Pgr_023068, Pgr_023068 (mRNA) Phagocata gracilis

Overview
NamePgr_023068
Unique NamePgr_023068
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1769
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_023068 vs. RefSeq Human
Match: gi|221316711|ref|NP_689644.2| (piwi-like protein 4 [Homo sapiens])

HSP 1 Score: 120.553 bits (301), Expect = 1.315e-27
Identity = 140/549 (25.50%), Postives = 241/549 (43.90%), Query Frame = 3
Query:  213 KVGKEGKAVALKSNYANFKLTPRGPFFMYDVK-MP-AKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTVKDE-----EVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLY--------LERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIK-EMDITEEIE-LNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPF-MEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQ--HRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVR---------VQKVHMALVFINDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            K G  G  V L +N  N         + Y V  +P   S R ++ LLYS   ++ S++   FDG  LF  SQ  +E +   + + +     +++I        ++    Q+ NIIF  I   +   +IGR F+         + + P    +    +  GFA ++S    +   ++ + Y        LE +   L + +  + + +     LIG  ++T+YNN+TY I DI   +  T   +  +G +I+Y+DY+KQ+Y+IT+++  QP ++S +++     K N  +E      A  +  IP ELCFL G +D   S+  L K++    +  P  R + +       Q    A F +E WG+   +Q I++ GR +   ++          S  DW   +++      AQ  + + IL  DR       F++ ++R  G +  N     V   ++ ++++    FVR         VQ V M ++  N    Y  +K +  S   + +QCV  R  T         +A K  MQM  KLG + W VE
Sbjct:   98 KTGSSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLRIALLYS--HSELSNKAKAFDGAILFL-SQKLEEKVTELSSETQRGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFY---------NPSEPMEIPQHKLSLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMT-ALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKK-----KRNDNSE------AQLAHLIP-ELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQ-ISLTGRIVPSEKILMQDHICQPVSAADWS-KDIRTCKILNAQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFN-----VDYPKIIKVQENPAAFVRAIQQYVDPDVQLV-MCILPSNQKTYYDSIKKYLSSDCPVPSQCVLAR--TLNKQGMMMSIATKIAMQMTCKLGGELWAVE 611          
BLAST of Pgr_023068 vs. RefSeq Human
Match: gi|300244501|ref|NP_001177900.1| (piwi-like protein 1 isoform 2 [Homo sapiens])

HSP 1 Score: 117.472 bits (293), Expect = 1.174e-26
Identity = 141/593 (23.78%), Postives = 252/593 (42.50%), Query Frame = 3
Query:  126 EEKRTIKRGGLQKRFYIIEPSLQP--ETVKD-KVGKEGKAVALKSNYANFKLTPRGPFFMYDVK----MPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTV----KDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDIITKYNNKTYRISDIKEMDITEEI--ELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPF-MEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPD------DW-KFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDD---VKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRV--QKVH------MALVFINDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +E    +RGG ++ F+ +  + +   + VK+ K G  G  V L +N+      P+   + Y +     M A+ LR  L   +     K       FDG  LF P +  ++  E F+     +D  ++I         +    Q  NIIF  +   M  ++IGR ++         + N P         I  GF T++ +  N     S +L  +  ++VL   +V    +N Y++ +           LIG  ++TKYNNKTYR+ DI      +    + +G ++S+L+Y++++YN  + + KQP ++S+ +R     +         P     ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++G    +  +       +  WG+  D+  ++  GR L   ++  G     GK+ D      DW K       I       + ++   RN    N  I +   V   MG +++  ++       + E++D    ++RV  QKV       + L+  N    Y  +K +  +     +QCV  R  T    +    +A K  +QM  K+G + W V+
Sbjct:   72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---------NPNDPIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQG-----GKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMG-MQMRKAI-------MIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVD 620          
BLAST of Pgr_023068 vs. RefSeq Human
Match: gi|767975978|ref|XP_011537307.1| (PREDICTED: piwi-like protein 1 isoform X3 [Homo sapiens])

HSP 1 Score: 117.087 bits (292), Expect = 1.586e-26
Identity = 141/593 (23.78%), Postives = 253/593 (42.66%), Query Frame = 3
Query:  126 EEKRTIKRGGLQKRFYIIEPSLQP--ETVKD-KVGKEGKAVALKSNYANFKLTPRGPFFMYDVK----MPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTV----KDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDIITKYNNKTYRISDI--KEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPF-MEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPD------DW-KFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDD---VKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRV--QKVH------MALVFINDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +E    +RGG ++ F+ +  + +   + VK+ K G  G  V L +N+      P+   + Y +     M A+ LR  L   +     K       FDG  LF P +  ++  E F+     +D  ++I         +    Q  NIIF  +   M  ++IGR ++         + N P         I  GF T++ +  N     S +L  +  ++VL   +V    +N Y++ +           LIG  ++TKYNNKTYR+ DI   +   +   + +G ++S+L+Y++++YN  + + KQP ++S+ +R     +         P     ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++G    +  +       +  WG+  D+  ++  GR L   ++  G     GK+ D      DW K       I       + ++   RN    N  I +   V   MG +++  ++       + E++D    ++RV  QKV       + L+  N    Y  +K +  +     +QCV  R  T    +    +A K  +QM  K+G + W V+
Sbjct:   72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---------NPNDPIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQG-----GKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMG-MQMRKAI-------MIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVD 620          
BLAST of Pgr_023068 vs. RefSeq Human
Match: gi|768044486|ref|XP_011544923.1| (PREDICTED: piwi-like protein 1 isoform X3 [Homo sapiens])

HSP 1 Score: 117.087 bits (292), Expect = 1.586e-26
Identity = 141/593 (23.78%), Postives = 253/593 (42.66%), Query Frame = 3
Query:  126 EEKRTIKRGGLQKRFYIIEPSLQP--ETVKD-KVGKEGKAVALKSNYANFKLTPRGPFFMYDVK----MPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTV----KDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDIITKYNNKTYRISDI--KEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPF-MEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPD------DW-KFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDD---VKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRV--QKVH------MALVFINDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +E    +RGG ++ F+ +  + +   + VK+ K G  G  V L +N+      P+   + Y +     M A+ LR  L   +     K       FDG  LF P +  ++  E F+     +D  ++I         +    Q  NIIF  +   M  ++IGR ++         + N P         I  GF T++ +  N     S +L  +  ++VL   +V    +N Y++ +           LIG  ++TKYNNKTYR+ DI   +   +   + +G ++S+L+Y++++YN  + + KQP ++S+ +R     +         P     ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++G    +  +       +  WG+  D+  ++  GR L   ++  G     GK+ D      DW K       I       + ++   RN    N  I +   V   MG +++  ++       + E++D    ++RV  QKV       + L+  N    Y  +K +  +     +QCV  R  T    +    +A K  +QM  K+G + W V+
Sbjct:   72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---------NPNDPIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQG-----GKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMG-MQMRKAI-------MIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVD 620          
BLAST of Pgr_023068 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 117.087 bits (292), Expect = 2.044e-26
Identity = 141/593 (23.78%), Postives = 253/593 (42.66%), Query Frame = 3
Query:  126 EEKRTIKRGGLQKRFYIIEPSLQP--ETVKD-KVGKEGKAVALKSNYANFKLTPRGPFFMYDVK----MPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTV----KDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDIITKYNNKTYRISDI--KEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEG-KAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPD------DW-KFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDD---VKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRV--QKVH------MALVFINDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +E    +RGG ++ F+ +  + +   + VK+ K G  G  V L +N+      P+   + Y +     M A+ LR  L   +     K       FDG  LF P +  ++  E F+     +D  ++I         +    Q  NIIF  +   M  ++IGR ++         + N P         I  GF T++ +  N     S +L  +  ++VL   +V    +N Y++ +           LIG  ++TKYNNKTYR+ DI   +   +   + +G ++S+L+Y++++YN  + + KQP ++S+ +R     +         P     ++ IP ELC+L G +D  R++ N+ K L    +  P +R R++G    +  +       +  WG+  D+  ++  GR L   ++  G     GK+ D      DW K       I       + ++   RN    N  I +   V   MG +++  ++       + E++D    ++RV  QKV       + L+  N    Y  +K +  +     +QCV  R  T    +    +A K  +QM  K+G + W V+
Sbjct:   72 QELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCH----AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---------NPNDPIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR-----RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQG-----GKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMG-MQMRKAI-------MIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVD 620          
BLAST of Pgr_023068 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 373/542 (68.82%), Postives = 461/542 (85.06%), Query Frame = 3
Query:  144 KRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHK-EDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGV 1766
            +RGGLQ+RF IIEP+LQP+TV DK+GK+G+ V+LKSNYANF +   GPF+MYDV M  KS+R KL+LL + A +K + QPFCFDGRRLFT S+WH  ED E   +KD E+SIR L +F++N+EEYYQM+NI+FNNIQ+FMGQE+IGR FFLGSNC     + GP+FFK DNFKILGG++TT++RGTN++G+ASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRDIITKYNNKTYRISDIKEMD+ +E++L   KISYL+YFKQRYNI L N KQPFVISR++R  ++ KE  ENEPE P + DQSLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPRERL DI DFC WT  GK+  +M+ WG+ ++ QPITI GREL  V++FS + +IN K PDDWKFGE+KFD+P+G  HRF +L VDRNP+HFN FI+DVKRE+GRLR+N++++++++CR NE+ED LTDF+RV KVHMALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+
Sbjct:   58 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGI 599          
BLAST of Pgr_023068 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 284/561 (50.62%), Postives = 391/561 (69.70%), Query Frame = 3
Query:  147 RGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQP--FCFDGRRLFTPSQWHKE-DIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNC--NEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKE------------NQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPFM-EKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRVQK--VHMALVFINDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            RGGL++ F I+EP+LQP  + +K G  G+ V L+SN+  F +     F MYD       L  K+ L + V   + +  P  FCFDGRRLFT  +WH E DI+ F+  ++++++R +++ +  TEEYYQM+N++ NN+QV +GQERIG+ +FL  N   +E    +GPTFF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRDIITKYNNKTYRIS+IKEM++ E+ E+ G  +SY +YFK+RYNI L  G QPFV++R+++ P++++              +E E EAP++ D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI  +C+W +   AA  M  KW +++DN+P+ I GREL   +V SG  +IN K  DDWKFG V+FDI +  +H   ++ VDRN   +  F++DV++E+  +R++  V  V TC  N++E  L D  R       MALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE
Sbjct:   25 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKK-PMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVE 584          
BLAST of Pgr_023068 vs. Smed Unigenes AA
Match: SMU15015027 (SmedAsxldir_c97534_g1_i3|m.40524|m.26292)

HSP 1 Score: 97.4413 bits (241), Expect = 7.227e-24
Identity = 45/73 (61.64%), Postives = 57/73 (78.08%), Query Frame = 3
Query:  870 MDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCF 1088
            MD+ +E++L   KISYL+YFKQRYNI L N +QPFVISR++R  ++QKE  ENEPE P + DQSLSI GEL +
Sbjct:    1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSVVRQKEKIENEPEGPTETDQSLSISGELGY 73          
BLAST of Pgr_023068 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 95.1301 bits (235), Expect = 3.310e-20
Identity = 125/549 (22.77%), Postives = 231/549 (42.08%), Query Frame = 3
Query:  234 AVALKSNYANFKLTPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSD-----QPFCFDGRRLFTPSQW-HKEDIETFTVKDEEVSIRYLASFIENT--EEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIY--------NKNQL-----DLLIGRDIITKYNNKTYRISDIK-EMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLS--IPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCS--WTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ-RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRN-PTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVR-----VQKVHMALVFINDDKAYARVKNFT-ISTGLLTQCV---TVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            ++ L +NY   + T +   + Y V   A  +  +L  +  V     SD     +   FDG  L+ P    +KE I       ++  +     F  N    E   + N++F  I+  +   +IGR +F                  R   +I  G+ T++     Q+     LL  +  ++V+  +SVY+I         NK Q+     + L+G+ ++T +NN+ YRI+DI    +   E +  G KISY DYFK  Y + + + +QP ++S+        +  +   P+  K+ D  L   IP ELC L G +D    +  L + L    +  P++R   + +F    ++ E +A   +  WG+ ++   + I   ++N   ++ G +  ++     ++K       +  G +    IL   ++  T  N  +  +  +  R+ V      +     +  E+YL +  R     VQ V   L  + +D+ Y  +K F  +   + +Q V   T++ G   +      VA    +Q+ AKLG + W V+
Sbjct:  211 SLTLSANYVKVRTT-QPHIYQYHVSF-APPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEK---------KIVLDRRRMEIWPGYVTSI-----QNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKS-----NSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-----VAVNIALQINAKLGGELWAVK 730          
BLAST of Pgr_023068 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 373/542 (68.82%), Postives = 461/542 (85.06%), Query Frame = 3
Query:  144 KRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHK-EDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGV 1766
            +RGGLQ+RF IIEP+LQP+TV DK+GK+G+ V+LKSNYANF +   GPF+MYDV M  KS+R KL+LL + A +K + QPFCFDGRRLFT S+WH  ED E   +KD E+SIR L +F++N+EEYYQM+NI+FNNIQ+FMGQE+IGR FFLGSNC     + GP+FFK DNFKILGG++TT++RGTN++G+ASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRDIITKYNNKTYRISDIKEMD+ +E++L   KISYL+YFKQRYNI L N KQPFVISR++R  ++ KE  ENEPE P + DQSLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPRERL DI DFC WT  GK+  +M+ WG+ ++ QPITI GREL  V++FS + +IN K PDDWKFGE+KFD+P+G  HRF +L VDRNP+HFN FI+DVKRE+GRLR+N++++++++CR NE+ED LTDF+RV KVHMALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQMF+KLGYDPWG+
Sbjct:   15 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGI 556          
BLAST of Pgr_023068 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 292/561 (52.05%), Postives = 398/561 (70.94%), Query Frame = 3
Query:  111 VRNKMEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQP--FCFDGRRLFTPSQWHK-EDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCN-EAISKN-GPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPFME-KWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRVQK--VHMALVFINDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +R  ++  R  +RGGLQKRF I+EP LQP   KDK+G  GK V L+SN+  F +     + MYD       L  KL L   V   K  + P  FC+DGRRLFT   W +  DI+ FT+ +++VS+R +++F+ +TEEYYQM+N++ NN+Q+ MGQE+IG+ +FLGSN N + + KN GPTFF+ +NFK+LGGF TTL RGT  +G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRDI+TKYNNKTYRIS+IKEM+I E  E+ G  +SY  YFK+RYNI L   +QPFV++R++++  + K  + NE EAP+D D +L+I GELCFLCGFSD E+SN++LQK+LG VLKR PRERL DI  FC W +    +  M  KWG+++DN P+ I GREL   +V SG QRIN K  DDWKFG+V+F++ +G +H   ++ VDRN + +  F++DV+ E+ +LR +  +  V  C  N++E  L D +R       +ALVF+ DD+ YA+VK+FTISTGLLTQCVT RNGTNR+D+RR+VV+ K+VMQ+F+K GYDPW ++
Sbjct:    6 IRKNLDGIRIERRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTID 566          
BLAST of Pgr_023068 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 284/557 (50.99%), Postives = 390/557 (70.02%), Query Frame = 3
Query:  147 RGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQP--FCFDGRRLFTPSQWHKE-DIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNC--NEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKE--------NQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPFM-EKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRVQK--VHMALVFINDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            RGGL+  F I+EP+LQP  + +K G  G+ V L+SN+  F +     F MYD       L  K+ L + V   + +  P  FCFDGRRLFT  +WH E DI+ F+  ++++++R +++ +  TEEYYQM+N++ NN+QV +GQERIG+ +FL  N   +E    +GPTFF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRDIITKYNNKTYRIS+IKEM++ E+ E+ G  +SY +YFK+RYNI L  G QPFV++R+++ P++++          +E E EAP++ D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI  +C+W +   AA  M  KW +++DN+P+ I GREL   +V SG  +IN K  DDWKFG V+FDI +  +H   ++ VDRN   +  F++DV++E+  +R++  V  V TC  N++E  L D  R       MALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQ+FAK GYDPW VE
Sbjct:   25 RGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKK-PMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVE 580          
BLAST of Pgr_023068 vs. uniprot
Match: gi|226701333|sp|Q8CGT6|PIWL4_MOUSE (RecName: Full=Piwi-like protein 4; Short=mAgo5)

HSP 1 Score: 133.65 bits (335), Expect = 1.752e-31
Identity = 141/555 (25.41%), Postives = 237/555 (42.70%), Query Frame = 3
Query:  204 VKD-KVGKEGKAVALKSNYANFKLTPRGPFFMYDVKMPA--KSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKE--DIETFTVKDE--EVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERIN-RVLNENSVYNIYNKNQLDL------------LIGRDIITKYNNKTYRISDIK-EMDITEEIE-LNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAAPF-MEKWGVQLDNQPITIMGRELNGVEVFSGKQRINGKSPDDWKFGEVKFDIPQGAQ-HRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVH--------MALVFINDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            VKD K G  G  V L +N  N  L      + Y V       S R ++ LLY+ +    SD+   FDG  LF   +  ++  ++ + T + E  ++++   +    N+    Q  N+IF  I   +   +IGR F+  S          P    +    +  GFA ++S         S LL+   +N +VL   +V +      L              L+G  ++T+YNNKTYRI DI   +  T+  +  +G +++Y+DY+KQ+Y+ITL++  QP ++S ++R     K N  +EP       Q + +  ELCFL G S    S+  L K++    +  P  R + +       Q    A F +E WG+   +Q +++ GR +   ++             DW        +      +R+ I+  +R       F+  ++R  G +  N     V   ++ ++++    F+R  +VH        M ++  N    Y  +K +  S   + +QCV  R  T         VA K  MQM  KLG + W VE
Sbjct:   89 VKDCKTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSIL--SDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSE---------PVEIPQYKLSLWPGFAISVSH------FESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKR-----KRNDNSEP-------QMVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFELETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFN-----VGYPKIIKVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTR--TLNKQGTMLSVATKIAMQMTCKLGGELWSVE 606          
BLAST of Pgr_023068 vs. uniprot
Match: gi|33112431|sp|Q9VKM1|PIWI_DROME (RecName: Full=Protein piwi)

HSP 1 Score: 123.635 bits (309), Expect = 3.942e-28
Identity = 143/566 (25.27%), Postives = 255/566 (45.05%), Query Frame = 3
Query:  192 QPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKM-PA-KSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTVKDE-----EVSIRYLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDIITKYNNKTYRISDIKEMDITEE-IELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEG-KAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRI---NGKSP----DDWK--FGEVK-FDIPQGAQHRFAILAVDRNPTHFNQFIDDVKRE---MGRLRVNHSVE-TVTTCRVNEIEDYLTDFVRVQ-KVHMALVFINDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +P  +  K G +G  V L++N+   K  P      Y V+  P+ ++ R ++ +L + A   GS   + FDG +LFT  ++ +E I   + K +     ++SI+++  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL++    +T YNN+TYRI+D+      +      G  IS+++Y+  +YNI + +  QP +IS+ R   ++             +A + + +  ELC + G +   RSN  L +++ S  +  P++R   +  F    Q   ++   +  W ++LD     + GR +       G+Q I   NGK P     DW+  F + +    P     R+A++A  RN       +D + R    MG LR+    E  +   R       + D VR   K+ + LV  ++ + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +E
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIV----LTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALK------------TNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRII-------GQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIE 602          
BLAST of Pgr_023068 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 123.635 bits (309), Expect = 4.551e-29
Identity = 143/566 (25.27%), Postives = 255/566 (45.05%), Query Frame = 3
Query:  192 QPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKM-PA-KSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTVKDE-----EVSIRYLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDIITKYNNKTYRISDIKEMDITEE-IELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEG-KAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRI---NGKSP----DDWK--FGEVK-FDIPQGAQHRFAILAVDRNPTHFNQFIDDVKRE---MGRLRVNHSVE-TVTTCRVNEIEDYLTDFVRVQ-KVHMALVFINDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +P  +  K G +G  V L++N+   K  P      Y V+  P+ ++ R ++ +L + A   GS   + FDG +LFT  ++ +E I   + K +     ++SI+++  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL++    +T YNN+TYRI+D+      +      G  IS+++Y+  +YNI + +  QP +IS+ R   ++             +A + + +  ELC + G +   RSN  L +++ S  +  P++R   +  F    Q   ++   +  W ++LD     + GR +       G+Q I   NGK P     DW+  F + +    P     R+A++A  RN       +D + R    MG LR+    E  +   R       + D VR   K+ + LV  ++ + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +E
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIV----LTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALK------------TNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRII-------GQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIE 602          
BLAST of Pgr_023068 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 123.635 bits (309), Expect = 4.551e-29
Identity = 143/566 (25.27%), Postives = 255/566 (45.05%), Query Frame = 3
Query:  192 QPETVKDKVGKEGKAVALKSNYANFKLTPRGPFFMYDVKM-PA-KSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQWHKEDIETFTVKDE-----EVSIRYLASFIENTE-EYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDIITKYNNKTYRISDIKEMDITEE-IELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEG-KAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRI---NGKSP----DDWK--FGEVK-FDIPQGAQHRFAILAVDRNPTHFNQFIDDVKRE---MGRLRVNHSVE-TVTTCRVNEIEDYLTDFVRVQ-KVHMALVFINDDKAYARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            +P  +  K G +G  V L++N+   K  P      Y V+  P+ ++ R ++ +L + A   GS   + FDG +LFT  ++ +E I   + K +     ++SI+++  FI   E  + Q++N+I       +  E +GR  F      +  +K     FK    ++  G+ T++ R   +D     LL  E  ++V+   ++Y+I  +              N LDL++    +T YNN+TYRI+D+      +      G  IS+++Y+  +YNI + +  QP +IS+ R   ++             +A + + +  ELC + G +   RSN  L +++ S  +  P++R   +  F    Q   ++   +  W ++LD     + GR +       G+Q I   NGK P     DW+  F + +    P     R+A++A  RN       +D + R    MG LR+    E  +   R       + D VR   K+ + LV  ++ + Y+ +K    +   + TQ VT++   NR       +A K  +Q+  KLGY PW +E
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSI-RQHEKD----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIV----LTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALK------------TNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRII-------GQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMG-LRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIE 602          
BLAST of Pgr_023068 vs. RefSeq Drosophila melanogaster
Match: gi|281366635|ref|NP_001163498.1| (argonaute 3, isoform G [Drosophila melanogaster])

HSP 1 Score: 111.694 bits (278), Expect = 3.131e-25
Identity = 122/541 (22.55%), Postives = 226/541 (41.77%), Query Frame = 3
Query:  219 GKEGKAVALKSNYANFKLTPRGPFFMYDVKM--PAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQW-HKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDIITKYNNKTYRISDIK-EMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFV--ISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAA-PFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRIN-GKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVR--VQKVHMALVFIND--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            G +G +V +  NY           F Y+V+   P  S+  ++  L       G  + F  DG  L+ P    +K  +     +D E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  ++T+YNN+TY+I+DI  + + T + E+     SY++Y+KQ +NI + +  QP +  I + R +P            A ++  Q   IP ELC+L G  D  RS+  L + + +  +  P +R   +  F        AA   +  WG+ L N    I GR+++  +++  K  ++ G+S +  K       +      ++ I+ +          +D++K+    L +N S  T+ +   + I+ Y+    R       M +   ++  D  YA +K    S   + +Q +  +   N  D + + V  K V+QM  KLG   W V+
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTF--DGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIP------------AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQN--DLKIRSVVQKIVLQMNCKLGGSLWTVK 631          
BLAST of Pgr_023068 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 111.309 bits (277), Expect = 3.486e-25
Identity = 122/541 (22.55%), Postives = 226/541 (41.77%), Query Frame = 3
Query:  219 GKEGKAVALKSNYANFKLTPRGPFFMYDVKM--PAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQW-HKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDIITKYNNKTYRISDIK-EMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFV--ISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAA-PFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRIN-GKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVR--VQKVHMALVFIND--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            G +G +V +  NY           F Y+V+   P  S+  ++  L       G  + F  DG  L+ P    +K  +     +D E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  ++T+YNN+TY+I+DI  + + T + E+     SY++Y+KQ +NI + +  QP +  I + R +P            A ++  Q   IP ELC+L G  D  RS+  L + + +  +  P +R   +  F        AA   +  WG+ L N    I GR+++  +++  K  ++ G+S +  K       +      ++ I+ +          +D++K+    L +N S  T+ +   + I+ Y+    R       M +   ++  D  YA +K    S   + +Q +  +   N  D + + V  K V+QM  KLG   W V+
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTF--DGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIP------------AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQN--DLKIRSVVQKIVLQMNCKLGGSLWTVK 631          
BLAST of Pgr_023068 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 111.309 bits (277), Expect = 3.486e-25
Identity = 122/541 (22.55%), Postives = 226/541 (41.77%), Query Frame = 3
Query:  219 GKEGKAVALKSNYANFKLTPRGPFFMYDVKM--PAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQW-HKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQERIGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDIITKYNNKTYRISDIK-EMDITEEIELNGVKISYLDYFKQRYNITLANGKQPFV--ISRMRRLPIQQKENQENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRERLRDIGDFCSWTQEGKAA-PFMEKWGVQLDNQPITIMGRELNGVEVFSGKQRIN-GKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREMGRLRVNHSVETVTTCRVNEIEDYLTDFVR--VQKVHMALVFIND--DKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQMFAKLGYDPWGVE 1769
            G +G +V +  NY           F Y+V+   P  S+  ++  L       G  + F  DG  L+ P    +K  +     +D E+ IR L    E      Q+ NI+F+ +   +   +  R  F  S          P        ++  G+ T +      +     +L  +  +R+L + +V  +           Y ++   +L+G  ++T+YNN+TY+I+DI  + + T + E+     SY++Y+KQ +NI + +  QP +  I + R +P            A ++  Q   IP ELC+L G  D  RS+  L + + +  +  P +R   +  F        AA   +  WG+ L N    I GR+++  +++  K  ++ G+S +  K       +      ++ I+ +          +D++K+    L +N S  T+ +   + I+ Y+    R       M +   ++  D  YA +K    S   + +Q +  +   N  D + + V  K V+QM  KLG   W V+
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTF--DGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIP------------AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQN--DLKIRSVVQKIVLQMNCKLGGSLWTVK 631          
The following BLAST results are available for this feature:
BLAST of Pgr_023068 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221316711|ref|NP_689644.2|1.315e-2725.50piwi-like protein 4 [Homo sapiens][more]
gi|300244501|ref|NP_001177900.1|1.174e-2623.78piwi-like protein 1 isoform 2 [Homo sapiens][more]
gi|767975978|ref|XP_011537307.1|1.586e-2623.78PREDICTED: piwi-like protein 1 isoform X3 [Homo sa... [more]
gi|768044486|ref|XP_011544923.1|1.586e-2623.78PREDICTED: piwi-like protein 1 isoform X3 [Homo sa... [more]
gi|66346725|ref|NP_004755.2|2.044e-2623.78piwi-like protein 1 isoform 1 [Homo sapiens][more]
back to top
BLAST of Pgr_023068 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150261770.000e+068.82SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159470.000e+050.62SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150150277.227e-2461.64SmedAsxldir_c97534_g1_i3|m.40524|m.26292[more]
SMU150001113.310e-2022.77Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
back to top
BLAST of Pgr_023068 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+068.82RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+052.05RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+050.99RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|226701333|sp|Q8CGT6|PIWL4_MOUSE1.752e-3125.41RecName: Full=Piwi-like protein 4; Short=mAgo5[more]
gi|33112431|sp|Q9VKM1|PIWI_DROME3.942e-2825.27RecName: Full=Protein piwi[more]
back to top
BLAST of Pgr_023068 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|4.551e-2925.27piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|4.551e-2925.27piwi, isoform B [Drosophila melanogaster][more]
gi|281366635|ref|NP_001163498.1|3.131e-2522.55argonaute 3, isoform G [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|3.486e-2522.55argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|3.486e-2522.55argonaute 3, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_023068 ID=Pgr_023068|Name=Pgr_023068|organism=Phagocata gracilis|type=mRNA|length=1769bp
ATTAAATTCATTTGTTTAAATTCATTGTTAGGTATATCCATATAAAAGTC
TAAAGCTTTTGTCTTTGTTCATTATTACTAAAAAGCAATCTTTTTTAGAA
GAACATTTAAGTTAGAAACAAAATGGAAGAAAAAAGAACAATTAAGAGAG
GAGGCCTTCAAAAGAGATTCTACATAATAGAACCGTCTCTTCAACCTGAA
ACAGTGAAGGATAAAGTAGGAAAGGAAGGAAAAGCTGTAGCATTGAAATC
CAATTATGCAAATTTCAAGTTAACGCCAAGAGGTCCATTCTTTATGTATG
ATGTTAAAATGCCAGCAAAAAGCTTACGTGGAAAGCTAGATTTGTTATAC
AGCGTTGCTACAACGAAAGGAAGTGATCAGCCGTTTTGTTTTGATGGACG
TCGACTTTTTACACCTTCTCAATGGCATAAAGAAGATATTGAAACGTTTA
CAGTTAAAGACGAAGAAGTTTCAATCAGGTATTTGGCTTCCTTCATCGAA
AACACGGAAGAATATTATCAAATGGTCAATATAATTTTCAATAATATTCA
AGTTTTTATGGGCCAAGAGAGGATTGGTAGAGCCTTTTTCCTTGGTTCTA
ATTGTAATGAAGCTATATCTAAAAACGGACCAACGTTTTTTAAGAGAGAT
AATTTTAAAATTTTAGGCGGATTTGCTACAACTCTTTCGAGAGGCACAAA
TCAAGATGGTAGTGCATCCACACTATTATATCTTGAACGAATAAATCGAG
TTTTAAATGAAAATTCAGTGTACAATATTTACAATAAAAATCAGTTGGAC
CTTTTAATAGGCCGAGATATTATTACTAAGTATAATAATAAGACGTATAG
AATTAGCGATATTAAGGAAATGGATATTACTGAAGAGATTGAGTTAAACG
GAGTTAAAATTTCTTATCTCGATTACTTTAAGCAACGCTACAATATTACT
CTAGCAAATGGAAAGCAACCTTTTGTAATATCTAGAATGAGAAGATTACC
TATACAACAGAAAGAAAATCAAGAAAACGAACCGGAAGCTCCAAAAGATG
CCGATCAAAGTTTATCCATACCCGGTGAATTGTGTTTCTTGTGCGGCTTT
TCAGATAGCGAAAGGTCAAACTTAAATTTACAAAAAAGCTTAGGTTCGGT
TTTGAAACGAGAACCCAGAGAGAGGTTAAGAGATATCGGTGACTTTTGCA
GTTGGACACAAGAAGGTAAAGCTGCTCCATTCATGGAAAAGTGGGGTGTT
CAGTTAGATAATCAGCCGATAACTATCATGGGCCGCGAGCTTAATGGTGT
TGAAGTATTTTCGGGCAAGCAGAGAATAAACGGTAAATCTCCAGATGATT
GGAAGTTTGGTGAAGTTAAATTTGACATACCACAAGGCGCTCAGCATAGA
TTTGCTATTTTAGCAGTCGATAGAAATCCAACTCATTTCAACCAATTTAT
TGATGATGTTAAGCGCGAAATGGGAAGATTAAGAGTTAATCATTCAGTTG
AAACGGTTACTACATGTAGAGTAAATGAAATTGAAGATTACCTTACTGAC
TTTGTTAGGGTACAAAAAGTCCATATGGCTCTTGTTTTTATTAATGACGA
TAAAGCATATGCACGTGTTAAGAATTTTACAATTAGTACAGGTTTATTAA
CTCAATGTGTCACTGTTCGCAATGGCACAAACCGAGATGATCGTAGAAGG
AAGGTAGTGGCTGATAAGAGTGTGATGCAAATGTTCGCCAAGTTAGGGTA
TGATCCATGGGGAGTTGAA

Design Primers for Pgr_023068

back to top

protein sequence

>Pgr_023068-protein ID=Pgr_023068-protein|Name=Pgr_023068|organism=Phagocata gracilis|type=polypeptide|length=549bp
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
back to top

coding sequence

>Pgr_023068.123.1769 ID=Pgr_023068.123.1769|Name=Pgr_023068.123.1769|organism=Phagocata gracilis|type=CDS|length=1647bp
ATGGAAGAAAAAAGAACAATTAAGAGAGGAGGCCTTCAAAAGAGATTCTA
CATAATAGAACCGTCTCTTCAACCTGAAACAGTGAAGGATAAAGTAGGAA
AGGAAGGAAAAGCTGTAGCATTGAAATCCAATTATGCAAATTTCAAGTTA
ACGCCAAGAGGTCCATTCTTTATGTATGATGTTAAAATGCCAGCAAAAAG
CTTACGTGGAAAGCTAGATTTGTTATACAGCGTTGCTACAACGAAAGGAA
GTGATCAGCCGTTTTGTTTTGATGGACGTCGACTTTTTACACCTTCTCAA
TGGCATAAAGAAGATATTGAAACGTTTACAGTTAAAGACGAAGAAGTTTC
AATCAGGTATTTGGCTTCCTTCATCGAAAACACGGAAGAATATTATCAAA
TGGTCAATATAATTTTCAATAATATTCAAGTTTTTATGGGCCAAGAGAGG
ATTGGTAGAGCCTTTTTCCTTGGTTCTAATTGTAATGAAGCTATATCTAA
AAACGGACCAACGTTTTTTAAGAGAGATAATTTTAAAATTTTAGGCGGAT
TTGCTACAACTCTTTCGAGAGGCACAAATCAAGATGGTAGTGCATCCACA
CTATTATATCTTGAACGAATAAATCGAGTTTTAAATGAAAATTCAGTGTA
CAATATTTACAATAAAAATCAGTTGGACCTTTTAATAGGCCGAGATATTA
TTACTAAGTATAATAATAAGACGTATAGAATTAGCGATATTAAGGAAATG
GATATTACTGAAGAGATTGAGTTAAACGGAGTTAAAATTTCTTATCTCGA
TTACTTTAAGCAACGCTACAATATTACTCTAGCAAATGGAAAGCAACCTT
TTGTAATATCTAGAATGAGAAGATTACCTATACAACAGAAAGAAAATCAA
GAAAACGAACCGGAAGCTCCAAAAGATGCCGATCAAAGTTTATCCATACC
CGGTGAATTGTGTTTCTTGTGCGGCTTTTCAGATAGCGAAAGGTCAAACT
TAAATTTACAAAAAAGCTTAGGTTCGGTTTTGAAACGAGAACCCAGAGAG
AGGTTAAGAGATATCGGTGACTTTTGCAGTTGGACACAAGAAGGTAAAGC
TGCTCCATTCATGGAAAAGTGGGGTGTTCAGTTAGATAATCAGCCGATAA
CTATCATGGGCCGCGAGCTTAATGGTGTTGAAGTATTTTCGGGCAAGCAG
AGAATAAACGGTAAATCTCCAGATGATTGGAAGTTTGGTGAAGTTAAATT
TGACATACCACAAGGCGCTCAGCATAGATTTGCTATTTTAGCAGTCGATA
GAAATCCAACTCATTTCAACCAATTTATTGATGATGTTAAGCGCGAAATG
GGAAGATTAAGAGTTAATCATTCAGTTGAAACGGTTACTACATGTAGAGT
AAATGAAATTGAAGATTACCTTACTGACTTTGTTAGGGTACAAAAAGTCC
ATATGGCTCTTGTTTTTATTAATGACGATAAAGCATATGCACGTGTTAAG
AATTTTACAATTAGTACAGGTTTATTAACTCAATGTGTCACTGTTCGCAA
TGGCACAAACCGAGATGATCGTAGAAGGAAGGTAGTGGCTGATAAGAGTG
TGATGCAAATGTTCGCCAAGTTAGGGTATGATCCATGGGGAGTTGAA
back to top
Gene Groups
Pgr_023068 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.