Pgr_024273, Pgr_024273 (mRNA) Phagocata gracilis

Overview
NamePgr_024273
Unique NamePgr_024273
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length4758
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_024273 vs. RefSeq Human
Match: gi|310750400|ref|NP_702913.1| (outer dense fiber protein 2 isoform 1 [Homo sapiens])

HSP 1 Score: 125.176 bits (313), Expect = 5.288e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 2257
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  613 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 888          

HSP 2 Score: 125.176 bits (313), Expect = 5.288e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 3296
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  613 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 888          

HSP 3 Score: 99.3673 bits (246), Expect = 5.104e-20
Identity = 118/440 (26.82%), Postives = 217/440 (49.32%), Query Frame = 2
Query:   77 SYSYSKKLQNSRSSSP-VYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPW---VPPPGKTTRGSKTPLGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            S + +K     RSS+P +++HVD++TP+HV++ K       S   +   G+         K   VN++            S R+++ +PP    + PP      S   L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   81 SVTVTKPTMKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGM---------KGDTVNVR-----------RSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 494          

HSP 4 Score: 99.3673 bits (246), Expect = 5.104e-20
Identity = 118/440 (26.82%), Postives = 217/440 (49.32%), Query Frame = -2
Query: 3408 SYSYSKKLQNSRSSSP-VYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPW---VPPPGKTTRGSKTPLGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4682
            S + +K     RSS+P +++HVD++TP+HV++ K       S   +   G+         K   VN++            S R+++ +PP    + PP      S   L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   81 SVTVTKPTMKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGM---------KGDTVNVR-----------RSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 494          
BLAST of Pgr_024273 vs. RefSeq Human
Match: gi|24430181|ref|NP_002531.3| (outer dense fiber protein 2 isoform 9 [Homo sapiens])

HSP 1 Score: 125.176 bits (313), Expect = 5.364e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 2257
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  525 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 800          

HSP 2 Score: 125.176 bits (313), Expect = 5.364e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 3296
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  525 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 800          

HSP 3 Score: 98.2117 bits (243), Expect = 1.124e-19
Identity = 114/432 (26.39%), Postives = 214/432 (49.54%), Query Frame = 2
Query:   98 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPW---VPPPGKTTRGSKTPLGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            +++  S+ P+++HVD++TP+HV++ K       S   +   G+         K   VN++            S R+++ +PP    + PP      S   L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:    1 MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGM---------KGDTVNVR-----------RSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 406          

HSP 4 Score: 98.2117 bits (243), Expect = 1.124e-19
Identity = 114/432 (26.39%), Postives = 214/432 (49.54%), Query Frame = -2
Query: 3408 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPW---VPPPGKTTRGSKTPLGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4661
            +++  S+ P+++HVD++TP+HV++ K       S   +   G+         K   VN++            S R+++ +PP    + PP      S   L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:    1 MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGM---------KGDTVNVR-----------RSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 406          
BLAST of Pgr_024273 vs. RefSeq Human
Match: gi|310750408|ref|NP_702911.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 124.79 bits (312), Expect = 6.020e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 2257
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 2 Score: 124.79 bits (312), Expect = 6.020e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 3296
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 3 Score: 80.8777 bits (198), Expect = 2.572e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = 2
Query:  260 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          

HSP 4 Score: 80.8777 bits (198), Expect = 2.572e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = -2
Query: 3408 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4499
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          
BLAST of Pgr_024273 vs. RefSeq Human
Match: gi|334278916|ref|NP_001229282.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 124.79 bits (312), Expect = 6.020e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 2257
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 2 Score: 124.79 bits (312), Expect = 6.020e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 3296
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 3 Score: 80.8777 bits (198), Expect = 2.572e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = 2
Query:  260 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          

HSP 4 Score: 80.8777 bits (198), Expect = 2.572e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = -2
Query: 3408 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4499
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          
BLAST of Pgr_024273 vs. RefSeq Human
Match: gi|578817518|ref|XP_006717189.1| (PREDICTED: outer dense fiber protein 2 isoform X1 [Homo sapiens])

HSP 1 Score: 124.79 bits (312), Expect = 6.020e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 2257
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 2 Score: 124.79 bits (312), Expect = 6.020e-28
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 3296
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 3 Score: 80.8777 bits (198), Expect = 2.572e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = 2
Query:  260 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          

HSP 4 Score: 80.8777 bits (198), Expect = 2.572e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = -2
Query: 3408 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4499
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          
BLAST of Pgr_024273 vs. Smed Unigenes AA
Match: SMU15005578 (SmedAsxldir_c106665_g2_i9|m.77475|m.37289)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 441/779 (56.61%), Postives = 571/779 (73.30%), Query Frame = 2
Query:   74 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCA-----------------------------------------DYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 2281
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM      NH +    HC HC                                          D+D S+S   TI+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSFSNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 775          

HSP 2 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 441/779 (56.61%), Postives = 571/779 (73.30%), Query Frame = -2
Query: 2478 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCA-----------------------------------------DYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 4685
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM      NH +    HC HC                                          D+D S+S   TI+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSFSNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 775          
BLAST of Pgr_024273 vs. Smed Unigenes AA
Match: SMU15005577 (SmedAsxldir_c106665_g2_i7|m.77472|m.45171)

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 439/770 (57.01%), Postives = 569/770 (73.90%), Query Frame = 2
Query:   74 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYD--------------------------HSESSFQT------IDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 2281
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM      NH +    HC HC + +                           S  SF        I+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 766          

HSP 2 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 439/770 (57.01%), Postives = 569/770 (73.90%), Query Frame = -2
Query: 2478 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYD--------------------------HSESSFQT------IDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 4685
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM      NH +    HC HC + +                           S  SF        I+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 766          
BLAST of Pgr_024273 vs. Smed Unigenes AA
Match: SMU15005576 (SmedAsxldir_c106665_g2_i15|m.77482|m.8142)

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 434/762 (56.96%), Postives = 562/762 (73.75%), Query Frame = 2
Query:   74 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKT------------------PLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYDHSESSFQT------IDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 2281
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+                  PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM               C +      S  SF        I+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML--------------CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 744          

HSP 2 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 434/762 (56.96%), Postives = 562/762 (73.75%), Query Frame = -2
Query: 2478 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKT------------------PLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYDHSESSFQT------IDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 4685
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+                  PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM               C +      S  SF        I+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML--------------CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 744          
BLAST of Pgr_024273 vs. Smed Unigenes AA
Match: SMU15001741 (Asxlregen_comp65555_c0_seq4|m.19436|m.7732)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 430/756 (56.88%), Postives = 557/756 (73.68%), Query Frame = 2
Query:   74 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKT------------------PLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 2281
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+                  PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM                               I+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLM-------------------------------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 721          

HSP 2 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 430/756 (56.88%), Postives = 557/756 (73.68%), Query Frame = -2
Query: 2478 MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKT------------------PLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD-ESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDE-DSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF 4685
            MS   SK++  SR SSPV+L VDKDTP+HVY+DK + +   S FNA           +RP+KPG N+ TS+LM       ++R+RSMSPPWVPPPGKTT+  K+                  PLG +WNEDEAD+ Q++RY  +I  L NEVG+LR QL+ EKQ D+LR + DA+   ++ ++ELKQEID++EKEN LLR SL+K + +  L+ +S+ L+Q LIETEL+  RC HQMQHVFD L+NI+ EGHK++ RDIDRI+  FHDTESR+F+FK+++N LR LLK  Q REI  + S  ++N FL + R+EL+     LE  + +K+  ID+L++QL  K+DESINFASTHESLEN+KGHLQQQLKQKSGDCNR++VQIRTLESELAKERLDKEHL+++LKN KDR  DDR  LKKAAR QKQRA KAEET+  L+S+L  KER +E+LM                               I+S+E+QEKL  ++ I DEN+ LH +M +++ E +I SLK+EN+NLRSIADQCE RL+DVEREM+++RR + +E D + + Q+ KLS IL+KLE+SEK+NQ SQ RIE+LERK+K  E+QN ++KN LQQK+SS IDN+CKA++LARENA+LMRQLEAAL+DS+RN+DNAR+K   +DR LQSRIH++E+QLA Q+AE+ KW RN EE ERKC++K+QD+KIQLEQ+E TNRSM TYVQFLKKSY+NVFGDMPL NGLS P  S +G  + F
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSP----NERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLM-------------------------------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 721          
BLAST of Pgr_024273 vs. uniprot
Match: gi|158564320|sp|Q6AYX5|ODFP2_RAT (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 126.716 bits (317), Expect = 4.911e-28
Identity = 102/278 (36.69%), Postives = 167/278 (60.07%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKAN-QLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL--SNPASS 2257
            Q + +R E  E   Q++R   EN++L D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL L  +K + S+K N QLSQ +++ELERK++    QN++    + ++E ++   + + ++  RE  +L RQLE+A+ D+RR  +  +E+  SK+R  QS+I DLE QL++ + E  + RR  ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P  +    S+P  S
Sbjct:  544 QVMKTRLEADEVAAQLERCDKENKMLKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLELAREKHQASQKENKQLSQ-KVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSPIRS 820          

HSP 2 Score: 126.716 bits (317), Expect = 4.911e-28
Identity = 102/278 (36.69%), Postives = 167/278 (60.07%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKAN-QLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL--SNPASS 3296
            Q + +R E  E   Q++R   EN++L D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL L  +K + S+K N QLSQ +++ELERK++    QN++    + ++E ++   + + ++  RE  +L RQLE+A+ D+RR  +  +E+  SK+R  QS+I DLE QL++ + E  + RR  ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P  +    S+P  S
Sbjct:  544 QVMKTRLEADEVAAQLERCDKENKMLKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLELAREKHQASQKENKQLSQ-KVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSPIRS 820          

HSP 3 Score: 94.7449 bits (234), Expect = 3.312e-18
Identity = 120/436 (27.52%), Postives = 220/436 (50.46%), Query Frame = 2
Query:   98 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQS-FNNSRRPKKPGVNIKTSKLMGKKKAENSKR---IRSMSPPW---VPPPGKTTRGSKTPLGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLD--KGQHDSQLDESDHLIQ-------ALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            +++  S+ P+++HVD++TP+HV++ K       S   +   G++    N RR     V +KT K+      ++S R    +  +PP    + PP      S   L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH+++  K + D  + +  HL Q        L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D+++LKKA R QK+RA+K+EE    L   LA+K
Sbjct:    1 MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRR----SVRVKT-KVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADK 425          

HSP 4 Score: 94.7449 bits (234), Expect = 3.312e-18
Identity = 120/436 (27.52%), Postives = 220/436 (50.46%), Query Frame = -2
Query: 3408 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQS-FNNSRRPKKPGVNIKTSKLMGKKKAENSKR---IRSMSPPW---VPPPGKTTRGSKTPLGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLD--KGQHDSQLDESDHLIQ-------ALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4661
            +++  S+ P+++HVD++TP+HV++ K       S   +   G++    N RR     V +KT K+      ++S R    +  +PP    + PP      S   L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH+++  K + D  + +  HL Q        L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D+++LKKA R QK+RA+K+EE    L   LA+K
Sbjct:    1 MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRR----SVRVKT-KVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADK 425          
BLAST of Pgr_024273 vs. uniprot
Match: gi|158513400|sp|A3KGV1|ODFP2_MOUSE (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 125.561 bits (314), Expect = 9.223e-28
Identity = 101/278 (36.33%), Postives = 167/278 (60.07%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKAN-QLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL--SNPASS 2257
            Q + +R E  E   Q++R   EN++L D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N QLSQ +++ELERK++    QN++    + ++E ++   + + ++  RE  +L RQLE+A+ D+RR  +  +E+  SK+R  QS+I DLE QL++ + E  + RR  ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P  +    S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKMLKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSQ-KVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSPIRS 825          

HSP 2 Score: 125.561 bits (314), Expect = 9.223e-28
Identity = 101/278 (36.33%), Postives = 167/278 (60.07%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKAN-QLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL--SNPASS 3296
            Q + +R E  E   Q++R   EN++L D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N QLSQ +++ELERK++    QN++    + ++E ++   + + ++  RE  +L RQLE+A+ D+RR  +  +E+  SK+R  QS+I DLE QL++ + E  + RR  ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P  +    S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKMLKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSQ-KVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSPIRS 825          

HSP 3 Score: 76.2554 bits (186), Expect = 1.562e-12
Identity = 110/402 (27.36%), Postives = 194/402 (48.26%), Query Frame = 2
Query:  260 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTR--GSK----------TP-----------LGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLD--KGQHDSQLDESDHLIQ-------ALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            P V +  S   G K        S R+++   PW+PP   + R  G K          TP           L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH+++  K + D  + +  HL Q        L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D+++LKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGTLLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          

HSP 4 Score: 76.2554 bits (186), Expect = 1.562e-12
Identity = 110/402 (27.36%), Postives = 194/402 (48.26%), Query Frame = -2
Query: 3408 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTR--GSK----------TP-----------LGPFWNEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLD--KGQHDSQLDESDHLIQ-------ALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4499
            P V +  S   G K        S R+++   PW+PP   + R  G K          TP           L     ED+ D G  +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH+++  K + D  + +  HL Q        L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D+++LKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGTLLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          
BLAST of Pgr_024273 vs. uniprot
Match: gi|74736013|sp|Q5BJF6|ODFP2_HUMAN (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 124.79 bits (312), Expect = 1.595e-27
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 1463 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 2257
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 2 Score: 124.79 bits (312), Expect = 1.595e-27
Identity = 98/276 (35.51%), Postives = 164/276 (59.42%), Query Frame = -2
Query: 2502 QTIDSR-ENQEKLGQMQRIADENEILHDKMNHS------NHESVIISLKRENDNLR---SIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGL-SNPASS 3296
            Q + +R E  E   Q++R   EN+IL D+MN          +S +  L++  D L+   +   +C+ +L+  ER+   L   I D  SR + Q +KL +  +K + S+K N+    +++ELERK++    QN++    + ++E ++  ++ + ++  RE   L RQLE+A+ D+RR  +  +E   SK+R  Q++I DLE QL++ + E  + RR+ ++ +R+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVFGD P    L S+P  S
Sbjct:  549 QVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRS 824          

HSP 3 Score: 80.8777 bits (198), Expect = 6.816e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = 2
Query:  260 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEK 1351
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          

HSP 4 Score: 80.8777 bits (198), Expect = 6.816e-14
Identity = 105/405 (25.93%), Postives = 193/405 (47.65%), Query Frame = -2
Query: 3408 PGVNIKTSKLMGKK----KAENSKRIRSMSPPWVPPPGKTTRGSKTPLGPFWN----------------------------EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEK 4499
            P V +  S   G K        S R+++   PW+PP GK+   S  P+G  W                             +D++   +  RY+ KI+ LMN VG L+ +++ +K + ++  +   L   ++ ++E+  E+   E EN +LRH++++ + +             E + L+  L+E E+       Q+  + D +   L+   ++T  DI+ +         ++  F+  N  LR LL+    +E    E L +    L +R AE +     L   + DKD  ++EL +++  +  ++   +   +S+E+++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +M+ LK  K +   D++SLKKA R QK+RA+K+EE    L   LA+K
Sbjct:   36 PSVTVTKSHKRGMKGDTVNVRRSVRVKT-KVPWMPP-GKS---SARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADK 430          
BLAST of Pgr_024273 vs. uniprot
Match: gi|82082176|sp|Q5ZKK5|ODFP2_CHICK (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 119.783 bits (299), Expect = 6.263e-26
Identity = 86/262 (32.82%), Postives = 153/262 (58.40%), Query Frame = 2
Query: 1499 GQMQRIADENEILHDKMN------HSNHESVIISLKRENDNLRSIADQ---CEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXXMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASS 2257
             ++++  +E + L D+MN          +S +  L++  + LR    Q   C+ +L+  E++   L   I D   R + Q +K+ +  ++ + +++  +    + EELERK++    QN++    + ++E S+   + + ++  RE ++L RQLE A+ D++R  +  RE+ +S++R  QS++ DLE QL++ + E  + RRN E+ ER+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVF D  L   L +P  S
Sbjct:  560 AKLEKCDNEKKALKDEMNKELELARKQFQSQLAELEKLPEILRITETQLAECQDQLQSYEKKNMDLSVMIADLRQRIELQGDKMEMTRERYQSAQEEKKQLTLKAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSAL---LGSPGRS 818          

HSP 2 Score: 119.783 bits (299), Expect = 6.263e-26
Identity = 86/262 (32.82%), Postives = 153/262 (58.40%), Query Frame = -2
Query: 2502 GQMQRIADENEILHDKMN------HSNHESVIISLKRENDNLRSIADQ---CEVRLKDVEREMESLRRNIGDEDSRDDSQIEKLSLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVIDNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIHDXXXXXXXXXXXAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHTYVQFLKKSYSNVFGDMPLPNGLSNPASS 3260
             ++++  +E + L D+MN          +S +  L++  + LR    Q   C+ +L+  E++   L   I D   R + Q +K+ +  ++ + +++  +    + EELERK++    QN++    + ++E S+   + + ++  RE ++L RQLE A+ D++R  +  RE+ +S++R  QS++ DLE QL++ + E  + RRN E+ ER+  S++QD+K +LEQ+E+TNRSM  YVQFLK SY+NVF D  L   L +P  S
Sbjct:  560 AKLEKCDNEKKALKDEMNKELELARKQFQSQLAELEKLPEILRITETQLAECQDQLQSYEKKNMDLSVMIADLRQRIELQGDKMEMTRERYQSAQEEKKQLTLKAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSAL---LGSPGRS 818          

HSP 3 Score: 111.694 bits (278), Expect = 2.290e-23
Identity = 148/570 (25.96%), Postives = 269/570 (47.19%), Query Frame = 2
Query:   98 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKTPL--GPF-----------------------WNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD---------ESDHLIQALIETE---LSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYDHSESSFQTIDSR-----ENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNI 1681
            ++N  SS P+++HVD++TP+HV+        IK G        Q   + ++ K   VN++ + +  K KA           PW+PP GKT+    T    GP                         +E++A   +   YE KI+ LMN VG L+ + + +KQ+   + +   L   ++ ++E+ QE+   E EN LLR ++++ + +  L          E + L+  L E E    +A R  H ++   + L N+  E H ++  DI+ +         ++  F+  N  LR LL+   +RE R  + + +    L +  A+ +     L+  + DK+  I+ L  Q+ ++ +++   +   +SLE+V+GHLQ QL+ K  + NR+  QIR LE   A+ + + E + D LK  + +   D+D+LK+A R QK+RA+++EE    L+  LAEK+  + +      ++   +   ++     D    E    T++SR     E Q  L    R  ++ + L DK++    E+   S + EN+ L++     E +L     E++ L+ ++
Sbjct:    1 MKNRSSSPPLHVHVDENTPVHVH--------IKKGQKTTPAKCQQ-KHKQKMKGNTVNVRRA-VQVKTKA-----------PWMPP-GKTSVLDSTYKWEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQMTKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERL-NV--EKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERE-RDVQKILEKQGVLMKMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLKELRQKADRDKDALKRALRAQKERAERSEECAGQLAVQLAEKDSYVAE-----ALSTLESWRSRYNKVVKDKSDLELEMVTVNSRIADLLEQQATLEDKMR--EDRDALMDKLHQQTTETT--SFRMENERLKASVVPMEEKLNQAHVEVQQLKSSV 534          

HSP 4 Score: 111.694 bits (278), Expect = 2.290e-23
Identity = 148/570 (25.96%), Postives = 269/570 (47.19%), Query Frame = -2
Query: 3078 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTRGSKTPL--GPF-----------------------WNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLD---------ESDHLIQALIETE---LSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHCAHCADYDHSESSFQTIDSR-----ENQEKLGQMQRIADENEILHDKMNHSNHESVIISLKRENDNLRSIADQCEVRLKDVEREMESLRRNI 4661
            ++N  SS P+++HVD++TP+HV+        IK G        Q   + ++ K   VN++ + +  K KA           PW+PP GKT+    T    GP                         +E++A   +   YE KI+ LMN VG L+ + + +KQ+   + +   L   ++ ++E+ QE+   E EN LLR ++++ + +  L          E + L+  L E E    +A R  H ++   + L N+  E H ++  DI+ +         ++  F+  N  LR LL+   +RE R  + + +    L +  A+ +     L+  + DK+  I+ L  Q+ ++ +++   +   +SLE+V+GHLQ QL+ K  + NR+  QIR LE   A+ + + E + D LK  + +   D+D+LK+A R QK+RA+++EE    L+  LAEK+  + +      ++   +   ++     D    E    T++SR     E Q  L    R  ++ + L DK++    E+   S + EN+ L++     E +L     E++ L+ ++
Sbjct:    1 MKNRSSSPPLHVHVDENTPVHVH--------IKKGQKTTPAKCQQ-KHKQKMKGNTVNVRRA-VQVKTKA-----------PWMPP-GKTSVLDSTYKWEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQMTKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERL-NV--EKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERE-RDVQKILEKQGVLMKMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLKELRQKADRDKDALKRALRAQKERAERSEECAGQLAVQLAEKDSYVAE-----ALSTLESWRSRYNKVVKDKSDLELEMVTVNSRIADLLEQQATLEDKMR--EDRDALMDKLHQQTTETT--SFRMENERLKASVVPMEEKLNQAHVEVQQLKSSV 534          
BLAST of Pgr_024273 vs. uniprot
Match: gi|82179654|sp|Q5PQ23|ODFP2_XENLA (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2 [Xenopus laevis])

HSP 1 Score: 115.161 bits (287), Expect = 1.075e-24
Identity = 123/474 (25.95%), Postives = 226/474 (47.68%), Query Frame = 2
Query:   98 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSP--PWVPPPGKTTRGSKTPLGPFW----------------------------NEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQ-------DELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERR-AELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXXEETIHDLSSLLAEKERQLEKLMA 1378
            ++N   S P+++HVD+ TP+HV++ K                     +SR P K     K    + KK   N +R  ++    PW+PP   + R +    G  W                            +E+E    +   YE KI  LM+E+G L+++LE +K++       ++L  S   L A ++ + E+ QE+   E EN  L+ SLD+ Q +  L         +E  HL+  L+E E        Q+  + D ++  L+   ++T  DI+ +         ++  F++ N  LR+LL+   ++E      + Q    L++   A+ E+++  L+  +++++  +++L  QL  + D S   +   +S+E+ K HLQ QL+ +  + NR++VQIR LE   A ++ +   LM+ L   K +   ++++LKK+ R QKQRA+++EET+  L+  L   + +L K ++
Sbjct:    1 MKNRSPSPPLHVHVDESTPVHVHIKK---------------------SSRPPAKTQQGAK----LKKKGMGNLRRSATVKTKVPWIPPGKSSLRDA----GLKWEGLTHRLDITPPDTERMFSALRMSDLSTDEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQR-LKHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLREQHRQETETYRLMEQKEMLLKKLSDADTEKMH--LQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLERNEAHQKEEIVKLMEQLTELKQKVDSEKEALKKSVRAQKQRAERSEETLEMLNRQLVGNDSELAKALS 442          

HSP 2 Score: 115.161 bits (287), Expect = 1.075e-24
Identity = 123/474 (25.95%), Postives = 226/474 (47.68%), Query Frame = -2
Query: 3381 LQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDGLQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSP--PWVPPPGKTTRGSKTPLGPFW----------------------------NEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQ-------DELRRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQL---------DESDHLIQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDTESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERR-AELERLNDTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLKQKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSXXXXXXXXXXXXXXAEETIHDLSSLLAEKERQLEKLMA 4661
            ++N   S P+++HVD+ TP+HV++ K                     +SR P K     K    + KK   N +R  ++    PW+PP   + R +    G  W                            +E+E    +   YE KI  LM+E+G L+++LE +K++       ++L  S   L A ++ + E+ QE+   E EN  L+ SLD+ Q +  L         +E  HL+  L+E E        Q+  + D ++  L+   ++T  DI+ +         ++  F++ N  LR+LL+   ++E      + Q    L++   A+ E+++  L+  +++++  +++L  QL  + D S   +   +S+E+ K HLQ QL+ +  + NR++VQIR LE   A ++ +   LM+ L   K +   ++++LKK+ R QKQRA+++EET+  L+  L   + +L K ++
Sbjct:    1 MKNRSPSPPLHVHVDESTPVHVHIKK---------------------SSRPPAKTQQGAK----LKKKGMGNLRRSATVKTKVPWIPPGKSSLRDA----GLKWEGLTHRLDITPPDTERMFSALRMSDLSTDEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQR-LKHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLREQHRQETETYRLMEQKEMLLKKLSDADTEKMH--LQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLERNEAHQKEEIVKLMEQLTELKQKVDSEKEALKKSVRAQKQRAERSEETLEMLNRQLVGNDSELAKALS 442          
The following BLAST results are available for this feature:
BLAST of Pgr_024273 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|310750400|ref|NP_702913.1|5.288e-2835.51outer dense fiber protein 2 isoform 1 [Homo sapien... [more]
gi|24430181|ref|NP_002531.3|5.364e-2835.51outer dense fiber protein 2 isoform 9 [Homo sapien... [more]
gi|310750408|ref|NP_702911.1|6.020e-2835.51outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
gi|334278916|ref|NP_001229282.1|6.020e-2835.51outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
gi|578817518|ref|XP_006717189.1|6.020e-2835.51PREDICTED: outer dense fiber protein 2 isoform X1 ... [more]
back to top
BLAST of Pgr_024273 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150055780.000e+056.61SmedAsxldir_c106665_g2_i9|m.77475|m.37289[more]
SMU150055770.000e+057.01SmedAsxldir_c106665_g2_i7|m.77472|m.45171[more]
SMU150055760.000e+056.96SmedAsxldir_c106665_g2_i15|m.77482|m.8142[more]
SMU150017410.000e+056.88Asxlregen_comp65555_c0_seq4|m.19436|m.7732[more]
back to top
BLAST of Pgr_024273 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|158564320|sp|Q6AYX5|ODFP2_RAT4.911e-2836.69RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158513400|sp|A3KGV1|ODFP2_MOUSE9.223e-2836.33RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|74736013|sp|Q5BJF6|ODFP2_HUMAN1.595e-2735.51RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82082176|sp|Q5ZKK5|ODFP2_CHICK6.263e-2632.82RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82179654|sp|Q5PQ23|ODFP2_XENLA1.075e-2425.95RecName: Full=Outer dense fiber protein 2; AltName... [more]
back to top
BLAST of Pgr_024273 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_024273 ID=Pgr_024273|Name=Pgr_024273|organism=Phagocata gracilis|type=mRNA|length=4758bp
AAGCTTCTTTAGTTACATTAAATATAAATAATTTCTAATAAATTCCACAT
TTTGTTGCATTAACGCTTAAACAATGTCTTATAGTTATTCCAAAAAATTA
CAAAACAGTCGATCATCAAGTCCAGTTTATTTACATGTTGACAAGGATAC
TCCTATTCATGTATACTTGGATAAAGACGAAAGTAATGATATTAAAAGCG
GATTTAATGCAGCAAGTGACGGATTACAAAGCTTTAATAATTCAAGAAGA
CCAAAGAAACCTGGAGTTAATATAAAAACATCGAAGTTGATGGGTAAAAA
GAAAGCAGAGAATAGTAAACGAATTCGATCAATGTCCCCTCCTTGGGTAC
CACCACCTGGTAAAACGACAAGAGGTTCAAAAACCCCACTAGGACCATTT
TGGAATGAGGATGAAGCTGATATAGGACAACAAGAACGTTACGAATCAAA
GATTAACGAGTTAATGAATGAAGTTGGTGATCTAAGATATCAGCTAGAGA
AGGAGAAGCAACAGGACGAATTACGACGGAGTAATGATGCGTTAAGAGCC
CATGAAGACACTATAGATGAATTGAAACAAGAGATAGACCTTGTTGAGAA
GGAGAACGACCTTCTTAGACACAGTCTTGACAAGGGTCAACATGACTCTC
AATTAGATGAATCCGATCATTTGATCCAAGCTTTGATCGAGACTGAATTG
TCTGCTGGTCGTTGTCAACATCAGATGCAGCACGTGTTTGACAATTTGAA
GAACATTCTCCGGGAGGGCCACAAGATCACCGGCCGTGATATTGATCGAA
TAAATGGTTATTTCCACGATACTGAGTCGCGGATGTTTGAATTCAAGAAT
GTGAACAATGATCTGAGGAGTCTACTCAAGAGTTTCCAGCAACGGGAGAT
TAGAGCCCGAGAATCTTTGGCCCAGGATAACTCGTTCTTGCAAGAGAGAC
GGGCCGAGTTAGAGAGACTGAATGACACTCTTGAGTGTGCAATGAACGAC
AAAGATGTCACCATTGACGAGTTGAGGCGACAATTGGCGAAGAAGAGTGA
CGAGAGTATTAATTTTGCGTCGACTCACGAGTCTCTCGAGAATGTCAAGG
GCCACTTGCAGCAGCAACTGAAACAAAAGTCCGGCGATTGTAACCGTATG
GCCGTACAAATCCGAACCCTTGAAAGTGAACTGGCCAAAGAACGACTAGA
CAAAGAACATCTAATGGACATTCTGAAAAATTCCAAAGACCGCACAGTCG
ATGATAGAGATAGTCTGAAGAAAGCCGCCCGTCTACAGAAGCAGAGAGCC
CAGAAAGCTGAAGAAACAATTCACGATTTATCGTCTCTTTTAGCTGAGAA
AGAGCGGCAACTTGAGAAATTGATGGCACAATTCGGTATTACCAATCACG
GGACTGACCCTGGCCAACATTGTGCACACTGTGCTGACTACGACCATTCG
GAGTCATCATTTCAGACGATCGATAGCAGAGAAAATCAAGAGAAACTCGG
TCAAATGCAAAGAATTGCCGATGAAAACGAAATACTGCACGATAAAATGA
ATCATTCCAATCACGAAAGTGTGATTATTTCATTGAAACGAGAGAATGAT
AATCTGAGATCAATAGCAGATCAGTGTGAGGTGCGATTAAAGGATGTAGA
ACGAGAGATGGAGTCTCTTCGTCGTAATATCGGTGATGAAGACAGCAGAG
ATGACAGTCAAATAGAGAAACTGTCACTCATACTACAGAAGCTTGAGGTG
TCGGAGAAGGCCAACCAATTGAGTCAGTCTCGTATAGAAGAATTGGAGCG
GAAAATTAAGGGCTGTGAAAATCAAAATTTAGATCTAAAAAATAGCCTCC
AGCAGAAGGAGAGCTCCGTCATCGATAATCGATGCAAGGCCGATGATCTG
GCGAGAGAGAATGCGGCTCTGATGCGTCAACTTGAGGCGGCTTTGAGTGA
CTCGCGCAGAAATGCTGACAATGCCCGAGAGAAGATATCTAGTAAGGATC
GGGGTCTTCAATCGAGGATCCACGACCTCGAGGCTCAATTGGCTCAACAA
CGAGCCGAAGCTATGAAATGGAGACGGAACTTTGAGGAGAACGAACGGAA
ATGTAGTAGTAAGATGCAGGACATCAAGATTCAGTTGGAGCAAGCGGAGA
CCACCAATCGCAGTATGCACACCTATGTCCAGTTCTTGAAGAAATCTTAC
TCCAATGTATTTGGAGATATGCCTCTGCCAAATGGACTTAGCAATCCCGC
GTCGTCTCAGATTGGCGGACCGATTTGTTTCTAAGATAATGACGACAATT
GTTGATTGTCTGTGACCGGAATATATTTTATAGTTGTTATATTTATCGAA
ATATATATTTCTATCGTTCTTTAAAAAAATTTTTTTAAAGAACGATAGAA
ATATATATTTCGATAAATATAACAACTATAAAATATATTCCGGTCACAGA
CAATCAACAATTGTCGTCATTATCTTAGAAACAAATCGGTCCGCCAATCT
GAGACGACGCGGGATTGCTAAGTCCATTTGGCAGAGGCATATCTCCAAAT
ACATTGGAGTAAGATTTCTTCAAGAACTGGACATAGGTGTGCATACTGCG
ATTGGTGGTCTCCGCTTGCTCCAACTGAATCTTGATGTCCTGCATCTTAC
TACTACATTTCCGTTCGTTCTCCTCAAAGTTCCGTCTCCATTTCATAGCT
TCGGCTCGTTGTTGAGCCAATTGAGCCTCGAGGTCGTGGATCCTCGATTG
AAGACCCCGATCCTTACTAGATATCTTCTCTCGGGCATTGTCAGCATTTC
TGCGCGAGTCACTCAAAGCCGCCTCAAGTTGACGCATCAGAGCCGCATTC
TCTCTCGCCAGATCATCGGCCTTGCATCGATTATCGATGACGGAGCTCTC
CTTCTGCTGGAGGCTATTTTTTAGATCTAAATTTTGATTTTCACAGCCCT
TAATTTTCCGCTCCAATTCTTCTATACGAGACTGACTCAATTGGTTGGCC
TTCTCCGACACCTCAAGCTTCTGTAGTATGAGTGACAGTTTCTCTATTTG
ACTGTCATCTCTGCTGTCTTCATCACCGATATTACGACGAAGAGACTCCA
TCTCTCGTTCTACATCCTTTAATCGCACCTCACACTGATCTGCTATTGAT
CTCAGATTATCATTCTCTCGTTTCAATGAAATAATCACACTTTCGTGATT
GGAATGATTCATTTTATCGTGCAGTATTTCGTTTTCATCGGCAATTCTTT
GCATTTGACCGAGTTTCTCTTGATTTTCTCTGCTATCGATCGTCTGAAAT
GATGACTCCGAATGGTCGTAGTCAGCACAGTGTGCACAATGTTGGCCAGG
GTCAGTCCCGTGATTGGTAATACCGAATTGTGCCATCAATTTCTCAAGTT
GCCGCTCTTTCTCAGCTAAAAGAGACGATAAATCGTGAATTGTTTCTTCA
GCTTTCTGGGCTCTCTGCTTCTGTAGACGGGCGGCTTTCTTCAGACTATC
TCTATCATCGACTGTGCGGTCTTTGGAATTTTTCAGAATGTCCATTAGAT
GTTCTTTGTCTAGTCGTTCTTTGGCCAGTTCACTTTCAAGGGTTCGGATT
TGTACGGCCATACGGTTACAATCGCCGGACTTTTGTTTCAGTTGCTGCTG
CAAGTGGCCCTTGACATTCTCGAGAGACTCGTGAGTCGACGCAAAATTAA
TACTCTCGTCACTCTTCTTCGCCAATTGTCGCCTCAACTCGTCAATGGTG
ACATCTTTGTCGTTCATTGCACACTCAAGAGTGTCATTCAGTCTCTCTAA
CTCGGCCCGTCTCTCTTGCAAGAACGAGTTATCCTGGGCCAAAGATTCTC
GGGCTCTAATCTCCCGTTGCTGGAAACTCTTGAGTAGACTCCTCAGATCA
TTGTTCACATTCTTGAATTCAAACATCCGCGACTCAGTATCGTGGAAATA
ACCATTTATTCGATCAATATCACGGCCGGTGATCTTGTGGCCCTCCCGGA
GAATGTTCTTCAAATTGTCAAACACGTGCTGCATCTGATGTTGACAACGA
CCAGCAGACAATTCAGTCTCGATCAAAGCTTGGATCAAATGATCGGATTC
ATCTAATTGAGAGTCATGTTGACCCTTGTCAAGACTGTGTCTAAGAAGGT
CGTTCTCCTTCTCAACAAGGTCTATCTCTTGTTTCAATTCATCTATAGTG
TCTTCATGGGCTCTTAACGCATCATTACTCCGTCGTAATTCGTCCTGTTG
CTTCTCCTTCTCTAGCTGATATCTTAGATCACCAACTTCATTCATTAACT
CGTTAATCTTTGATTCGTAACGTTCTTGTTGTCCTATATCAGCTTCATCC
TCATTCCAAAATGGTCCTAGTGGGGTTTTTGAACCTCTTGTCGTTTTACC
AGGTGGTGGTACCCAAGGAGGGGACATTGATCGAATTCGTTTACTATTCT
CTGCTTTCTTTTTACCCATCAACTTCGATGTTTTTATATTAACTCCAGGT
TTCTTTGGTCTTCTTGAATTATTAAAGCTTTGTAATCCGTCACTTGCTGC
ATTAAATCCGCTTTTAATATCATTACTTTCGTCTTTATCCAAGTATACAT
GAATAGGAGTATCCTTGTCAACATGTAAATAAACTGGACTTGATGATCGA
CTGTTTTGTAATTTTTTGGAATAACTATAAGACATTGTTTAAGCGTTAAT
GCAACAAAATGTGGAATTTATTAGAAATTATTTATATTTAATGTAACTAA
AGAAGCTT

Design Primers for Pgr_024273

back to top

protein sequence

>Pgr_024273-protein ID=Pgr_024273-protein|Name=Pgr_024273|organism=Phagocata gracilis|type=polypeptide|length=737bp
MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDG
LQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTR
GSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDEL
RRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLDESDHL
IQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDT
ESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLN
DTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLK
QKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSLKK
AARLQKQRAQKAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHC
AHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESV
IISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKL
SLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVI
DNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIH
DLEAQLAQQRAEAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHT
YVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF*
back to top

coding sequence

>Pgr_024273.74.2284 ID=Pgr_024273.74.2284|Name=Pgr_024273.74.2284|organism=Phagocata gracilis|type=CDS|length=2211bp
ATGTCTTATAGTTATTCCAAAAAATTACAAAACAGTCGATCATCAAGTCC
AGTTTATTTACATGTTGACAAGGATACTCCTATTCATGTATACTTGGATA
AAGACGAAAGTAATGATATTAAAAGCGGATTTAATGCAGCAAGTGACGGA
TTACAAAGCTTTAATAATTCAAGAAGACCAAAGAAACCTGGAGTTAATAT
AAAAACATCGAAGTTGATGGGTAAAAAGAAAGCAGAGAATAGTAAACGAA
TTCGATCAATGTCCCCTCCTTGGGTACCACCACCTGGTAAAACGACAAGA
GGTTCAAAAACCCCACTAGGACCATTTTGGAATGAGGATGAAGCTGATAT
AGGACAACAAGAACGTTACGAATCAAAGATTAACGAGTTAATGAATGAAG
TTGGTGATCTAAGATATCAGCTAGAGAAGGAGAAGCAACAGGACGAATTA
CGACGGAGTAATGATGCGTTAAGAGCCCATGAAGACACTATAGATGAATT
GAAACAAGAGATAGACCTTGTTGAGAAGGAGAACGACCTTCTTAGACACA
GTCTTGACAAGGGTCAACATGACTCTCAATTAGATGAATCCGATCATTTG
ATCCAAGCTTTGATCGAGACTGAATTGTCTGCTGGTCGTTGTCAACATCA
GATGCAGCACGTGTTTGACAATTTGAAGAACATTCTCCGGGAGGGCCACA
AGATCACCGGCCGTGATATTGATCGAATAAATGGTTATTTCCACGATACT
GAGTCGCGGATGTTTGAATTCAAGAATGTGAACAATGATCTGAGGAGTCT
ACTCAAGAGTTTCCAGCAACGGGAGATTAGAGCCCGAGAATCTTTGGCCC
AGGATAACTCGTTCTTGCAAGAGAGACGGGCCGAGTTAGAGAGACTGAAT
GACACTCTTGAGTGTGCAATGAACGACAAAGATGTCACCATTGACGAGTT
GAGGCGACAATTGGCGAAGAAGAGTGACGAGAGTATTAATTTTGCGTCGA
CTCACGAGTCTCTCGAGAATGTCAAGGGCCACTTGCAGCAGCAACTGAAA
CAAAAGTCCGGCGATTGTAACCGTATGGCCGTACAAATCCGAACCCTTGA
AAGTGAACTGGCCAAAGAACGACTAGACAAAGAACATCTAATGGACATTC
TGAAAAATTCCAAAGACCGCACAGTCGATGATAGAGATAGTCTGAAGAAA
GCCGCCCGTCTACAGAAGCAGAGAGCCCAGAAAGCTGAAGAAACAATTCA
CGATTTATCGTCTCTTTTAGCTGAGAAAGAGCGGCAACTTGAGAAATTGA
TGGCACAATTCGGTATTACCAATCACGGGACTGACCCTGGCCAACATTGT
GCACACTGTGCTGACTACGACCATTCGGAGTCATCATTTCAGACGATCGA
TAGCAGAGAAAATCAAGAGAAACTCGGTCAAATGCAAAGAATTGCCGATG
AAAACGAAATACTGCACGATAAAATGAATCATTCCAATCACGAAAGTGTG
ATTATTTCATTGAAACGAGAGAATGATAATCTGAGATCAATAGCAGATCA
GTGTGAGGTGCGATTAAAGGATGTAGAACGAGAGATGGAGTCTCTTCGTC
GTAATATCGGTGATGAAGACAGCAGAGATGACAGTCAAATAGAGAAACTG
TCACTCATACTACAGAAGCTTGAGGTGTCGGAGAAGGCCAACCAATTGAG
TCAGTCTCGTATAGAAGAATTGGAGCGGAAAATTAAGGGCTGTGAAAATC
AAAATTTAGATCTAAAAAATAGCCTCCAGCAGAAGGAGAGCTCCGTCATC
GATAATCGATGCAAGGCCGATGATCTGGCGAGAGAGAATGCGGCTCTGAT
GCGTCAACTTGAGGCGGCTTTGAGTGACTCGCGCAGAAATGCTGACAATG
CCCGAGAGAAGATATCTAGTAAGGATCGGGGTCTTCAATCGAGGATCCAC
GACCTCGAGGCTCAATTGGCTCAACAACGAGCCGAAGCTATGAAATGGAG
ACGGAACTTTGAGGAGAACGAACGGAAATGTAGTAGTAAGATGCAGGACA
TCAAGATTCAGTTGGAGCAAGCGGAGACCACCAATCGCAGTATGCACACC
TATGTCCAGTTCTTGAAGAAATCTTACTCCAATGTATTTGGAGATATGCC
TCTGCCAAATGGACTTAGCAATCCCGCGTCGTCTCAGATTGGCGGACCGA
TTTGTTTCTAA
back to top
Gene Groups
Pgr_024273 is similar in sequence to the genes of this group: GG437
Gene NameGene ID
SMU15001741SMU15001741
SMU15005576SMU15005576
SMU15005577SMU15005577
SMU15005578SMU15005578
Ddo_003032Ddo_003032
Ddo_005045Ddo_005045
Ddo_009916Ddo_009916
Ddo_012914Ddo_012914
Gsp_000977Gsp_000977
Gsp_002888Gsp_002888
Gsp_019027Gsp_019027
Gsp_023053Gsp_023053
Pgr_024273Pgr_024273
Pmo_012872Pmo_012872
odf2Pmo_015154

Gene Group Protein Sequences

>SMU15001741

MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMI
NSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIAD
QCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQ
SSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENAS
LMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNK
WHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGD
MPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005576
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML
CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMA
NNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDK
SEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVL
QQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRD
RQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSE
ITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005577
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQED
QEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESR
LRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIR
IEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQL
EAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNC
EETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSN
GLSCPNPSYMGQSLSFNGF*
>SMU15005578
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSF
SNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLR
SIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSE
KSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELAR
ENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKA
ESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYAN
VFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>Ddo_003032 Ddo_003032
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLQSKSHADLEDGNDELLSKPLTELCDQCKLNSREYQQNLRHIDDIVE
ENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILR
KTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLE
GQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNAD
NVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQ
DLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQ
SSLNFGGF*
>Ddo_005045 Ddo_005045
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENL
RSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEAS
EKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLM
RENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQR
AETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYA
NVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Ddo_009916 Ddo_009916
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLLNSREYQQNLRHI
DDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKE
MKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKK
IRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDS
RRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKN
SSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNN
SFVPQSSLNFGGF*
>Ddo_012914 Ddo_012914
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGND
ELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEI
IIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINR
LSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSV
IDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRI
HDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQ
TYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Gsp_000977 Gsp_000977
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLIMNSREDQDNLRRMDEIIDE
NQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRR
TMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLEN
QNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADN
SREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQD
LKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQS
LSFGGF*
>Gsp_002888 Gsp_002888
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLISNQNQNETKSDSIPVIKSF
NNQYVQCEMNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRE
NDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEK
LETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKT
EELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQL
AQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLK
KSYANVFGDIPLSNGLSCPNPPYIGQSLSFGGF*
>Gsp_019027 Gsp_019027
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIS
NQNQNETKSDSIPVIKSFNNQYVQCEMNSREDQDNLRRMDEIIDENQHLH
RQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEE
NDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEM
KTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKT
VGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQL
EQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQSLSFGG
F*
>Gsp_023053 Gsp_023053
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIM
NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIAD
QCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQ
TSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENAS
LTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANK
WRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGD
IPLSNGLSCPNPPYIGQSLSFGGF*
>Pgr_024273 Pgr_024273
MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDG
LQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTR
GSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDEL
RRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLDESDHL
IQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDT
ESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLN
DTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLK
QKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSLKK
AARLQKQRAQKAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHC
AHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESV
IISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKL
SLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVI
DNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIH
DLEAQLAQQRAEAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHT
YVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF*
>Pmo_012872 Pmo_012872
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMSEFGVPNHISEPNRHCS
HCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHS
LKRENENLRSIADQCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQI
LQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNR
CKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDLE
AQLAQQRAEAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQ
FLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF*
>Pmo_015154 odf2
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMMESRENQEQLGQMNRIA
EENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESL
RHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCE
NQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNAD
NAREKINSKDRSLQSRIHDLEAQLAQQRAEAMKWRRSCEENDRKCSGKLQ
DIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGG
PICF*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.