Pgr_029537, Pgr_029537 (mRNA) Phagocata gracilis

Overview
NamePgr_029537
Unique NamePgr_029537
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1547
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_029537 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 260/401 (64.84%), Postives = 326/401 (81.30%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSK 1399
            ME L+ +FS+ NV  YVGVED ADKASFLFSV ILVVCT+I++ K+YI   ++CYIPI+ TG   E Y++NYCW HGTIP R NET+PQ    W+Q D +RRLNYYQWVPFVLGLQGVLFYLPR+IW+T++YNLSGNDLEGLV SAKKA +Q+ + R+E I Q+++CLED+  QRRVL  +K P+L+Q+ S+ CC RRTGVF  SLY +IK+LYL NA  QI LMQ+FL+ GV+ L+  FG TIL+DI+SG+ WNDNL+FPRV++C+I  ISTV  KNHH+AQCALP+NMLNEK+YIFLWFWTVGV  +T+ SIP+W++RMTF RKR++F+KRFLK+KS Y K K ++L+ QFV  FLRHDG+F+L +ISLNAGDLI TDIVS LWEIY ++Y  + DF K
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKI-DFRK 399          
BLAST of Pgr_029537 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 256/401 (63.84%), Postives = 330/401 (82.29%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSK 1399
            ME  L+QF++     YVG+EDAADKASFLFSV ILVVC++I++ K+YI   +SCYIP++++G + + YVKNYCWVHGTIP  +NET+PQT+D+W+  D  R++NYYQWVPFVLGLQGVLFYLPR+IW+T++YNLSGNDLEGLV SAKKA +Q+ + R+E I Q+++CLED+  QRRVL  +K P+L+Q+ S+ CC RRTGVF  SLY +IK+LYL NA  QI LMQ+FL+ GV+ L+  FG TIL+DI+SG+ WNDNL+FPRV++C+I  ISTV  KNHH+AQCALP+NMLNEK+YIFLWFWTVGV  +T+ SIP+W++RMTF RKR++F+KRFLK+KS Y K K ++L+ QFV  FLRHDG+F+L +ISLNAGDLI TDIVS LWEIY ++Y  + DF K
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKI-DFRK 399          
BLAST of Pgr_029537 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 403.675 bits (1036), Expect = 1.702e-135
Identity = 190/396 (47.98%), Postives = 265/396 (66.92%), Query Frame = 2
Query:  200 EQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFC--C--SRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHY 1375
            E+ L       ++TYVG+ED ADK SFLFSV +L++  +++T K Y+   ++CY      G NFE Y++NYCWVHGTI     E IPQ +  W + D  RR+NYYQWVPF+LGLQ ++FY+P++IWQ + YN SG +LE +V  A  A +    +R++ IE+I+R +EDMLFQ R         L+++    C  C  S+  G +L   Y LIK LY +N  GQ+++M+ FL  G  + +  FG T+L ++ISG+ W+   +FPRV YCY+  I  VG  N +VAQCALPVNMLNEK+Y+FLWFW V V I+T  SIP+W +RM F+ +R +F+KRFL +  NYE+   + ++  F+  FLRHDGVFL+RM+ +NAGD+IT DIV+RL EIY E+Y
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYER-SDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENY 396          
BLAST of Pgr_029537 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 392.889 bits (1008), Expect = 1.865e-131
Identity = 195/395 (49.37%), Postives = 273/395 (69.11%), Query Frame = 2
Query:  236 ATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRA---SMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSP 1411
            A +VG+ED ADK SF  S +IL++ T++IT K Y+L S++CYIPI  +G +F+ ++K+YCWVHGTIP++ N  +P   + W +MD   R+NYYQWVPFVL LQG+LFYLPR+IWQ + YNLSG DLEGLV  A  A +Q  K + E ++QI+  LE++LF  R ++    P++ + +   S  C  +R+G  L + Y  IK+LY+INAFGQ++LMQ+FL  G  H    FG  +L++I+ GR WND ++FPRV YCY+  I  V  KN+++AQC LP+NMLNEK+YIFLWFWTV V   T  S+  W++R+T    +  F+K+FL+++  Y   +   +L+ F   FLR DGVF+LRM S+NAGDLIT DIV+ LW IY E + +  +FSK+  P
Sbjct:   16 ADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFG--HKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTD-EDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE-NFSKSGVP 404          
BLAST of Pgr_029537 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 372.089 bits (954), Expect = 2.859e-123
Identity = 178/412 (43.20%), Postives = 265/412 (64.32%), Query Frame = 2
Query:  200 EQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFC--C--SRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSPKQFV 1423
            ++ L+      +++Y G+ED AD+ +F+FSV IL +  +I+TAK Y    +SCY+    +G NF+ Y++NYCWVHGTIP   NE IP   + W   D ++R+ YYQWVPF+LGLQ +LFY+P+++W+ + YN  G +LE L+T+A  +      +R+  +  I R +ED+L+Q R     K    ++R   +C  C  S+  G +L S YF IK LY IN  GQ+YLM+ FL  G       FG TIL DIISG++W++   FPRV+YCY   I  +G  N +VAQC LPVNMLNEK+YIFLWFW + V IITL SI  WV R+ F+ KR  F K+ LK+  +Y++ ++   +  F+  +LR+DG+FL+RMI +N+GD++  +I++ LWE Y   Y + +DF+  ++ ++ +
Sbjct:    4 QEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFL--GFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLT-VNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYIN-HDFTNYNNYEKLI 411          
BLAST of Pgr_029537 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 228.794 bits (582), Expect = 1.185e-67
Identity = 134/394 (34.01%), Postives = 222/394 (56.35%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAA-DKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDML-FQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEH 1372
            M  LL  F+SA  +    V+D   DK ++ ++ AI+ V  I+++AK+Y+   + C++P   T    E Y +NYCWV  T  L  ++ IP    +       R++ YYQWVPFVL L+ +LFY+P ++W+ + +  SG  ++ LV  A  +     + R  A++ I+  +E+ L  + +V+  ++  LL    ++  C+R +G  +  LY  +KILY +N  GQI+L+  FL     + S  +G+ +L D+++GR W ++  FPRV  C    +  +G  + H  QC L +NM NEK+++FLWFW   +A  TLCS+  W++      ++  FV ++L     Y+ +  Q  L +FV  FLR DGVFLLRM++ +AG+L   ++   LW  Y ++
Sbjct:    1 MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQS-LRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Pgr_029537 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 219.55 bits (558), Expect = 1.108e-62
Identity = 134/414 (32.37%), Postives = 222/414 (53.62%), Query Frame = 2
Query:  206 LLAQFSSANVATYVGVEDA-ADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPL-----LKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQD--LLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKAS-SPKQF 1420
            +L   +SA  A Y  ++D   DK ++ ++  IL    ++++AK+Y+   + C++P   T    E Y +NYCWV  T  +   E IP+     +     R++ YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     + +   +  ++R ++D + Q   +D   H       L+  A+   C R  G ++  LY  IK+LY  N   Q +L+ H L  G   L+ GF  ++L+D++    W    MFPRV  C    +  +G  + H  QC L +NM NEK+++FLWFW +   I+T+C+   W+  M    +   FV+++L+V  ++      D   L +F   FLR DGVF+LRMIS +AG+L++++++  LW+          DF+    SP QF
Sbjct:  122 ILYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTD-AMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEV-QLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGF--SLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ----------DFNNVDRSPTQF 511          
BLAST of Pgr_029537 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 192.971 bits (489), Expect = 1.168e-53
Identity = 124/401 (30.92%), Postives = 208/401 (51.87%), Query Frame = 2
Query:  248 GVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQID-KDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFS-----LYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKV--KSNYEKLKHQD-----------------LLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIE 1369
            G +DA D+ ++ ++  IL VC ++I+AK+Y    + C++    +  + E Y+++YCW+  T  IP+  N     T  +      E+++ YYQWVPF+L  + ++F LP + W+   +  SG +++ L+ +A  A + +D  DRQ+A+E I+    D L         + P  + RA  +    +   FL       +Y   K+LY +N   Q +++   L+         FG  +L DI +GR W +   FPRV  C    +  +   N +  QCAL +N++NEKV+ FLW W + +AIIT CS   W+       ++ ++V +F+++   S Y+KL+  +                 LL+ FV  FL+ DG+ +LRMIS +AGD+I   +V  LW+ Y E
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVN-PHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNL-------DLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF---FGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRE 400          
BLAST of Pgr_029537 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 188.348 bits (477), Expect = 4.057e-52
Identity = 119/393 (30.28%), Postives = 197/393 (50.13%), Query Frame = 2
Query:  254 EDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSR---RTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSPKQ 1417
            +DA D+ S++ +  +L   +I+++ K+Y+  ++ C++P+   G  +E Y ++YC++  T  IP RS E     ED+      +  + YYQWVP VL +Q  +FYLP  IW ++ Y   G D   +++ A+   SQ  + R + + ++   + D      +LDT      K     F C R     G     LY  IK++YL N F Q  ++  FL    T L   +G     D+ +GR W D+ +FPRV  C    +  +   + +  QC L +NM NEK+Y+F+WFW V V I T  +    ++R++F   R  +++  L    N  K   + ++  F    L+ DGV L+R I  +AG ++T +I   L++ + E+     DF    S K 
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERS-EIPGDVEDR-----QKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGD------ILDTRS----KNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG-NETFL---WGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFK-DEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTKS 389          
BLAST of Pgr_029537 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 187.963 bits (476), Expect = 1.004e-51
Identity = 123/407 (30.22%), Postives = 205/407 (50.37%), Query Frame = 2
Query:  230 NVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQID-KDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFS-----LYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQD-------------------LLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIE 1369
            N  +  G +DA D+ ++ ++  IL VC ++I+AK+Y    + C++    +  + E Y+++YCW+  T  IP+  N     T  +      E+++ YYQWVPF+L  + ++F LP + W+   +  SG +++ L+ +A    + +D  DRQ+A+E I+    D L         + P  + RA  +    +   FL       L+   K+LY +N   Q  ++   L+         FG  +L DI +GR W +   FPRV  C    +  +   N +  QCAL +N++NEKV+ FLW W + +AIIT CS   W+       ++ ++V +F+++  + E  K Q                    LL+ FV  FL+ DGV +LRMIS +AGD+I   +V  LW+ + E
Sbjct:   29 NALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVN-PHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNL-------DLQSPNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLF---FGFQVLNDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRE 416          
BLAST of Pgr_029537 vs. RefSeq Drosophila melanogaster
Match: gi|17864458|ref|NP_524824.1| (optic ganglion reduced, isoform A [Drosophila melanogaster])

HSP 1 Score: 96.2857 bits (238), Expect = 1.975e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_029537 vs. RefSeq Drosophila melanogaster
Match: gi|24640272|ref|NP_727147.1| (optic ganglion reduced, isoform B [Drosophila melanogaster])

HSP 1 Score: 96.2857 bits (238), Expect = 1.975e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_029537 vs. RefSeq Drosophila melanogaster
Match: gi|386763961|ref|NP_001245557.1| (optic ganglion reduced, isoform C [Drosophila melanogaster])

HSP 1 Score: 96.2857 bits (238), Expect = 1.975e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_029537 vs. RefSeq Drosophila melanogaster
Match: gi|386763963|ref|NP_001245558.1| (optic ganglion reduced, isoform D [Drosophila melanogaster])

HSP 1 Score: 96.2857 bits (238), Expect = 1.975e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_029537 vs. RefSeq Drosophila melanogaster
Match: gi|442615362|ref|NP_001259299.1| (optic ganglion reduced, isoform E [Drosophila melanogaster])

HSP 1 Score: 96.2857 bits (238), Expect = 1.975e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
The following BLAST results are available for this feature:
BLAST of Pgr_029537 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pgr_029537 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150036490.000e+064.84SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150036480.000e+063.84SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150008371.702e-13547.98Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150009181.865e-13149.37Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150006572.859e-12343.20Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Pgr_029537 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL1.185e-6734.01RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.108e-6232.37RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.168e-5330.92RecName: Full=Innexin-19[more]
gi|12643734|sp|Q19746|INX3_CAEEL4.057e-5230.28RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|74959869|sp|O61715|INX19_CAEEL1.004e-5130.22RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
back to top
BLAST of Pgr_029537 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17864458|ref|NP_524824.1|1.975e-2125.40optic ganglion reduced, isoform A [Drosophila mela... [more]
gi|24640272|ref|NP_727147.1|1.975e-2125.40optic ganglion reduced, isoform B [Drosophila mela... [more]
gi|386763961|ref|NP_001245557.1|1.975e-2125.40optic ganglion reduced, isoform C [Drosophila mela... [more]
gi|386763963|ref|NP_001245558.1|1.975e-2125.40optic ganglion reduced, isoform D [Drosophila mela... [more]
gi|442615362|ref|NP_001259299.1|1.975e-2125.40optic ganglion reduced, isoform E [Drosophila mela... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_029537 ID=Pgr_029537|Name=Pgr_029537|organism=Phagocata gracilis|type=mRNA|length=1547bp
CTCAAATCCAACAACTGAAAATTGTTTACAATTGAATCGTCTTTATCGCA
TATCAATAATCGGTAAGGCGAGCAAATAAAATTAACATTTACATCGCTTA
AAGGACGGTTGTTAGACACGAATCTATGTGATGACATTTACCACTAACCA
TTTCTACCATTTCATTTCATACATTGGAATCTAAATTAATTGGAAAATGG
AGCAATTACTTGCACAGTTTTCCAGTGCCAATGTGGCCACTTATGTCGGA
GTTGAGGATGCCGCCGACAAGGCGAGTTTTCTGTTCAGTGTCGCCATCTT
GGTGGTGTGCACGATAATAATCACTGCCAAGGAATACATACTCGATTCGA
TGTCGTGTTATATTCCTATTATGATGACGGGACACAATTTCGAGGTATAT
GTGAAGAATTACTGTTGGGTACATGGAACGATTCCACTTAGAAGTAATGA
AACTATTCCACAAACGGAAGATCAGTGGCTACAAATGGATTTGGAAAGAA
GACTAAATTACTATCAATGGGTACCATTCGTTCTTGGTCTTCAAGGAGTT
CTCTTCTATCTTCCACGGATGATTTGGCAAACTGTTGTCTACAATTTAAG
TGGTAACGATCTCGAAGGCTTAGTAACCAGTGCAAAAAAAGCCTGCAGTC
AAATCGACAAAGACCGACAAGAGGCAATCGAACAAATTTCTCGCTGCTTG
GAGGACATGCTCTTCCAGCGACGGGTTCTGGACACATCAAAGCATCCGTT
GTTGAAACAGAGAGCATCGATGTTCTGTTGCAGTCGACGAACCGGGGTGT
TTTTGTTCAGTTTATATTTTCTAATAAAAATACTATATTTAATCAATGCT
TTTGGTCAAATCTATTTGATGCAACATTTTCTGCGTATCGGTGTCACTCA
TCTAAGTGGAGGATTCGGGGTGACAATATTGCGAGACATAATTTCTGGGC
GAACGTGGAATGATAATCTGATGTTCCCGCGAGTGGCCTACTGCTACATT
GGTGGCATATCAACTGTGGGCACTAAAAACCACCACGTGGCTCAGTGTGC
TCTGCCGGTGAATATGCTCAACGAGAAGGTGTACATCTTTCTTTGGTTCT
GGACTGTGGGAGTGGCGATTATCACTTTGTGCAGTATTCCAATCTGGGTG
TTCCGGATGACCTTTATAAGGAAGAGAAGGGAATTTGTGAAAAGATTTTT
AAAAGTGAAATCGAATTATGAGAAACTCAAACATCAGGATCTGTTGGAAC
AGTTTGTGGGCACTTTTTTAAGACATGATGGAGTGTTCCTGTTGCGGATG
ATTTCTCTAAATGCCGGGGATTTGATCACTACAGACATTGTGAGCAGATT
GTGGGAAATTTACATTGAACACTACAATGACGTCTACGATTTTAGCAAGG
CTTCGTCTCCCAAACAATTTGTCTAAAATATCGACTGAATAAACAATGCT
CTTTTATTGTAGAATTGTTTTAATCAGTGACCTTTCACATTTTATATAAT
GTTCGTATTTTCAATTAAACAAAATATATTAGTTTATTAACTTGCAA

Design Primers for Pgr_029537

back to top

protein sequence

>Pgr_029537-protein ID=Pgr_029537-protein|Name=Pgr_029537|organism=Phagocata gracilis|type=polypeptide|length=410bp
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
back to top

coding sequence

>Pgr_029537.197.1426 ID=Pgr_029537.197.1426|Name=Pgr_029537.197.1426|organism=Phagocata gracilis|type=CDS|length=1230bp
ATGGAGCAATTACTTGCACAGTTTTCCAGTGCCAATGTGGCCACTTATGT
CGGAGTTGAGGATGCCGCCGACAAGGCGAGTTTTCTGTTCAGTGTCGCCA
TCTTGGTGGTGTGCACGATAATAATCACTGCCAAGGAATACATACTCGAT
TCGATGTCGTGTTATATTCCTATTATGATGACGGGACACAATTTCGAGGT
ATATGTGAAGAATTACTGTTGGGTACATGGAACGATTCCACTTAGAAGTA
ATGAAACTATTCCACAAACGGAAGATCAGTGGCTACAAATGGATTTGGAA
AGAAGACTAAATTACTATCAATGGGTACCATTCGTTCTTGGTCTTCAAGG
AGTTCTCTTCTATCTTCCACGGATGATTTGGCAAACTGTTGTCTACAATT
TAAGTGGTAACGATCTCGAAGGCTTAGTAACCAGTGCAAAAAAAGCCTGC
AGTCAAATCGACAAAGACCGACAAGAGGCAATCGAACAAATTTCTCGCTG
CTTGGAGGACATGCTCTTCCAGCGACGGGTTCTGGACACATCAAAGCATC
CGTTGTTGAAACAGAGAGCATCGATGTTCTGTTGCAGTCGACGAACCGGG
GTGTTTTTGTTCAGTTTATATTTTCTAATAAAAATACTATATTTAATCAA
TGCTTTTGGTCAAATCTATTTGATGCAACATTTTCTGCGTATCGGTGTCA
CTCATCTAAGTGGAGGATTCGGGGTGACAATATTGCGAGACATAATTTCT
GGGCGAACGTGGAATGATAATCTGATGTTCCCGCGAGTGGCCTACTGCTA
CATTGGTGGCATATCAACTGTGGGCACTAAAAACCACCACGTGGCTCAGT
GTGCTCTGCCGGTGAATATGCTCAACGAGAAGGTGTACATCTTTCTTTGG
TTCTGGACTGTGGGAGTGGCGATTATCACTTTGTGCAGTATTCCAATCTG
GGTGTTCCGGATGACCTTTATAAGGAAGAGAAGGGAATTTGTGAAAAGAT
TTTTAAAAGTGAAATCGAATTATGAGAAACTCAAACATCAGGATCTGTTG
GAACAGTTTGTGGGCACTTTTTTAAGACATGATGGAGTGTTCCTGTTGCG
GATGATTTCTCTAAATGCCGGGGATTTGATCACTACAGACATTGTGAGCA
GATTGTGGGAAATTTACATTGAACACTACAATGACGTCTACGATTTTAGC
AAGGCTTCGTCTCCCAAACAATTTGTCTAA
back to top
Gene Groups
Pgr_029537 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.