Pgr_021595, Pgr_021595 (mRNA) Phagocata gracilis

Overview
NamePgr_021595
Unique NamePgr_021595
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1549
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_021595 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 297/440 (67.50%), Postives = 368/440 (83.64%), Query Frame = 2
Query:  113 MVAEEFIGLVDKLKLSKYVGVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV* 1432
            MVAEEF+ L+ + K+S YVG+EDFADKLSFLFSV  L +S+MVVTIKSY FKPLACY AT P G NF+NYLENYCWVHGTI+ LPGE +PQND +WA AD+ RRI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK+GT+LE ++N+A+ A N+ P +RK  ++++ARTIEDMLFQHRDYRQG  A +RR++Y  CNFCVFSKHMGTWL+L Y ++K LY +NV GQL IMKKFLGFN + ++FGYTVL+NM++G+ WHQTGIFPRVTYCY+  I+H+G +NKYVAQCALP+NMLNEKIYVFLWFW+ LVG++TAISIP+WF R+A LS RS F+K+FL+M   Y RSDK  +++FI EFLRHDGVFL+RM+FINAGD+IT+DIV RL EIY + YKH+DFRN++ Y K  D    + R+     S++SI+KEP+E+FV*
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV* 440          
BLAST of Pgr_021595 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 255/427 (59.72%), Postives = 339/427 (79.39%), Query Frame = 2
Query:  113 MVAEEFIGLVDKLKLSKYVGVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDVGTAIRRSGRQPDSN 1393
            MVA+EF+ L+D+ KLS Y G+EDFAD+L+F+FSV+ LS+S+++VT K+YFFKPL+CYVATTPSG+NFD Y+ENYCWVHGTI  L  E++P   ++WAI D D+RITYYQWVPFILGLQCI+FYIP+++W++ICYNK GT+LE LI  A+ ++   P +RK +++ + R IED+L+QHRDYRQGKMA  RRR+Y+ CNFCVFSKH+GTWLV  YF +KCLY +NV GQL +MK FLGFN S+++FGYT+LN++++G+ WH+T  FPRV+YCY  +I+HLGA N YVAQC LP+NMLNEKIY+FLWFWV LVG+IT +SI  W +RI  LS RS F KK L M   Y RS+  +++HFI E+LR+DG+FLIRMI+IN+GD++ ++I+  LWE Y ++Y + DF N+++Y K          SGRQ D +
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEK--------LISGRQDDKS 419          
BLAST of Pgr_021595 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 392.119 bits (1006), Expect = 7.257e-131
Identity = 199/415 (47.95%), Postives = 293/415 (70.60%), Query Frame = 2
Query:  113 MVAEEFIGLVDKLKLSKYVGVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNE-SITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQS--LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDD 1348
            MVA EF+  + KL++S  VG+ED  D+L+F FSV+ L V I++VT+K Y FKP++CY+     G N  +Y+EN CWV GTI++    K P  D+EW   +   ++ YYQWVPF+LGLQCIMFY+P+++WQ+ICYN+TGTD++ L+  A++A +S+ E R  +V  +++T+E +L+QHRD+R GK+A  RR+++    F + SK +GTWLV  Y ++K  Y  N F QL+IM+KFLGF++ ++  FG  V NN+ +G  W  T IFPRV+YC++ ++ HLG  N  VAQC LP+NMLNE+IY FLW W+ +V  +T +SIP+W LRI  +  R HF+++FL++ ++ T+  K++  L  F S+FLRHDG+FL++MI +NAGD+ITS+IV +LW IY   Y +   RNF + G  +D
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEK-HKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVN---RNFLNDGSDED 410          
BLAST of Pgr_021595 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 385.185 bits (988), Expect = 6.208e-128
Identity = 206/437 (47.14%), Postives = 287/437 (65.68%), Query Frame = 2
Query:  113 MVAEEFIGLVDKLKLSKYVGVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQS--LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDV--GTAIRRSGRQPDSNESIEKE 1411
            MVA +FI  + K ++S Y GVEDFADK +FLF+V+ L +   +VT+K Y  KP++CY++T  SG N   Y+ENYCWV GTI I    K+P  ++EWA   N  +I YYQWVPF+L LQ IMFYIPR+IWQ+ CYN TGTD+  LI  A++A +S+ E R  +V+ +A+TIE ML+QHRD R G++A  RR +YK+C FC+ SK  GT L+  YFI+K LY  N   QL  MK FLG NE+   FG+ ++ N++NGQ W  T +FPRV YCY+  ++++G +N  VAQC LP+NMLNEKI+ FLW W+F   ++  ISI +W  R ++   R  F+ +FL +  +    D++   +  F  +FLR+DGVFL++MI +NAGD++ +DIV +LW+I+  QY +   RNF   G  DD   G  + R      S  S +K 
Sbjct:    1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWA-ELNKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYAN---RNFLSDGSDDDENHGRTLIRLDNNNHSKPSFDKS 431          
BLAST of Pgr_021595 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 375.941 bits (964), Expect = 1.199e-124
Identity = 197/424 (46.46%), Postives = 275/424 (64.86%), Query Frame = 2
Query:  113 MVAEEFIGLVDKLKLSKYVGVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFR----NFSHYGKPDDVGTAIRRS 1372
            MVA EF  L+++L      G+ED ADK+S +FSVL LSV + +VTIKSY  KP++CY++  PSG NF +Y+ENYCW+HGTI + P +KL  N   W   +  ++I YYQWVPFILGLQCIMFYIP++IWQ+ C+N+ GT+L+ +I  + K A     +R+   + +A+ IE+ML  HRD+R  K+A+IRR +Y  C+  + SK +GT +V  YF+ K LY  N  GQL +++  LGF   +  FG  +   +V+G        FPRV +CYL  IRH+G  N YVAQC LP+NMLNEKIY FLW W+ LV   T ISIP+W  R+     R H++  FL M + Y    K  +  FI++FLRHDG+FL+RMI  NAGDLI + +V  LW+IY+ +Y++ + R    + S++ K D+   +   S
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLRKDIFSVSNHLKEDEANNSTSNS 424          
BLAST of Pgr_021595 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 204.142 bits (518), Expect = 3.011e-58
Identity = 130/373 (34.85%), Postives = 207/373 (55.50%), Query Frame = 2
Query:  176 EDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYID 1294
            +D  DKL++ ++   ++V  ++V+ K Y   P+ C+V  T +    + Y ENYCWV  T  +   + +P N  E      +R+I YYQWVPF+L L+ ++FY+P I+W+L+ + ++G  ++ L+  A  +     E R   +  +A  +E+ L        G          K+ N  + ++  G  +   Y  +K LY VN+ GQ+ ++  FLG N S   +G  VLN+++NG+ W ++G FPRVT C   E++ LG  +++  QC L INM NEKI++FLWFW FL+   T  S+  W     + S + +FV K+L   + Y   D QSL  F+  FLR DGVFL+RM+  +AG+L   ++ + LW  Y D
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRL-------KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG-NRS-KWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCD 377          
BLAST of Pgr_021595 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 204.142 bits (518), Expect = 4.765e-57
Identity = 129/372 (34.68%), Postives = 211/372 (56.72%), Query Frame = 2
Query:  176 EDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFL-LMKDKYTR--SDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWE 1282
            +DF DKL++ ++   L+   ++V+ K Y   P+ C+V  T +    + Y ENYCWV  T  +   E +P+       +  +R+I YYQWVPFIL ++ ++FY+P I+W+ + Y  +G +L+ L+  A  A     E +   V  MAR ++D +      RQG        +    N C   +H G ++ + Y  +K LY  NV  Q  ++   LG N+   A+G+++L ++++   W QTG+FPRVT C   E+R LG  +++  QC L INM NEKI++FLWFW    G++T  +   W L + + S    FV+K+L ++ D   +  +D  +L  F + FLR DGVF++RMI  +AG+L++S+++  LW+
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTD-AMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Pgr_021595 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 182.956 bits (463), Expect = 4.727e-50
Identity = 140/420 (33.33%), Postives = 225/420 (53.57%), Query Frame = 2
Query:  170 GVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKA-ANSAPEDRKGIVDKMARTIEDML-FQHRDYR---QGKMADIRRRMYKMCNFCVFSKHM-GTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKD-----KYTRSDKQS---------------LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDV 1351
            G +D  D+L++ ++ L L+V  +V++ K Y   P+ C+V    S  + + Y+E+YCW+  T  I   E +P  DD    A  +++I YYQWVPFIL  + +MF +P I W+L C  ++G +++ LIN A  A A     DR+  V+ +     D L  Q  + R   +G +A I+           FS+ + G  + + Y   K LY VNV  Q  I+   L  +E +  FG+ VL+++  G+ W +TG FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W  ++ +IT  S   W     + S +  +V KF+ + +     K  + +K +               LD F+S+FL+ DG+ ++RMI  +AGD+I   +VR LW+    +Y+  ++R F  + +  DV
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVP--DDH--TAREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF-FGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQ----EYRERNWREFEEHEEMKDV 415          
BLAST of Pgr_021595 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 181.8 bits (460), Expect = 1.791e-49
Identity = 136/420 (32.38%), Postives = 225/420 (53.57%), Query Frame = 2
Query:  170 GVEDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEA--SKAANSAPEDRKGIVDKMARTIEDMLFQHRDYR---QGKMADIRRRMYKMCNFCVFSKHM-GTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKD-----KYTRSDKQS---------------LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDV 1351
            G +D  D+L++ ++ L L+V  +V++ K Y   P+ C+V    S  + + Y+E+YCW+  T  I   E +P  DD    A  +++I YYQWVPFIL  + +MF +P I W+L C  ++G +++ LIN A   +A   A + +K +       ++++  Q  + R   +G +A I+           FS+ + G  L + +   K LY +NV  Q LI+   L  +     FG+ VLN++  G+ W +TG FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W  ++ +IT  S   W     + S +  +V KF+ + +     K  + +K +               LD F+S+FL+ DGV ++RMI  +AGD+I   +VR LW+    +++  ++R F  + +  DV
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVP--DDH--TAREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQ----EFRERNWREFEEHEEMKDV 431          
BLAST of Pgr_021595 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 172.555 bits (436), Expect = 5.588e-46
Identity = 123/422 (29.15%), Postives = 212/422 (50.24%), Query Frame = 2
Query:  149 LKLSKYVGV---EDFADKXXXXXXXXXXXXXIMVVTIKSYFFKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMG--TWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMK------DKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDVGTAIRRSGRQ 1381
            L ++KY+     +D++D+L++L +   L    ++++ K +  +P+ C       G +++ Y ENYCW   T  + P + +     E      DR+++YYQWVPF L LQ   F  P  +W+    N +G  +  ++ +A  +AN   E R+  +  + R +   L       Q  M   + +++K   F  F    G  +W+   Y   K LY +NVF QL +M  FLG N     +G+ V+ ++V G+ W ++G FPR   C   E+R +    +Y  QC L IN+ NEKI+V LWFW  ++ + + +S+  WF+ +        FVK+ L +        + +R +   +  F++++L  DGVF++RM+  +AG +  +D+V+ L+E Y  Q K+ D +          + T    S RQ
Sbjct:    8 LGMAKYLSPREDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTP-DRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSAL-----RFQANMERKKVQVHKTVTFLNFQYSSGFISWI---YLFTKVLYFLNVFAQLYLMNYFLGTNRH-HWYGFGVVQDIVQGEPWERSGYFPRAAVCDF-EVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDLQTISTGAESSIRQ 416          
BLAST of Pgr_021595 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 81.6481 bits (200), Expect = 1.766e-16
Identity = 71/276 (25.72%), Postives = 110/276 (39.86%), Query Frame = 2
Query:  236 MVVTIKSYFFKPLAC-YVATTPSGLNFDNYLENYCWVHGTISIL-------------PGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 1012
            + VT + Y   P+ C +    P     ++ L  YCW+H T +++             PG    Q      I    +   YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   28 IAVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTI----KHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 258          
BLAST of Pgr_021595 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 81.6481 bits (200), Expect = 2.039e-16
Identity = 71/276 (25.72%), Postives = 110/276 (39.86%), Query Frame = 2
Query:  236 MVVTIKSYFFKPLAC-YVATTPSGLNFDNYLENYCWVHGTISIL-------------PGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 1012
            + VT + Y   P+ C +    P     ++ L  YCW+H T +++             PG    Q      I    +   YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   44 IAVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTI----KHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Pgr_021595 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 81.6481 bits (200), Expect = 2.039e-16
Identity = 71/276 (25.72%), Postives = 110/276 (39.86%), Query Frame = 2
Query:  236 MVVTIKSYFFKPLAC-YVATTPSGLNFDNYLENYCWVHGTISIL-------------PGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 1012
            + VT + Y   P+ C +    P     ++ L  YCW+H T +++             PG    Q      I    +   YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   44 IAVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTI----KHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Pgr_021595 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 81.6481 bits (200), Expect = 2.039e-16
Identity = 71/276 (25.72%), Postives = 110/276 (39.86%), Query Frame = 2
Query:  236 MVVTIKSYFFKPLAC-YVATTPSGLNFDNYLENYCWVHGTISIL-------------PGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 1012
            + VT + Y   P+ C +    P     ++ L  YCW+H T +++             PG    Q      I    +   YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   44 IAVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTI----KHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Pgr_021595 vs. RefSeq Drosophila melanogaster
Match: gi|161077972|ref|NP_608410.2| (shaking B, isoform D [Drosophila melanogaster])

HSP 1 Score: 82.0333 bits (201), Expect = 3.642e-16
Identity = 71/276 (25.72%), Postives = 110/276 (39.86%), Query Frame = 2
Query:  236 MVVTIKSYFFKPLAC-YVATTPSGLNFDNYLENYCWVHGTISIL-------------PGEKLPQNDDEWAIADNDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 1012
            + VT + Y   P+ C +    P     ++ L  YCW+H T +++             PG    Q      I    +   YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:  199 IAVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTI----KHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 429          
The following BLAST results are available for this feature:
BLAST of Pgr_021595 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pgr_021595 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008370.000e+067.50Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006570.000e+059.72Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150364827.257e-13147.95dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150331266.208e-12847.14SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150281811.199e-12446.46SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
back to top
BLAST of Pgr_021595 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL3.011e-5834.85RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL4.765e-5734.68RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR4.727e-5033.33RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL1.791e-4932.38RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|10720052|sp|Q23157|INX11_CAEEL5.588e-4629.15RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
back to top
BLAST of Pgr_021595 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24643566|ref|NP_523425.2|1.766e-1625.72shaking B, isoform C [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|2.039e-1625.72shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|2.039e-1625.72shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|2.039e-1625.72shaking B, isoform I [Drosophila melanogaster][more]
gi|161077972|ref|NP_608410.2|3.642e-1625.72shaking B, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_021595 ID=Pgr_021595|Name=Pgr_021595|organism=Phagocata gracilis|type=mRNA|length=1549bp
GGTAAACATAAGATTGTTTATCCACCACTGAATATAAGCCACAGTGTCTA
TGGTTACATTATTCTTAGAGAGGCATTGACATTTATTGACTAATTAATAT
CTACCAGAGAATATGGTCGCGGAAGAATTCATCGGACTCGTCGACAAATT
GAAGCTGTCGAAATATGTCGGCGTGGAGGACTTCGCCGACAAACTTAGCT
TCTTGTTCAGTGTCCTGTTCCTGTCAGTGTCGATCATGGTTGTCACCATC
AAGTCGTACTTCTTCAAGCCACTGGCGTGCTATGTGGCCACCACTCCTAG
TGGACTCAACTTTGATAATTACCTAGAGAACTATTGCTGGGTTCATGGCA
CGATATCGATTCTCCCCGGGGAGAAGTTGCCACAGAATGACGACGAATGG
GCCATTGCCGACAATGATAGAAGAATAACTTACTATCAATGGGTGCCATT
CATCCTCGGGCTCCAGTGCATCATGTTCTATATTCCGAGGATCATCTGGC
AGCTGATCTGCTACAACAAGACCGGCACTGACCTCGAATTCCTCATCAAT
GAGGCCAGCAAGGCCGCCAATAGTGCTCCGGAAGACCGAAAGGGCATCGT
CGATAAGATGGCGAGAACTATCGAGGACATGCTGTTCCAGCACCGGGATT
ATCGGCAAGGAAAGATGGCGGACATCCGCAGGAGAATGTACAAGATGTGC
AACTTCTGCGTCTTTTCCAAGCACATGGGCACCTGGCTCGTTTTATGCTA
CTTCATCATGAAGTGCCTCTATTGTGTCAATGTGTTTGGGCAACTACTCA
TCATGAAGAAGTTCCTCGGCTTCAATGAGTCCATTACCGCTTTTGGGTAC
ACGGTTCTCAACAATATGGTCAACGGACAGCACTGGCACCAGACTGGGAT
ATTCCCCAGAGTGACGTACTGCTACTTGGGCGAGATCCGCCATCTCGGGG
CCAGCAATAAGTACGTGGCCCAGTGCGCACTGCCTATCAATATGCTCAAC
GAGAAGATATATGTCTTCCTCTGGTTCTGGGTGTTCCTTGTGGGCGTCAT
AACCGCCATCAGCATCCCAGTTTGGTTCCTCCGGATCGCACTTCTATCCA
ATCGAAGTCACTTCGTGAAGAAGTTCCTCCTCATGAAGGACAAGTACACT
AGGTCCGACAAGCAGTCTCTTGATCACTTCATTAGCGAGTTCCTTCGGCA
CGACGGAGTGTTCCTAATCAGGATGATCTTCATTAATGCCGGCGATCTGA
TCACGTCAGACATTGTGAGACGTCTCTGGGAGATCTACATCGACCAGTAC
AAGCACATCGACTTCAGGAACTTCTCCCACTATGGGAAGCCGGACGATGT
TGGTACCGCTATACGACGGAGTGGCAGGCAACCGGACTCCAACGAGTCCA
TTGAGAAAGAGCCCATAGAACACTTTGTGTGAGACAATGCCATTAGTGAT
TCATCGTACTTTAAAGTGCTCAAATTATTGACTATGAATTTATTATGATT
GATTTACTAAAATTACGAAGATTTGTATTTTTATAATTACATTCTATTG

Design Primers for Pgr_021595

back to top

protein sequence

>Pgr_021595-protein ID=Pgr_021595-protein|Name=Pgr_021595|organism=Phagocata gracilis|type=polypeptide|length=440bp
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
back to top

coding sequence

>Pgr_021595.113.1432 ID=Pgr_021595.113.1432|Name=Pgr_021595.113.1432|organism=Phagocata gracilis|type=CDS|length=1320bp
ATGGTCGCGGAAGAATTCATCGGACTCGTCGACAAATTGAAGCTGTCGAA
ATATGTCGGCGTGGAGGACTTCGCCGACAAACTTAGCTTCTTGTTCAGTG
TCCTGTTCCTGTCAGTGTCGATCATGGTTGTCACCATCAAGTCGTACTTC
TTCAAGCCACTGGCGTGCTATGTGGCCACCACTCCTAGTGGACTCAACTT
TGATAATTACCTAGAGAACTATTGCTGGGTTCATGGCACGATATCGATTC
TCCCCGGGGAGAAGTTGCCACAGAATGACGACGAATGGGCCATTGCCGAC
AATGATAGAAGAATAACTTACTATCAATGGGTGCCATTCATCCTCGGGCT
CCAGTGCATCATGTTCTATATTCCGAGGATCATCTGGCAGCTGATCTGCT
ACAACAAGACCGGCACTGACCTCGAATTCCTCATCAATGAGGCCAGCAAG
GCCGCCAATAGTGCTCCGGAAGACCGAAAGGGCATCGTCGATAAGATGGC
GAGAACTATCGAGGACATGCTGTTCCAGCACCGGGATTATCGGCAAGGAA
AGATGGCGGACATCCGCAGGAGAATGTACAAGATGTGCAACTTCTGCGTC
TTTTCCAAGCACATGGGCACCTGGCTCGTTTTATGCTACTTCATCATGAA
GTGCCTCTATTGTGTCAATGTGTTTGGGCAACTACTCATCATGAAGAAGT
TCCTCGGCTTCAATGAGTCCATTACCGCTTTTGGGTACACGGTTCTCAAC
AATATGGTCAACGGACAGCACTGGCACCAGACTGGGATATTCCCCAGAGT
GACGTACTGCTACTTGGGCGAGATCCGCCATCTCGGGGCCAGCAATAAGT
ACGTGGCCCAGTGCGCACTGCCTATCAATATGCTCAACGAGAAGATATAT
GTCTTCCTCTGGTTCTGGGTGTTCCTTGTGGGCGTCATAACCGCCATCAG
CATCCCAGTTTGGTTCCTCCGGATCGCACTTCTATCCAATCGAAGTCACT
TCGTGAAGAAGTTCCTCCTCATGAAGGACAAGTACACTAGGTCCGACAAG
CAGTCTCTTGATCACTTCATTAGCGAGTTCCTTCGGCACGACGGAGTGTT
CCTAATCAGGATGATCTTCATTAATGCCGGCGATCTGATCACGTCAGACA
TTGTGAGACGTCTCTGGGAGATCTACATCGACCAGTACAAGCACATCGAC
TTCAGGAACTTCTCCCACTATGGGAAGCCGGACGATGTTGGTACCGCTAT
ACGACGGAGTGGCAGGCAACCGGACTCCAACGAGTCCATTGAGAAAGAGC
CCATAGAACACTTTGTGTGA
back to top
Gene Groups
Pgr_021595 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.