Pgr_025217, Pgr_025217 (mRNA) Phagocata gracilis

Overview
NamePgr_025217
Unique NamePgr_025217
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1477
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_025217 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 268/408 (65.69%), Postives = 323/408 (79.17%), Query Frame = 1
Query:  118 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSP 1341
            MVLSEF+ + T YKW +FVGMEDFADKLSF++STS+LLL+T++ITVKSYLLTSIACYIPI PSGKDFDDFLKSYCWVHGTIP+  +LP   D  +WE++D   RINYYQWVPFVLALQGILFYLPRI+WQ++TYNLSG DLEGLVEMANSA NQTG+ K+ TV QIA NLEN+ F HR+IN H++ +  K + AK+WLC+ KRSGRQL  QYMFIK+LY+IN FGQL LMQ FL FG     FGY+VLKNIL GREWNDT IFPRVTYCY+  IQHV ++N+YLAQC LPINMLNEK+YIFLWFWTV V   T  S+  W++R+T    +  F+K+FL+++  Y   +   +L+ F   FLR DGVF+LRM S+NAGDLIT DIV+ LW IY E + +  +FSK+  P
Sbjct:    1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP--PDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTD-EDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE-NFSKSGVP 404          
BLAST of Pgr_025217 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 426.402 bits (1095), Expect = 5.417e-145
Identity = 208/404 (51.49%), Postives = 293/404 (72.52%), Query Frame = 1
Query:  124 LSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTH--DHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSK 1329
            +  FLS  T ++   +VG+ED ADK SF  S  +L++ ++I++ K Y+   I+CYIP+  SG D D ++K+YCWVHGTIP  A+   P+ ++ W   D +++INYYQWVPFVL LQG+LFYLPR++W+ + YNLSG DLEGLV  A  A NQ GE++  T+ Q+A+ LE++F   R +  H +   ++  +  + +C G+R+G   I  Y+ IK+LYL N   Q+ILMQ FL++G    +  FG+ +LK+ILSG++WND  +FPRV++C+++ I  V  +N ++AQCALPINMLNEK+YIFLWFWTVGV  +T+ SIP+W++RMTF RKR++F+KRFLK+KS Y K K ++L+ QFV  FLRHDG+F+L +ISLNAGDLI TDIVS LWEIY ++Y  + DF K
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKI-DFRK 399          
BLAST of Pgr_025217 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 415.231 bits (1066), Expect = 9.613e-141
Identity = 202/404 (50.00%), Postives = 289/404 (71.53%), Query Frame = 1
Query:  124 LSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTH--DHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSK 1329
            +   +   + +    +VG+ED ADK SF  S  +L++ T+I++ K Y+   IACYIPI  +G+  +D++++YCW HGTIP   +   P++   W + D ++R+NYYQWVPFVL LQG+LFYLPR++W+ + YNLSG DLEGLV  A  A NQ GE++  T+ Q+A+ LE++F   R +  H +   ++  +  + +C G+R+G   I  Y+ IK+LYL N   Q+ILMQ FL++G    +  FG+ +LK+ILSG++WND  +FPRV++C+++ I  V  +N ++AQCALPINMLNEK+YIFLWFWTVGV  +T+ SIP+W++RMTF RKR++F+KRFLK+KS Y K K ++L+ QFV  FLRHDG+F+L +ISLNAGDLI TDIVS LWEIY ++Y  + DF K
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFL-QRRVLGHTKFPVLR--QKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKI-DFRK 399          
BLAST of Pgr_025217 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 404.06 bits (1037), Expect = 6.733e-136
Identity = 199/397 (50.13%), Postives = 273/397 (68.77%), Query Frame = 1
Query:  118 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHN-RSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHY 1305
            MV  EFL+ +  +K   +VG+EDFADKLSF  S +LL+L  +++T+KSYL   +ACY    P G +F+++L++YCWVHGTI        P+++  W   D  +RINYYQWVPF+L LQ I+FY+P+I+WQI+ YN SG +LE +V  AN+A N     + + +++IA  +E+M F HR+    N   L  K     N+    K  G  LI+ Y+ IK LY +NV GQL +M+KFL F      FGY VL N++SG+EW+ T IFPRVTYCYV  I+HVG+ N Y+AQCALP+NMLNEK+Y+FLWFW V V I+T  SIP+W +RM F+ +R +F+KRFL +  NYE+   + ++  F+  FLRHDGVFL+RM+ +NAGD+IT DIV+RL EIY E+Y
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYER-SDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENY 396          
BLAST of Pgr_025217 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 340.502 bits (872), Expect = 2.314e-111
Identity = 174/419 (41.53%), Postives = 263/419 (62.77%), Query Frame = 1
Query:  118 MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAK-------NWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSPKQFV 1353
            MV  EFLS +  +K  ++ G+EDFAD+L+F  S  +L L  +I+T K+Y    ++CY+   PSG +FD ++++YCWVHGTIP   +   P     W   D ++RI YYQWVPF+L LQ ILFY+P+++W+I+ YN  G +LE L+  A  +       + + +  I   +E++ + HR+          K AKA+       N+    K  G  L+  Y FIK LY INV GQL LM+ FL F +    FGY +L +I+SG+ W++T+ FPRV+YCY   I+H+G  N Y+AQC LP+NMLNEK+YIFLWFW + V IITL SI  WV R+ F+ KR  F K+ LK+  +Y++ ++   +  F+  +LR+DG+FL+RMI +N+GD++  +I++ LWE Y   Y + +DF+  ++ ++ +
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYR------QGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLT-VNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYIN-HDFTNYNNYEKLI 411          
BLAST of Pgr_025217 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 219.935 bits (559), Expect = 1.667e-64
Identity = 134/398 (33.67%), Postives = 227/398 (57.04%), Query Frame = 1
Query:  115 TMVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEH 1302
            +M+L  F S V   K + F   +D  DKL++  +T+++ +  I+++ K Y+   I C++P   + +  + + ++YCWV  T  +P++  +P    E        N++I YYQWVPFVLAL+ +LFY+P IVW+++++  SG  ++ LV+MA  +     E +N  ++ IA N+E       ++   NR       K  N +   + SG  +   Y+ +K+LY +N+ GQ+ L+  FL  G    ++G  VL ++++GREW ++  FPRVT C   +++ +G  + +  QC L INM NEK+++FLWFW   +A  TLCS+  W++      ++  FV ++L     Y+ +  Q  L +FV  FLR DGVFLLRM++ +AG+L   ++   LW  Y ++
Sbjct:    2 SMLLYYFASAV---KSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAER------ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNR------LKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQS-LRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Pgr_025217 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 219.55 bits (558), Expect = 5.809e-63
Identity = 134/397 (33.75%), Postives = 227/397 (57.18%), Query Frame = 1
Query:  181 EDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEEL--DRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLEN-MFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQD--LLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSPKQF 1350
            +DF DKL++  +T++L    ++++ K Y+   I C++P   +    + + ++YCWV  T  +PM   +P         E+   RN++I YYQWVPF+LA++ +LFY+P I+W+ + Y  SG +L+GLV+MA  A     E+K  TV  +A ++++ +   + +   H+RS         N    G+  G  + + Y+ IK+LY  NV  Q  L+   L  G++D  +G+ +LK+++   EW  T +FPRVT C   +++ +G  + +  QC L INM NEK+++FLWFW +   I+T+C+   W+  M    +   FV+++L+V  ++      D   L +F   FLR DGVF+LRMIS +AG+L++++++  LW    + +N+V       SP QF
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIP--------REIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW----QDFNNV-----DRSPTQF 511          
BLAST of Pgr_025217 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 198.364 bits (503), Expect = 7.593e-56
Identity = 129/401 (32.17%), Postives = 221/401 (55.11%), Query Frame = 1
Query:  175 GMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGK----RSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKV--KSNYEKLKHQD-----------------LLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEH 1302
            G +D  D+L++  +  +L +  ++I+ K Y  T I C++    S +  +++++SYCW+  T  IPM  ++P   D  A EE    ++I YYQWVPF+L  + ++F LP I W++ ++  SG +++ L+   N+AC+    +  +  ++  E +   F  + ++   N  +     +A+ W+   K     SG+ + I Y F K+LY +NV  Q  ++   L+  +   +FG+ VL +I +GR W +T  FPRVT C   +++++   N Y  QCAL IN++NEKV+ FLW W + +AIIT CS   W+       ++ ++V +F+++   S Y+KL+  +                 LL+ FV  FL+ DG+ +LRMIS +AGD+I   +V  LW+ Y E 
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER 401          
BLAST of Pgr_025217 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 195.282 bits (495), Expect = 1.349e-54
Identity = 128/401 (31.92%), Postives = 219/401 (54.61%), Query Frame = 1
Query:  175 GMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGK----RSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQD-------------------LLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEH 1302
            G +D  D+L++  +  +L +  ++I+ K Y  T I C++    S +  +++++SYCW+  T  IPM  ++P   D  A EE    ++I YYQWVPF+L  + ++F LP I W++ ++  SG +++ L+   N+AC+    +  +  ++  E +   F  + ++   N  +     +A+ W+   K     SG+ L I + F K+LY +NV  Q +++   L+  +   +FG+ VL +I +GR W +T  FPRVT C   +++++   N Y  QCAL IN++NEKV+ FLW W + +AIIT CS   W+       ++ ++V +F+++  + E  K Q                    LL+ FV  FL+ DGV +LRMIS +AGD+I   +V  LW+ + E 
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLI---NAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRI-----RARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER 417          
BLAST of Pgr_025217 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 188.348 bits (477), Expect = 2.931e-52
Identity = 120/393 (30.53%), Postives = 204/393 (51.91%), Query Frame = 1
Query:  181 EDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDFDDFLKSYCWVHGT--IPMNASLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQIFPRVTYC--YVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFSKASSPKQ 1347
            +D  D+LS+  + +LL   +I+++ K Y+ ++I C++P++  G  ++ + + YC++  T  IP  + +P   ++       +   I YYQWVP VLA+Q  +FYLP  +W  + Y   G D   ++  A +  +Q  E +   V ++ + + ++    R  N + R    +          GK  G    + Y+ IK++YL NVF Q I++ KFL  G     +G+    ++ +GREW D+ +FPRVT C   V K+ +V   + Y  QC L INM NEK+Y+F+WFW V V I T  +    ++R++F   R  +++  L    N  K   + ++  F    L+ DGV L+R I  +AG ++T +I   L++ + E+     DF    S K 
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDR------QKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT-RSKNEYGRFYCYRF---------GKGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANV---HRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFK-DEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTKS 389          
BLAST of Pgr_025217 vs. RefSeq Drosophila melanogaster
Match: gi|24643568|ref|NP_728361.1| (shaking B, isoform A [Drosophila melanogaster])

HSP 1 Score: 96.6709 bits (239), Expect = 1.396e-21
Identity = 93/344 (27.03%), Postives = 148/344 (43.02%), Query Frame = 1
Query:  163 VNFVGMEDFADKLSFNVXXXXXXXXXXXXXVKSYLLTSIACYIPIQPSGKDF-DDFLKSYCWVHGTIPMNA--------SLPWPKDENAWEELDRNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVG------------VAIITLCSIPIWVFRMTFIRKRREFVK 1122
            V+ V  +    +L ++++  +L+  ++IIT + Y+   I C        KD  +D L +YCW+  T  + +        S+P+P   N+  +    +   YYQWV F L  Q ILFY PR +W+    +  G  +  L+   +       E K      +    EN+                   +  NW             +Y   ++L LINV GQ+ LM +F  F      FG  V+  + + +E        IFPR+T C   K    G    + A C LP+N++NEK+YIFLWFW +             V II    + +++FRM F   RR+ ++
Sbjct:   14 VSHVKTDSIVFRLHYSITVMILMSFSLIITTRQYVGNPIDCV-----HTKDIPEDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIE 317          
BLAST of Pgr_025217 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 94.3597 bits (233), Expect = 1.131e-20
Identity = 82/294 (27.89%), Postives = 124/294 (42.18%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVG------------VAIITLCSIPIWVFRMTFIRKRREFVK 1122
            +D L +YCW+H T  +         + +P+P   N+        +   YYQWV F L  Q ILFY PR +W+    +  G  +  L+   +       E K      +    EN+                   +  NW             +Y   ++L LINV GQ+ LM +F   +F T    FG  V+  + + +E        IFPR+T C   K    G    + A C LP+N++NEK+YIFLWFW +             V II    + +++FRM F   RR+ ++
Sbjct:   66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIE 322          
BLAST of Pgr_025217 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 94.3597 bits (233), Expect = 1.131e-20
Identity = 82/294 (27.89%), Postives = 124/294 (42.18%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVG------------VAIITLCSIPIWVFRMTFIRKRREFVK 1122
            +D L +YCW+H T  +         + +P+P   N+        +   YYQWV F L  Q ILFY PR +W+    +  G  +  L+   +       E K      +    EN+                   +  NW             +Y   ++L LINV GQ+ LM +F   +F T    FG  V+  + + +E        IFPR+T C   K    G    + A C LP+N++NEK+YIFLWFW +             V II    + +++FRM F   RR+ ++
Sbjct:   66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIE 322          
BLAST of Pgr_025217 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 94.3597 bits (233), Expect = 1.131e-20
Identity = 82/294 (27.89%), Postives = 124/294 (42.18%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVG------------VAIITLCSIPIWVFRMTFIRKRREFVK 1122
            +D L +YCW+H T  +         + +P+P   N+        +   YYQWV F L  Q ILFY PR +W+    +  G  +  L+   +       E K      +    EN+                   +  NW             +Y   ++L LINV GQ+ LM +F   +F T    FG  V+  + + +E        IFPR+T C   K    G    + A C LP+N++NEK+YIFLWFW +             V II    + +++FRM F   RR+ ++
Sbjct:   66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIE 322          
BLAST of Pgr_025217 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 93.9745 bits (232), Expect = 1.326e-20
Identity = 82/294 (27.89%), Postives = 124/294 (42.18%), Query Frame = 1
Query:  319 DDFLKSYCWVHGTIPM--------NASLPWPKDENAWEELDRN-QRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANSACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCAGKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFL--QFGTHDHYFGYIVLKNILSGREWNDTQ---IFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYIFLWFWTVG------------VAIITLCSIPIWVFRMTFIRKRREFVK 1122
            +D L +YCW+H T  +         + +P+P   N+        +   YYQWV F L  Q ILFY PR +W+    +  G  +  L+   +       E K      +    EN+                   +  NW             +Y   ++L LINV GQ+ LM +F   +F T    FG  V+  + + +E        IFPR+T C   K    G    + A C LP+N++NEK+YIFLWFW +             V II    + +++FRM F   RR+ ++
Sbjct:   50 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENL-------------------RYHNWWAY----------RYYVCELLALINVIGQMFLMNRFFDGEFIT----FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIE 306          
The following BLAST results are available for this feature:
BLAST of Pgr_025217 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pgr_025217 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150009180.000e+065.69Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150036485.417e-14551.49SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150036499.613e-14150.00SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150008376.733e-13650.13Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006572.314e-11141.53Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Pgr_025217 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL1.667e-6433.67RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL5.809e-6333.75RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR7.593e-5632.17RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL1.349e-5431.92RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|12643734|sp|Q19746|INX3_CAEEL2.931e-5230.53RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of Pgr_025217 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24643568|ref|NP_728361.1|1.396e-2127.03shaking B, isoform A [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|1.131e-2027.89shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|1.131e-2027.89shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|1.131e-2027.89shaking B, isoform I [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|1.326e-2027.89shaking B, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_025217 ID=Pgr_025217|Name=Pgr_025217|organism=Phagocata gracilis|type=mRNA|length=1477bp
GGATTTCAGATAATTCGGTGTGTTCTAACGTGAGCGAATAACAATGTCGA
TCAGTGTCACGATTTTATAATTCTAATTAGCGAATTATTGTCGGCAACAT
TTATTAGTCGGAGAACAATGGTACTAAGTGAATTTCTCAGTCACGTTACG
ACCTACAAATGGGTGAACTTCGTCGGCATGGAGGACTTTGCCGACAAGCT
CAGCTTCAATGTTTCGACGTCACTGTTACTATTAATAACCATCATTATAA
CAGTGAAAAGTTACCTACTGACGTCGATAGCCTGTTACATTCCCATACAG
CCATCAGGTAAAGATTTCGATGACTTTCTGAAGAGCTATTGTTGGGTGCA
CGGAACCATTCCAATGAATGCATCGTTACCGTGGCCAAAAGACGAAAATG
CTTGGGAAGAACTGGATAGAAATCAAAGAATAAATTATTATCAATGGGTG
CCATTCGTTCTGGCTCTACAGGGGATTTTGTTCTACTTGCCACGAATTGT
CTGGCAAATAATGACCTACAATCTGTCTGGCGCAGATCTCGAGGGTCTGG
TCGAGATGGCCAACTCTGCCTGCAATCAAACCGGAGAAGTCAAGAATAAC
ACAGTCAAACAAATTGCCGAAAATCTTGAAAATATGTTCTTCTGTCACAG
GGAAATAAATTTCCACAATAGAAGTTTGGCAATAAAAGCTGCCAAGGCCA
AGAATTGGCTTTGTGCCGGAAAACGAAGCGGTCGACAGTTGATAATACAG
TACATGTTCATTAAGATGCTCTACCTGATCAATGTGTTCGGCCAATTGAT
TTTGATGCAGAAGTTCTTGCAGTTCGGCACTCACGACCATTACTTCGGAT
ATATAGTGCTAAAGAATATCCTGAGCGGCCGCGAATGGAATGACACTCAG
ATTTTCCCGAGGGTCACGTACTGTTACGTCAATAAAATCCAACATGTCGG
CATGCAGAACGATTATCTGGCCCAGTGTGCTCTGCCAATTAATATGCTCA
ACGAGAAGGTGTACATCTTTCTTTGGTTCTGGACTGTGGGAGTGGCGATT
ATCACTTTGTGCAGTATTCCAATCTGGGTGTTCCGGATGACCTTTATAAG
GAAGAGAAGGGAATTTGTGAAAAGATTTTTAAAAGTGAAATCGAATTATG
AGAAACTCAAACATCAGGATCTGTTGGAACAGTTTGTGGGCACTTTTTTA
AGACATGATGGAGTGTTCCTGTTGCGGATGATTTCTCTAAATGCCGGGGA
TTTGATCACTACAGACATTGTGAGCAGATTGTGGGAAATTTACATTGAAC
ACTACAATGACGTCTACGATTTTAGCAAGGCTTCGTCTCCCAAACAATTT
GTCTAAAATATCGACTGAATAAACAATGCTCTTTTATTGTAGAATTGTTT
TAATCAGTGACCTTTCACATTTTATATAATGTTCGTATTTTCAATTAAAC
AAAATATATTAGTTTATTAACTTGCAA

Design Primers for Pgr_025217

back to top

protein sequence

>Pgr_025217-protein ID=Pgr_025217-protein|Name=Pgr_025217|organism=Phagocata gracilis|type=polypeptide|length=413bp
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
back to top

coding sequence

>Pgr_025217.118.1356 ID=Pgr_025217.118.1356|Name=Pgr_025217.118.1356|organism=Phagocata gracilis|type=CDS|length=1239bp
ATGGTACTAAGTGAATTTCTCAGTCACGTTACGACCTACAAATGGGTGAA
CTTCGTCGGCATGGAGGACTTTGCCGACAAGCTCAGCTTCAATGTTTCGA
CGTCACTGTTACTATTAATAACCATCATTATAACAGTGAAAAGTTACCTA
CTGACGTCGATAGCCTGTTACATTCCCATACAGCCATCAGGTAAAGATTT
CGATGACTTTCTGAAGAGCTATTGTTGGGTGCACGGAACCATTCCAATGA
ATGCATCGTTACCGTGGCCAAAAGACGAAAATGCTTGGGAAGAACTGGAT
AGAAATCAAAGAATAAATTATTATCAATGGGTGCCATTCGTTCTGGCTCT
ACAGGGGATTTTGTTCTACTTGCCACGAATTGTCTGGCAAATAATGACCT
ACAATCTGTCTGGCGCAGATCTCGAGGGTCTGGTCGAGATGGCCAACTCT
GCCTGCAATCAAACCGGAGAAGTCAAGAATAACACAGTCAAACAAATTGC
CGAAAATCTTGAAAATATGTTCTTCTGTCACAGGGAAATAAATTTCCACA
ATAGAAGTTTGGCAATAAAAGCTGCCAAGGCCAAGAATTGGCTTTGTGCC
GGAAAACGAAGCGGTCGACAGTTGATAATACAGTACATGTTCATTAAGAT
GCTCTACCTGATCAATGTGTTCGGCCAATTGATTTTGATGCAGAAGTTCT
TGCAGTTCGGCACTCACGACCATTACTTCGGATATATAGTGCTAAAGAAT
ATCCTGAGCGGCCGCGAATGGAATGACACTCAGATTTTCCCGAGGGTCAC
GTACTGTTACGTCAATAAAATCCAACATGTCGGCATGCAGAACGATTATC
TGGCCCAGTGTGCTCTGCCAATTAATATGCTCAACGAGAAGGTGTACATC
TTTCTTTGGTTCTGGACTGTGGGAGTGGCGATTATCACTTTGTGCAGTAT
TCCAATCTGGGTGTTCCGGATGACCTTTATAAGGAAGAGAAGGGAATTTG
TGAAAAGATTTTTAAAAGTGAAATCGAATTATGAGAAACTCAAACATCAG
GATCTGTTGGAACAGTTTGTGGGCACTTTTTTAAGACATGATGGAGTGTT
CCTGTTGCGGATGATTTCTCTAAATGCCGGGGATTTGATCACTACAGACA
TTGTGAGCAGATTGTGGGAAATTTACATTGAACACTACAATGACGTCTAC
GATTTTAGCAAGGCTTCGTCTCCCAAACAATTTGTCTAA
back to top
Gene Groups
Pgr_025217 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.