Pgr_019273, Pgr_019273 (mRNA) Phagocata gracilis

Overview
NamePgr_019273
Unique NamePgr_019273
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1657
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_019273 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 308/433 (71.13%), Postives = 371/433 (85.68%), Query Frame = 2
Query:  248 MVAEEFLNLVGQFKLSTYVGVEDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADD-KRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDFRNFSGYSKPINIGNALKKGVTINDSNVSIAKE 1543
            MVAEEFLNL+GQFK+STYVG+EDFADKLSFLFSV  ++LS+MVVTIKSY FKPLACY AT P G NF+NYLENYCWVHGTI  LPGE IPQ    W+ ADD +RI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK+GT+LE ++NDA+ A+N+ P ERK  +ER+AR IEDMLFQHRDYRQG  A LRRKVY +CNFCVFSKH+GTWL+LSY++IKFLY LNVIGQLFIMKKFLGFN +T SFGY VL+N+++G+EWHQTGIFPRVTYCY+  I+H+G +NKYVAQCALP+NMLNEKIYVFLWFW++LVG+ T ISIP WF R+AFL  RS FIK+FL M  NYER+DKP++N+FI EFLRHDGVFL+RM++INAGD+IT+DIV RL EIYK+ Y+++DFRN++ Y+K ++    L +   ++ S+ SI KE
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKE 433          
BLAST of Pgr_019273 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 264/434 (60.83%), Postives = 341/434 (78.57%), Query Frame = 2
Query:  248 MVAEEFLNLVGQFKLSTYVGVEDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD-DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDFRNFSGYSKPI-------NIGNALKKGVTINDSN 1525
            MVA+EFL+L+ QFKLS+Y G+EDFAD+L+F+FSVV + LS+++VT K+YFFKPL+CY+AT PSG+NFD Y+ENYCWVHGTI  L  E+IP  P+ W++ D DKRITYYQWVPFILGLQCI+FYIP+++W++ICYNK GT+LE LI  A+ +S   P ERK  +  + R+IED+L+QHRDYRQGKMA  RR++Y  CNFCVFSKHLGTWLV +Y  IK LY +NVIGQL++MK FLGFN S  SFGY +LN+I++G+ WH+T  FPRV+YCY  +I+HLGA N YVAQC LP+NMLNEKIY+FLWFWVLLVG+ T++SI  W +RI FL  RS F KK L M  +Y+R++   +NHFI+E+LR+DG+FLIRM+YIN+GD++ ++I+  LWE YK++Y N DF N++ Y K I       +  N LK     NDSN
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLK-----NDSN 429          
BLAST of Pgr_019273 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 396.741 bits (1018), Expect = 3.640e-132
Identity = 201/405 (49.63%), Postives = 291/405 (71.85%), Query Frame = 2
Query:  248 MVAEEFLNLVGQFKLSTYVGVEDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNE-STISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP--LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDFRN 1453
            MVA EFL+ + + ++ST VG+ED  D+L+F FSV+ +++ +++VT+K Y FKP++CY+  N  G N  +Y+EN CWV GTIAL    K P T + W   +  ++ YYQWVPF+LGLQCIMFY+P+++WQ+ICYN+TGTD++ L+  A++A +SS E R   V  L++ +E +L+QHRD+R GK+A  RRK++ S  F + SK +GTWLV SY+++K  Y  N   QL IM+KFLGF++ + ++FG +V NNI +G +W  T IFPRV+YC++ ++ HLG  N  VAQC LP+NMLNE+IY FLW W+L+V   T++SIP W +RI  +K R HFI++FL +S+   +  K   L+  F  +FLRHDG+FL++M+ +NAGD+ITS+IV +LW IYK  Y N +F N
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLN 404          
BLAST of Pgr_019273 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 385.185 bits (988), Expect = 2.005e-127
Identity = 208/437 (47.60%), Postives = 288/437 (65.90%), Query Frame = 2
Query:  248 MVAEEFLNLVGQFKLSTYVGVEDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTD--KPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDFRNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL 1552
            MVA +F++ + +F++S Y GVEDFADK +FLF+V+ +L+   +VT+K Y  KP++CYI+T  SG N   Y+ENYCWV GTI +    KIP T + W+  +  +I YYQWVPF+L LQ IMFYIPR+IWQ+ CYN TGTD+  LI  A++A +SS E R   V  +A+ IE ML+QHRD R G++A  RR +Y  C FC+ SK  GT L+  Y IIKFLY  N I QL+ MK FLG NE+ I FG+ ++ NI+NG++W  T +FPRV YCY+  ++++G +N  VAQC LP+NMLNEKI+ FLW W+    +   ISI  W  R +  + R  FI +FL ++   +  D  K ++  F  +FLR+DGVFL++M+ +NAGD++ +DIV +LW+I+K QY N +F +  G     N G  L +    N S  S  K N L
Sbjct:    1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYIST-ISGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAELNKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYANRNFLS-DGSDDDENHGRTLIRLDNNNHSKPSFDKSNSL 434          
BLAST of Pgr_019273 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 382.874 bits (982), Expect = 6.953e-127
Identity = 197/402 (49.00%), Postives = 271/402 (67.41%), Query Frame = 2
Query:  248 MVAEEFLNLVGQFKLSTYVGVEDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGW-SLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDFR 1450
            MVA EF +L+ +       G+ED ADK+S +FSV+ + + + +VTIKSY  KP++CY++  PSG NF +Y+ENYCW+HGTI L P +K+     GW  L   ++I YYQWVPFILGLQCIMFYIP++IWQ+ C+N+ GT+L+ +I  + K +     ER+   E +A++IE+ML  HRD+R  K+A++RR VY  C+  + SK LGT +V SY + K LY  N IGQLF+++  LGF     +FG  +   I++G E      FPRV +CY+  IRH+G  N YVAQC LP+NMLNEKIY FLW W+LLV   T ISIP W  R+     R H+I  FL M ++Y+   KPL++ FI +FLRHDG+FL+RM+  NAGDLI + +V  LW+IY  +Y+N + R
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLR 402          
BLAST of Pgr_019273 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 201.06 bits (510), Expect = 6.854e-57
Identity = 129/376 (34.31%), Postives = 213/376 (56.65%), Query Frame = 2
Query:  311 EDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIA---TNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRS-HFIKKFLAMSDNYERTDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKD 1426
            +D  DKL++ ++   I +  ++V+ K Y   P+ C++    T P     + Y ENYCWV  T  L   + IP     ++  ++++I YYQWVPF+L L+ ++FY+P I+W+L+ + ++G  ++ L+  A  +     E R   ++ +A  +E+ L        G    L        N  + ++  G  +   Y+ +K LY +N++GQ+F++  FLG N S   +G  VLN+++NGREW ++G FPRVT C   E++ LG  +++  QC L INM NEKI++FLWFW  L+   T+ S+  W + I+ + SR  +F+ K+L   + Y+  D   +  F+  FLR DGVFL+RM+  +AG+L   ++ K LW  Y D
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEP----MEQYTENYCWVQNTYFLPLHDYIPH---NYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKL-------LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG-NRSK-WYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYW-IYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCD 377          
BLAST of Pgr_019273 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 200.675 bits (509), Expect = 1.702e-55
Identity = 129/380 (33.95%), Postives = 217/380 (57.11%), Query Frame = 2
Query:  311 EDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRS-HFIKKFLAMSDNYER---TDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRN 1438
            +DF DKL++ ++   +    ++V+ K Y   P+ C++    +    + Y ENYCWV  T  +   E IP+         +++I YYQWVPFIL ++ ++FY+P I+W+ + Y  +G +L+GL+  A  A     E +  TV  +AR ++D +      RQG        +    N C   +H G ++ + Y+ IK LY  NV+ Q F++   LG N+  +++G+ +L ++++  EW QTG+FPRVT C   E+R LG  +++  QC L INM NEKI++FLWFW L  G+ TV +   W + I F+ S+   F++K+L +  ++      D   +  F   FLR DGVF++RM+  +AG+L++S+++  LW+ + +  R+
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTD-AMEQYTENYCWVQNTYWVPMQEDIPREIYS---RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWIL-IMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRS 507          
BLAST of Pgr_019273 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 180.644 bits (457), Expect = 7.595e-49
Identity = 126/407 (30.96%), Postives = 213/407 (52.33%), Query Frame = 2
Query:  380 TIKSYFFKPLACYIATNP-SGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASN-SSPEERKGTVERLA-RMIEDMLFQHRDYR---QGKMADLRRKVYGSCNFCVFSKHL-GTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKF--LAMSDNYERTDK------------------PLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYK----------DQYRNIDFRNFSGYSKPINIGN 1489
            + K Y   P+ C++  NP S  + + Y+E+YCW+  T  +   E +P   D  +  ++K+I YYQWVPFIL  + +MF +P I W+L C  ++G +++ LIN A  A       +R+  VE +    ++++  Q  + R   +G +A ++           FS+ L G  + + Y   K LY +NV+ Q FI+   L  +E  + FG+ VL++I  GR W +TG FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W +++ + T  S   W         +  ++ KF  +A S  Y++  K                   L++ F+ +FL+ DG+ ++RM+  +AGD+I   +V+ LW+ Y+          ++ ++++ R   G  + I I N
Sbjct:   44 SAKQYGGTPIECWV--NPHSRESMEEYIESYCWIQNTYWIPMYENVP---DDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSE-FVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEEHEEMKDVEMRRIQGTRERIVIAN 431          
BLAST of Pgr_019273 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 176.022 bits (445), Expect = 4.157e-47
Identity = 118/387 (30.49%), Postives = 202/387 (52.20%), Query Frame = 2
Query:  311 EDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLG--TWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSD-------NYERTDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNID 1444
            +D++D+L++L +   +L   ++++ K +  +P+ C       G +++ Y ENYCW   T  + P + +           D++++YYQWVPF L LQ   F  P  +W+    N +G  +  ++  A  ++N   E R+  +  L R +   L       Q  M   + +V+ +  F  F    G  +W+   Y+  K LY LNV  QL++M  FLG N     +G+ V+ +I+ G  W ++G FPR   C   E+R +    +Y  QC L IN+ NEKI+V LWFW +++ + + +S+  WF+ + F      F+K+ LA+S        N  R D  + + F+ ++L  DGVF++RM+  +AG +  +D+V+ L+E Y  Q +N D
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSAL-----RFQANMERKKVQVHKTVTFLNFQYSSGFISWI---YLFTKVLYFLNVFAQLYLMNYFLGTNRHHW-YGFGVVQDIVQGEPWERSGYFPRAAVCDF-EVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDV-SKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKD 393          
BLAST of Pgr_019273 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 174.096 bits (440), Expect = 8.791e-47
Identity = 128/396 (32.32%), Postives = 204/396 (51.52%), Query Frame = 2
Query:  272 LVGQFKLSTYVGVEDFADKXXXXXXXXXXXXXXXXXTIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRK-VYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKPLMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYR-NIDFRN 1453
            L   FK  T+   +D  D+LS++ +   +    ++V+ K Y    + C++     G  ++ Y E+YC++  T  +    +IP   +    A+   I YYQWVP +L +Q  MFY+P  IW  + Y + G D   +I++A    +   E R   V +L   I D+L            D R K  YG      F K LG+   + Y+ IK +Y  NV  Q  I+ KFLG NE T  +G+    ++  GREW  +G+FPRVT C    +R L   ++Y  QC L INM NEKIY+F+WFW + V + T I+      R++F  SR ++I+  L+   N  + +K ++  F    L+ DGV L+R +  +AG ++T +I + L++ + +  + N DF +
Sbjct:   11 LSETFKPKTF---DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE---IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDIL------------DTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG-NE-TFLWGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHH 383          
BLAST of Pgr_019273 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 88.5817 bits (218), Expect = 8.800e-19
Identity = 71/268 (26.49%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  380 TIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALL------PGEKIP----QTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 1144
            T + Y   P+ C    +      ++ L  YCW+H T  ++       G ++P        G      K   YYQWV F L  Q I+FY PR +W+    +  G  +  LI D      S  E+++     L  + E++ + +                              W    Y + + L  +NVIGQ+F+M +F  F+   I+FG  V++ +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   31 TTRQYVGNPIDCVHTRDIP----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 258          
BLAST of Pgr_019273 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 88.9669 bits (219), Expect = 9.908e-19
Identity = 71/268 (26.49%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  380 TIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALL------PGEKIP----QTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 1144
            T + Y   P+ C    +      ++ L  YCW+H T  ++       G ++P        G      K   YYQWV F L  Q I+FY PR +W+    +  G  +  LI D      S  E+++     L  + E++ + +                              W    Y + + L  +NVIGQ+F+M +F  F+   I+FG  V++ +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   47 TTRQYVGNPIDCVHTRDIP----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Pgr_019273 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 88.9669 bits (219), Expect = 9.908e-19
Identity = 71/268 (26.49%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  380 TIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALL------PGEKIP----QTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 1144
            T + Y   P+ C    +      ++ L  YCW+H T  ++       G ++P        G      K   YYQWV F L  Q I+FY PR +W+    +  G  +  LI D      S  E+++     L  + E++ + +                              W    Y + + L  +NVIGQ+F+M +F  F+   I+FG  V++ +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   47 TTRQYVGNPIDCVHTRDIP----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Pgr_019273 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 88.9669 bits (219), Expect = 9.908e-19
Identity = 71/268 (26.49%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  380 TIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALL------PGEKIP----QTPDGWSLADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 1144
            T + Y   P+ C    +      ++ L  YCW+H T  ++       G ++P        G      K   YYQWV F L  Q I+FY PR +W+    +  G  +  LI D      S  E+++     L  + E++ + +                              W    Y + + L  +NVIGQ+F+M +F  F+   I+FG  V++ +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   47 TTRQYVGNPIDCVHTRDIP----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Pgr_019273 vs. RefSeq Drosophila melanogaster
Match: gi|24643568|ref|NP_728361.1| (shaking B, isoform A [Drosophila melanogaster])

HSP 1 Score: 87.8113 bits (216), Expect = 2.250e-18
Identity = 74/267 (27.72%), Postives = 112/267 (41.95%), Query Frame = 2
Query:  380 TIKSYFFKPLACYIATNPSGLNFDNYLENYCWVHGTIALLP------GEKIPQTPDGWS---LADDKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKASNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVFSKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNNILNGREWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 1144
            T + Y   P+ C    +      ++ L  YCW+  T  L        G  +P    G S    AD K   YYQWV F L  Q I+FY PR +W+    +  G  +  LI D      S  E+++     L  + E++ + +                              W    Y + + L  +NVIGQ+F+M +F  F+   I+FG  V++ +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   43 TTRQYVGNPIDCVHTKDIP----EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 269          
The following BLAST results are available for this feature:
BLAST of Pgr_019273 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pgr_019273 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008370.000e+071.13Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006570.000e+060.83Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150364823.640e-13249.63dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150331262.005e-12747.60SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150281816.953e-12749.00SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
back to top
BLAST of Pgr_019273 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL6.854e-5734.31RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.702e-5533.95RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR7.595e-4930.96RecName: Full=Innexin-19[more]
gi|10720052|sp|Q23157|INX11_CAEEL4.157e-4730.49RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
gi|12643734|sp|Q19746|INX3_CAEEL8.791e-4732.32RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of Pgr_019273 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24643566|ref|NP_523425.2|8.800e-1926.49shaking B, isoform C [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|9.908e-1926.49shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|9.908e-1926.49shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|9.908e-1926.49shaking B, isoform I [Drosophila melanogaster][more]
gi|24643568|ref|NP_728361.1|2.250e-1827.72shaking B, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_019273 ID=Pgr_019273|Name=Pgr_019273|organism=Phagocata gracilis|type=mRNA|length=1657bp
GGAATATCGATATTCGGATCATGATACTGGAATATCCAATGACAAACATA
ATAATCATGTCATAAGATAATCATAGGAAATGATTGTGAAATTATGACCA
ATATTCAACCATCTTGGTTTATTTACCGTAGACGTACATAAATCCGTTGT
ATACGTTATGAACTATCGAATGTTTATATAGCCTAATTTTGCTACATCAT
GTCATTAAATTAAAAAAAAATCATTTTATTTGTAAAATATATCAATTATG
GTAGCCGAGGAGTTTCTGAATTTAGTTGGTCAATTCAAGCTTTCCACTTA
TGTTGGAGTTGAGGACTTTGCGGACAAGCTCAGCTTCCTATTCAGTGTCG
TGTTCATACTACTATCTTTGATGGTGGTCACCATAAAGTCGTATTTCTTC
AAGCCGCTCGCTTGCTACATAGCCACTAATCCCAGTGGTCTCAACTTTGA
TAACTATCTGGAGAATTATTGTTGGGTCCATGGCACCATTGCTCTTCTGC
CGGGTGAGAAGATCCCACAGACACCTGATGGCTGGTCATTGGCCGACGAT
AAGAGAATAACATACTATCAATGGGTGCCGTTTATTCTTGGTCTACAATG
CATCATGTTCTACATCCCAAGAATCATATGGCAACTAATCTGCTACAACA
AGACCGGGACCGACCTTGAAGGACTCATCAACGACGCCAGTAAAGCCTCC
AACAGTTCCCCTGAAGAACGTAAAGGGACTGTAGAAAGACTAGCGAGAAT
GATCGAAGATATGCTCTTTCAACATCGCGATTACCGTCAAGGGAAGATGG
CTGATCTCCGAAGAAAGGTGTATGGCTCGTGTAATTTCTGTGTATTCTCT
AAGCACCTCGGCACTTGGTTAGTTCTGTCGTATATGATCATCAAGTTTCT
TTATTGCCTCAACGTCATTGGTCAATTGTTTATAATGAAGAAATTTCTTG
GATTCAATGAGTCGACTATTTCGTTCGGATATGACGTGCTCAATAACATT
TTAAACGGCCGTGAGTGGCACCAGACAGGGATCTTCCCGCGGGTAACGTA
TTGTTACATCGGCGAGATCCGTCACCTGGGGGCCAGTAACAAGTACGTGG
CCCAATGCGCTCTACCGATTAATATGTTGAATGAGAAGATCTACGTCTTC
CTTTGGTTCTGGGTGCTCCTGGTCGGTGTGTGCACAGTGATCAGCATTCC
GACGTGGTTCATGAGAATCGCTTTCCTCAAGAGTCGCAGTCACTTTATCA
AGAAGTTCCTGGCAATGTCTGACAACTATGAGCGAACTGACAAGCCCCTT
ATGAACCATTTCATCCGAGAGTTCTTGCGTCACGACGGAGTGTTCCTGAT
CCGGATGATGTACATCAATGCCGGTGATCTGATCACGTCTGACATAGTGA
AAAGACTCTGGGAGATATATAAGGACCAATACAGAAATATCGATTTTAGG
AACTTCAGCGGATACTCGAAACCTATCAATATCGGTAATGCCTTAAAGAA
GGGAGTGACCATTAACGATTCCAATGTATCCATTGCCAAGGAGAATTTTC
TTTGAATATAGTCAGAACAACCAAAATAACAATTATTGATTATAATTAAG
CATTTTAATTTATATGCCAATTTTCATGCCGTGAATATATTTTCAGTAGA
AAAAAAA

Design Primers for Pgr_019273

back to top

protein sequence

>Pgr_019273-protein ID=Pgr_019273-protein|Name=Pgr_019273|organism=Phagocata gracilis|type=polypeptide|length=436bp
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
back to top

coding sequence

>Pgr_019273.248.1555 ID=Pgr_019273.248.1555|Name=Pgr_019273.248.1555|organism=Phagocata gracilis|type=CDS|length=1308bp
ATGGTAGCCGAGGAGTTTCTGAATTTAGTTGGTCAATTCAAGCTTTCCAC
TTATGTTGGAGTTGAGGACTTTGCGGACAAGCTCAGCTTCCTATTCAGTG
TCGTGTTCATACTACTATCTTTGATGGTGGTCACCATAAAGTCGTATTTC
TTCAAGCCGCTCGCTTGCTACATAGCCACTAATCCCAGTGGTCTCAACTT
TGATAACTATCTGGAGAATTATTGTTGGGTCCATGGCACCATTGCTCTTC
TGCCGGGTGAGAAGATCCCACAGACACCTGATGGCTGGTCATTGGCCGAC
GATAAGAGAATAACATACTATCAATGGGTGCCGTTTATTCTTGGTCTACA
ATGCATCATGTTCTACATCCCAAGAATCATATGGCAACTAATCTGCTACA
ACAAGACCGGGACCGACCTTGAAGGACTCATCAACGACGCCAGTAAAGCC
TCCAACAGTTCCCCTGAAGAACGTAAAGGGACTGTAGAAAGACTAGCGAG
AATGATCGAAGATATGCTCTTTCAACATCGCGATTACCGTCAAGGGAAGA
TGGCTGATCTCCGAAGAAAGGTGTATGGCTCGTGTAATTTCTGTGTATTC
TCTAAGCACCTCGGCACTTGGTTAGTTCTGTCGTATATGATCATCAAGTT
TCTTTATTGCCTCAACGTCATTGGTCAATTGTTTATAATGAAGAAATTTC
TTGGATTCAATGAGTCGACTATTTCGTTCGGATATGACGTGCTCAATAAC
ATTTTAAACGGCCGTGAGTGGCACCAGACAGGGATCTTCCCGCGGGTAAC
GTATTGTTACATCGGCGAGATCCGTCACCTGGGGGCCAGTAACAAGTACG
TGGCCCAATGCGCTCTACCGATTAATATGTTGAATGAGAAGATCTACGTC
TTCCTTTGGTTCTGGGTGCTCCTGGTCGGTGTGTGCACAGTGATCAGCAT
TCCGACGTGGTTCATGAGAATCGCTTTCCTCAAGAGTCGCAGTCACTTTA
TCAAGAAGTTCCTGGCAATGTCTGACAACTATGAGCGAACTGACAAGCCC
CTTATGAACCATTTCATCCGAGAGTTCTTGCGTCACGACGGAGTGTTCCT
GATCCGGATGATGTACATCAATGCCGGTGATCTGATCACGTCTGACATAG
TGAAAAGACTCTGGGAGATATATAAGGACCAATACAGAAATATCGATTTT
AGGAACTTCAGCGGATACTCGAAACCTATCAATATCGGTAATGCCTTAAA
GAAGGGAGTGACCATTAACGATTCCAATGTATCCATTGCCAAGGAGAATT
TTCTTTGA
back to top
Gene Groups
Pgr_019273 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.