41SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150001111.184e-6928.19Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150329887.604e-2525.99SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
SMU150389362.890e-2328.16dd_smedV4_3861_0_1|m.24705|m.16148[more]
back to top
BLAST of Pmo_000476 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|3.448e-7528.17piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|3.448e-7528.17PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|3.448e-7528.17PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|3.448e-7528.17PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|3.448e-7528.17PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Pmo_000476 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|8.260e-7828.72piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|8.260e-7828.72piwi, isoform B [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|2.698e-7327.03argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|2.698e-7327.03argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|2.698e-7327.03argonaute 3, isoform F [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_000476 ID=Pmo_000476|Name=Pmo_000476|organism=Phagocata morgani|type=mRNA|length=5252bp
TTTTTTTTCAAATAACAAATATATATTAATAACACGTTAAAAATAATAAC
TAAATGGCATGCTGACAATAATACTAAGTCTAGAGTTAATATATGAAAAT
TACTGCAAAAATACAACAAAAAACACAAATACAAAAAACCGTCTAAAGAT
AGAACAAGCGTTCACGAATTCGATCAGAAATAACCGGCGGATTGGTGCCC
CGATGCACAGTGCCGACTAGTTCCGCCAAACGATGGGCATAATGAGTAGG
TACCGGTACACGAATAGTACCCATCCAATTAAAGTACAAATGCGTCAAAG
CATAAGTAATATGTTGCAATTGACTTGGCGGAATCGGTGTCTTTTCACCC
GATTTACGGTTAGTCAATTGCGTGTCCATTAAAACATTGTAATTAGTTGG
CGTTGCAGTCCCCTTTGTCGTTCTTTGTGAAACCAAATAAAATTCATAAA
AGTTTGGTTTAACAATTTTCTCGTCAACAATGGTACCTGGATTCGGATTA
CTACCGTCTTTGAAAAACTTAACACTAATCCGCTTCTTCACAATAACATA
GATCAGCTGCGGAAGAGTTTCATTTTCATAAACCGATTCCATGAATTTCA
AAACAGCATCAGTTTCATATTTCTTAGTGAAGTACAATTGAGAATCACCG
ACTCCATCTCGGTAAATTATAAAGCGTTGTGGCAACGTATTAAACTTCTC
TTTAAATGTTTGTATAGCAGCCTTAAAATTTTGTGCCAAATTGTCGTGAT
ATTCATTTTTCCCTTTGGACGAATTAACAAAACTTAAATATTGCGAAAAC
TTGGAACTTATACTAAAAACAGAAGCTTGAATTGATCGTTTACCAGTTTT
GCTATGAAACGTATCTAATCCAACTATCATTGTCGGAACCATTTTTAATT
CAACACCCCATGGATCATAGCCTAATTTTGCAAACATTTGCATGACACTT
TTATCTGCAACAACCTTTCGTCGACGATCATCACGATTTGTTCCATTTCG
AACAGTAACACATTGAGTTAATAACCCTGTACTTATTGTGAAATTTTTAA
CTCGTGCATACGCTTTATCATCACCAATAAAAACAAGAGCCATATGAACC
TTTTGAACGCGAATGAAATCGCTAAGAAAATCCTCAATTTCATTTGTTCT
GCAAGATACCACTGTTTCAATTAAATGGTTAACCCGCAATCTACCCATTT
CTCGTTTAACATCATCAATGAATTGGTTGAACTGACTCGGATTTCTTTCA
ACAACTAATACCGCAAATCTATGCTGAGCTCCAGCCGGAATATCAAATTT
CACTTCTCCAAATTTCCAATCGTCAGAAGTTTTATCATTAATACGCCGCT
TGTTTGAGATAACCTCCACTCCATTAAGTTCCCTACCCATAATGGTAATT
GGTTGGTTATCTAGCTCAACCCCCCATTTTCCCATAAATGGAGCAGCTTT
TCCTTCAGTTGTCCAGCTACAAAAGTCACTAATATCTCGTAATCTTTCGC
GTGGTTCTCTTTTAAGAACAGATCCTAAACTTTTTTGTAAATTAAGATTA
CTTCTTTCACTATCCGAAAAACCACACAAAAAACACAACTCTCCTGGAAT
GGATAAACTTTCATCAGCTTCCTTAGGAGCTTCTGGTTCATTTTCAAGAT
TCTCTTTTCGATTAATACCAACTCGTTTCATTCGTGAAATTACAAACGGT
TGTTTACCATTGTTTAAAGTAATGTTGTATCGTTGCTTAAAGTAATCAAC
ATAAGAAATCTTTGTGCCATTTAATTCAATTTGTTCTGTAACATCAATTT
CTTTTATATCGCTTATACGATATGTTTTATTATTATGCTTAGTTATAACA
TCTCGCCCAATAAGCAAATCAAGCTGATTCTTATTGTAAATATTATAAAC
GGAATTTTCATTCAAGACCCGATTAATACGTTCCAAATAAAGCAAAGTAG
AAGCAGTACCATCTTGACTTGTTCCACGAGTAAGAGTAGTAGAAAAACCC
CCTAATATCTTAAAGTTATCTTTCTTGAAAAATGACGGTCCAAACTTAGA
CGTTGCTTCATTAGAATTAGAACCCAAAAAATATGCCCGACCAATTCTTT
CTTGGCCCATAAAAACTTGAATGTTGTTAAATATAATATTGACCATTTGA
TAGTATTCTTCAGTATTCTCAATAAATGAAGCTAAAAATCTAATTGAAAT
TTCATCTTCCTTTATTGTAAATGTTTCAATATCTTCTTTGTGCCATTGAG
ATGAAGTGAAAAGTCGACGACCATCAAAACAAAACGGTTGATTATTTTTC
GTTGATGCAATGCTATTCAATACGTCTAACTTTCCTCGCAAACTTTTAGC
TGGCATTTTTACATCATACATATAGAATGGTCCTTTCGGAGCCAATTTAA
AGTTTGCATAATTAGACTTCAATGCAACGGCTTTACCTTCTTTGCCTACC
TTATCAACAACCGATTCAGGTTGAAGAGACGGTTCAATAATATAGAACCT
TTTCTGTAATCCTCCGCGTCTTACTCCTTTTTTCTCCTCCATCTTGAAAT
ATTAAATTAGCCCAAATTATTTTTAAGAAAACAAAATTTTATTTTTATGA
ACAATTTAAACAAGAACTACTGTTGGCCAACAGTAGTTCTTGTTTAAATT
GTTCATAAAAATAAAATTTTGTTTTCTTAAAAATAATTTGGGCTAATTTA
ATATTTCAAGATGGAGGAGAAAAAAGGAGTAAGACGCGGAGGATTACAGA
AAAGGTTCTATATTATTGAACCGTCTCTTCAACCTGAATCGGTTGTTGAT
AAGGTAGGCAAAGAAGGTAAAGCCGTTGCATTGAAGTCTAATTATGCAAA
CTTTAAATTGGCTCCGAAAGGACCATTCTATATGTATGATGTAAAAATGC
CAGCTAAAAGTTTGCGAGGAAAGTTAGACGTATTGAATAGCATTGCATCA
ACGAAAAATAATCAACCGTTTTGTTTTGATGGTCGTCGACTTTTCACTTC
ATCTCAATGGCACAAAGAAGATATTGAAACATTTACAATAAAGGAAGATG
AAATTTCAATTAGATTTTTAGCTTCATTTATTGAGAATACTGAAGAATAC
TATCAAATGGTCAATATTATATTTAACAACATTCAAGTTTTTATGGGCCA
AGAAAGAATTGGTCGGGCATATTTTTTGGGTTCTAATTCTAATGAAGCAA
CGTCTAAGTTTGGACCGTCATTTTTCAAGAAAGATAACTTTAAGATATTA
GGGGGTTTTTCTACTACTCTTACTCGTGGAACAAGTCAAGATGGTACTGC
TTCTACTTTGCTTTATTTGGAACGTATTAATCGGGTCTTGAATGAAAATT
CCGTTTATAATATTTACAATAAGAATCAGCTTGATTTGCTTATTGGGCGA
GATGTTATAACTAAGCATAATAATAAAACATATCGTATAAGCGATATAAA
AGAAATTGATGTTACAGAACAAATTGAATTAAATGGCACAAAGATTTCTT
ATGTTGATTACTTTAAGCAACGATACAACATTACTTTAAACAATGGTAAA
CAACCGTTTGTAATTTCACGAATGAAACGAGTTGGTATTAATCGAAAAGA
GAATCTTGAAAATGAACCAGAAGCTCCTAAGGAAGCTGATGAAAGTTTAT
CCATTCCAGGAGAGTTGTGTTTTTTGTGTGGTTTTTCGGATAGTGAAAGA
AGTAATCTTAATTTACAAAAAAGTTTAGGATCTGTTCTTAAAAGAGAACC
ACGCGAAAGATTACGAGATATTAGTGACTTTTGTAGCTGGACAACTGAAG
GAAAAGCTGCTCCATTTATGGGAAAATGGGGGGTTGAGCTAGATAACCAA
CCAATTACCATTATGGGTAGGGAACTTAATGGAGTGGAGGTTATCTCAAA
CAAGCGGCGTATTAATGATAAAACTTCTGACGATTGGAAATTTGGAGAAG
TGAAATTTGATATTCCGGCTGGAGCTCAGCATAGATTTGCGGTATTAGTT
GTTGAAAGAAATCCGAGTCAGTTCAACCAATTCATTGATGATGTTAAACG
AGAAATGGGTAGATTGCGGGTTAACCATTTAATTGAAACAGTGGTATCTT
GCAGAACAAATGAAATTGAGGATTTTCTTAGCGATTTCATTCGCGTTCAA
AAGGTTCATATGGCTCTTGTTTTTATTGGTGATGATAAAGCGTATGCACG
AGTTAAAAATTTCACAATAAGTACAGGGTTATTAACTCAATGTGTTACTG
TTCGAAATGGAACAAATCGTGATGATCGTCGACGAAAGGTTGTTGCAGAT
AAAAGTGTCATGCAAATGTTTGCAAAATTAGGCTATGATCCATGGGGTGT
TGAATTAAAAATGGTTCCGACAATGATAGTTGGATTAGATACGTTTCATA
GCAAAACTGGTAAACGATCAATTCAAGCTTCTGTTTTTAGTATAAGTTCC
AAGTTTTCGCAATATTTAAGTTTTGTTAATTCGTCCAAAGGGAAAAATGA
ATATCACGACAATTTGGCACAAAATTTTAAGGCTGCTATACAAACATTTA
AAGAGAAGTTTAATACGTTGCCACAACGCTTTATAATTTACCGAGATGGA
GTCGGTGATTCTCAATTGTACTTCACTAAGAAATATGAAACTGATGCTGT
TTTGAAATTCATGGAATCGGTTTATGAAAATGAAACTCTTCCGCAGCTGA
TCTATGTTATTGTGAAGAAGCGGATTAGTGTTAAGTTTTTCAAAGACGGT
AGTAATCCGAATCCAGGTACCATTGTTGACGAGAAAATTGTTAAACCAAA
CTTTTATGAATTTTATTTGGTTTCACAAAGAACGACAAAGGGGACTGCAA
CGCCAACTAATTACAATGTTTTAATGGACACGCAATTGACTAACCGTAAA
TCGGGTGAAAAGACACCGATTCCGCCAAGTCAATTGCAACATATTACTTA
TGCTTTGACGCATTTGTACTTTAATTGGATGGGTACTATTCGTGTACCGG
TACCTACTCATTATGCCCATCGTTTGGCGGAACTAGTCGGCACTGTGCAT
CGGGGCACCAATCCGCCGGTTATTTCTGATCGAATTCGTGAACGCTTGTT
CTATCTTTAGACGGTTTTTTGTATTTGTGTTTTTTGTTGTATTTTTGCAG
TAATTTTCATATATTAACTCTAGACTTAGTATTATTGTCAGCATGCCATT
TAGTTATTATTTTTAACGTGTTATTAATATATATTTGTTATTTGAAAAAA
AA

Design Primers for Pmo_000476

back to top

protein sequence

>Pmo_000476-protein ID=Pmo_000476-protein|Name=Pmo_000476|organism=Phagocata morgani|type=polypeptide|length=800bp
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
back to top

coding sequence

>Pmo_000476.2711.5110 ID=Pmo_000476.2711.5110|Name=Pmo_000476.2711.5110|organism=Phagocata morgani|type=CDS|length=2400bp
ATGGAGGAGAAAAAAGGAGTAAGACGCGGAGGATTACAGAAAAGGTTCTA
TATTATTGAACCGTCTCTTCAACCTGAATCGGTTGTTGATAAGGTAGGCA
AAGAAGGTAAAGCCGTTGCATTGAAGTCTAATTATGCAAACTTTAAATTG
GCTCCGAAAGGACCATTCTATATGTATGATGTAAAAATGCCAGCTAAAAG
TTTGCGAGGAAAGTTAGACGTATTGAATAGCATTGCATCAACGAAAAATA
ATCAACCGTTTTGTTTTGATGGTCGTCGACTTTTCACTTCATCTCAATGG
CACAAAGAAGATATTGAAACATTTACAATAAAGGAAGATGAAATTTCAAT
TAGATTTTTAGCTTCATTTATTGAGAATACTGAAGAATACTATCAAATGG
TCAATATTATATTTAACAACATTCAAGTTTTTATGGGCCAAGAAAGAATT
GGTCGGGCATATTTTTTGGGTTCTAATTCTAATGAAGCAACGTCTAAGTT
TGGACCGTCATTTTTCAAGAAAGATAACTTTAAGATATTAGGGGGTTTTT
CTACTACTCTTACTCGTGGAACAAGTCAAGATGGTACTGCTTCTACTTTG
CTTTATTTGGAACGTATTAATCGGGTCTTGAATGAAAATTCCGTTTATAA
TATTTACAATAAGAATCAGCTTGATTTGCTTATTGGGCGAGATGTTATAA
CTAAGCATAATAATAAAACATATCGTATAAGCGATATAAAAGAAATTGAT
GTTACAGAACAAATTGAATTAAATGGCACAAAGATTTCTTATGTTGATTA
CTTTAAGCAACGATACAACATTACTTTAAACAATGGTAAACAACCGTTTG
TAATTTCACGAATGAAACGAGTTGGTATTAATCGAAAAGAGAATCTTGAA
AATGAACCAGAAGCTCCTAAGGAAGCTGATGAAAGTTTATCCATTCCAGG
AGAGTTGTGTTTTTTGTGTGGTTTTTCGGATAGTGAAAGAAGTAATCTTA
ATTTACAAAAAAGTTTAGGATCTGTTCTTAAAAGAGAACCACGCGAAAGA
TTACGAGATATTAGTGACTTTTGTAGCTGGACAACTGAAGGAAAAGCTGC
TCCATTTATGGGAAAATGGGGGGTTGAGCTAGATAACCAACCAATTACCA
TTATGGGTAGGGAACTTAATGGAGTGGAGGTTATCTCAAACAAGCGGCGT
ATTAATGATAAAACTTCTGACGATTGGAAATTTGGAGAAGTGAAATTTGA
TATTCCGGCTGGAGCTCAGCATAGATTTGCGGTATTAGTTGTTGAAAGAA
ATCCGAGTCAGTTCAACCAATTCATTGATGATGTTAAACGAGAAATGGGT
AGATTGCGGGTTAACCATTTAATTGAAACAGTGGTATCTTGCAGAACAAA
TGAAATTGAGGATTTTCTTAGCGATTTCATTCGCGTTCAAAAGGTTCATA
TGGCTCTTGTTTTTATTGGTGATGATAAAGCGTATGCACGAGTTAAAAAT
TTCACAATAAGTACAGGGTTATTAACTCAATGTGTTACTGTTCGAAATGG
AACAAATCGTGATGATCGTCGACGAAAGGTTGTTGCAGATAAAAGTGTCA
TGCAAATGTTTGCAAAATTAGGCTATGATCCATGGGGTGTTGAATTAAAA
ATGGTTCCGACAATGATAGTTGGATTAGATACGTTTCATAGCAAAACTGG
TAAACGATCAATTCAAGCTTCTGTTTTTAGTATAAGTTCCAAGTTTTCGC
AATATTTAAGTTTTGTTAATTCGTCCAAAGGGAAAAATGAATATCACGAC
AATTTGGCACAAAATTTTAAGGCTGCTATACAAACATTTAAAGAGAAGTT
TAATACGTTGCCACAACGCTTTATAATTTACCGAGATGGAGTCGGTGATT
CTCAATTGTACTTCACTAAGAAATATGAAACTGATGCTGTTTTGAAATTC
ATGGAATCGGTTTATGAAAATGAAACTCTTCCGCAGCTGATCTATGTTAT
TGTGAAGAAGCGGATTAGTGTTAAGTTTTTCAAAGACGGTAGTAATCCGA
ATCCAGGTACCATTGTTGACGAGAAAATTGTTAAACCAAACTTTTATGAA
TTTTATTTGGTTTCACAAAGAACGACAAAGGGGACTGCAACGCCAACTAA
TTACAATGTTTTAATGGACACGCAATTGACTAACCGTAAATCGGGTGAAA
AGACACCGATTCCGCCAAGTCAATTGCAACATATTACTTATGCTTTGACG
CATTTGTACTTTAATTGGATGGGTACTATTCGTGTACCGGTACCTACTCA
TTATGCCCATCGTTTGGCGGAACTAGTCGGCACTGTGCATCGGGGCACCA
ATCCGCCGGTTATTTCTGATCGAATTCGTGAACGCTTGTTCTATCTTTAG
back to top
Gene Groups
Pmo_000476 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.