Pgr_018247, Pgr_018247 (mRNA) Phagocata gracilis

Overview
NamePgr_018247
Unique NamePgr_018247
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2088
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_018247 vs. RefSeq Human
Match: gi|24431985|ref|NP_060538.2| (piwi-like protein 2 [Homo sapiens])

HSP 1 Score: 228.024 bits (580), Expect = 1.411e-62
Identity = 171/648 (26.39%), Postives = 306/648 (47.22%), Query Frame = 2
Query:  107 FEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVL----KIYNRNN-------IDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGE-RTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEV-MSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFN--YKNFIQDVEFELKNM--RINARIGQRMNCGP------NDIEKCLTDVARAGSNAAKIALVFV----PDDRTYARVKAFT-IQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNN----PNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKV 1948
             + +  ++  G+A +++R    +G +  L  +   ++V+  + VL     IY +N           ++G  +IT+YNN+TYRI D+    + ++ F + + + +T+ EY+ + Y I++++ +QP +I R              E            L +P EL F+ G  ++ K +    K L   +   P++    +    + + K EA++  + +W LR+     +IEGR LP   + + N   I  +          + N   +   +  ++ +  + +   Y     D   EL NM  +I   IG RM+         + IE  +  +        KI +V      P D  Y  +K    +Q+ + +Q V  R  T     R + V+ K ++Q+  K G + W V++ L+  M++GMD YH+ S   +S+   V SIN T T++ S V      QE  ++L      +L  F      LP++I++YRDGV D QL+   N+E+    P +++ ++   +  P++V  +V+K++ T L+         P PGT+VD  I    + +F+L++    +G   PT+Y  + +T  LS         P+ +Q++T+ L H+Y+NW GTIRVP P  YAH+LA L G +
Sbjct:  352 LQQHRLQIWPGYAASIRR---TDGGLFLLADVS--HKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEI-----------LLLP-ELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQ----------ELNWVKEVTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVR--TIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEI----PQLQKCFEAFENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLS---------PDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHI 957          
BLAST of Pgr_018247 vs. RefSeq Human
Match: gi|209180418|ref|NP_001129193.1| (piwi-like protein 2 [Homo sapiens])

HSP 1 Score: 228.024 bits (580), Expect = 1.411e-62
Identity = 171/648 (26.39%), Postives = 306/648 (47.22%), Query Frame = 2
Query:  107 FEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVL----KIYNRNN-------IDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGE-RTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEV-MSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFN--YKNFIQDVEFELKNM--RINARIGQRMNCGP------NDIEKCLTDVARAGSNAAKIALVFV----PDDRTYARVKAFT-IQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNN----PNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKV 1948
             + +  ++  G+A +++R    +G +  L  +   ++V+  + VL     IY +N           ++G  +IT+YNN+TYRI D+    + ++ F + + + +T+ EY+ + Y I++++ +QP +I R              E            L +P EL F+ G  ++ K +    K L   +   P++    +    + + K EA++  + +W LR+     +IEGR LP   + + N   I  +          + N   +   +  ++ +  + +   Y     D   EL NM  +I   IG RM+         + IE  +  +        KI +V      P D  Y  +K    +Q+ + +Q V  R  T     R + V+ K ++Q+  K G + W V++ L+  M++GMD YH+ S   +S+   V SIN T T++ S V      QE  ++L      +L  F      LP++I++YRDGV D QL+   N+E+    P +++ ++   +  P++V  +V+K++ T L+         P PGT+VD  I    + +F+L++    +G   PT+Y  + +T  LS         P+ +Q++T+ L H+Y+NW GTIRVP P  YAH+LA L G +
Sbjct:  352 LQQHRLQIWPGYAASIRR---TDGGLFLLADVS--HKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEI-----------LLLP-ELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQ----------ELNWVKEVTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVR--TIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEI----PQLQKCFEAFENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLS---------PDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHI 957          
BLAST of Pgr_018247 vs. RefSeq Human
Match: gi|364023796|ref|NP_001242904.1| (piwi-like protein 3 isoform 2 [Homo sapiens])

HSP 1 Score: 225.328 bits (573), Expect = 7.659e-62
Identity = 166/596 (27.85%), Postives = 288/596 (48.32%), Query Frame = 2
Query:  266 DQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERT-LTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXEXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRND----FNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDD--RTYARVKAF-TIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRG----NNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGTNPPIINERIRNRLFYL 2008
            +++IG  ++TKYNNKTYR+ D+  + + E+ F   + + +TY +Y+++++   +   +QP ++++ +        +             +  L IP +LC + G +D+   +  + K L    +  PR R   +  +   +   +    L++ WDL+ D   L + GR L    ++   + +      DW     +  + N       +I+  R+      + K  +Q V      M I  +  + +     D    +  + +      ++ +  +P+D  R Y  +K +   +  + +QCV  +  T +  + R +V+ K   Q+  K G   W VE  ++ TM VG+D +H+  + +KSI   V S N+  T++ S     K  +E  + L      AL  +      +P  +++YRDGVGD QLQ   + E   M   ++ I  N  +    L +I+VKKR+ T+ F +      NP PGT++D E+ +  +Y+FF+VSQ    GT TPT+YNV+ DT  LS         P+ +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ +H+       N  +  RLFYL
Sbjct:  316 NKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQR------------EPILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVT---APMGITMKPAEMIEVD-GDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKK--TLEKVQARTIVT-KIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFT----LAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLS---------PDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQEP-----NRSLSTRLFYL 873          
BLAST of Pgr_018247 vs. RefSeq Human
Match: gi|767975980|ref|XP_011537308.1| (PREDICTED: piwi-like protein 1 isoform X1 [Homo sapiens])

HSP 1 Score: 216.083 bits (549), Expect = 7.489e-61
Identity = 149/503 (29.62%), Postives = 248/503 (49.30%), Query Frame = 2
Query:  551 ELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRI--NERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCG-----PNDIEKCLTDVARAGSNAAKIALVFVPDDRT--YARVKAF-TIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSL-PQLVYIIVKKRVGTKLF----NRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGTNPPIINERIRNRLFYL 2008
            ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++++K +     ++ W L  D+  L   GR L   ++    +    N +  D  K  R    I         +I   RN     + IQ++       ++   +G +M         +  E  L  + +  +   +I +  +  +R   Y  +K +        +QCV  R  T    +    +++K  +Q+  K G + W V++ L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  + +  + +P RI++YRDGVGD QL+   N+EV    P   +  K++G    P+L  I+VKKRV T+ F     R  NP PGT++D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N       + NRL+YL
Sbjct:    5 ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNL------FKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEV----PQFLDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGLK---------PDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 481          
BLAST of Pgr_018247 vs. RefSeq Human
Match: gi|153792298|ref|NP_001008496.2| (piwi-like protein 3 isoform 1 [Homo sapiens])

HSP 1 Score: 221.476 bits (563), Expect = 1.933e-60
Identity = 167/601 (27.79%), Postives = 288/601 (47.92%), Query Frame = 2
Query:  266 DQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERT-LTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXEXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRND----FNYKNFIQDVEFELKNMRINAR---IGQRMNCGPNDIEKCLTDVARAGSNAAKI--ALVFVPDD--RTYARVKAF-TIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRG----NNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGTNPPIINERIRNRLFYL 2008
            +++IG  ++TKYNNKTYR+ D+  + + E+ F   + + +TY +Y+++++   +   +QP ++++ +        +             +  L IP +LC + G +D+   +  + K L    +  PR R   +  +   +   +    L++ WDL+ D   L + GR L    ++   + +      DW     +  + N       +I+  R+      + K  +Q V   +      A    +    N   + + K      + G +   +   +  +P+D  R Y  +K +   +  + +QCV  +  T +  + R +V+ K   Q+  K G   W VE  ++ TM VG+D +H+  + +KSI   V S N+  T++ S     K  +E  + L      AL  +      +P  +++YRDGVGD QLQ   + E   M   ++ I  N  +    L +I+VKKR+ T+ F +      NP PGT++D E+ +  +Y+FF+VSQ    GT TPT+YNV+ DT  LS         P+ +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ +H+       N  +  RLFYL
Sbjct:  316 NKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQR------------EPILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKK--TLEKVQARTIVT-KIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFT----LAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLS---------PDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQEP-----NRSLSTRLFYL 882          
BLAST of Pgr_018247 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 526/679 (77.47%), Postives = 600/679 (88.37%), Query Frame = 2
Query:    2 NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKYNNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXX---------XXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL* 2011
            NNLQVMLGQERIGK YFLS NITK EV +N+GPT+FE N+FKVLGGF TTLQRGT   G +TTLLYIERINRVLN+NSV+K YNR +IDQ+IGRDIITKYNNKTYRIS++KEM+++EKFE+G RTL+YAEYFKERYNI L Q +QPFV+TRVK+               +++ +E    APEE D++LNIPGELCFLCGFSDQEKSN+DLQK+LG VLKREPRERL+DIP YC W+   +A++ +  +W L+IDNKPLEIEGRELP  +V+S   +INE++ DDWKFGRVQF+I+ DR HEIDV++VDRNDF YKNF+ DVE EL+NMRI+AR+G+   CGPND+E+CL D AR+GS  AK+ALVFVPDDR YA+VK+FT+ TGLLTQCVTTRNGTN+NDKRRKVVSSKTVMQ+F+KFGYDPWTVE+KLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN+PKGRQEFHETLGKNF LAL DFK RYDILPQRI+++RDGVGD+QLQFTKNFEVDAMKP++E IYK  G  +PQ++Y+IVKKRVGTKLFNRGNNPNPGT+VDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLL+KK TMDPM PNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL*
Sbjct:  159 NNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          
BLAST of Pgr_018247 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 389/671 (57.97%), Postives = 522/671 (77.79%), Query Frame = 2
Query:    2 NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKYNNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKAT-MDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL* 2011
            NN+Q+ +GQE+IG+ +FL +N     + +  GP++F+M+NFK+LGG++TT+ RGT   G  +TLLY+ERINRVLNEN+V+ +Y R+ IDQ+IGRDIITKYNNKTYRISD+KEM + ++ +LG++ ++Y  YFK+RYNI+L+  +QPFVI+RVKR + RP  K   E   P     D SL+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL DI  +C+W   G++   + K W + I+ +P+ I GREL  V++ SN  +IN +IPDDWKFG ++F++    AH   V+VVDRN  ++ NFI+DV+ E+  +RIN  +    +C  N++E  LTD  R   +   +ALVF+PDD+ YA+VK FT+ TGLLTQCVT RNG+N++D+RRK V+ K+VMQ+FSK GYDPW + LK+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN+ KG+ EFHE LGKNF  AL  F+N+++ +P R++IYRDGVGDSQL FTK FE DA+  M+E+IY+N   +LPQ++Y++VKKR+  K F  G NPNPGT+VD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+  +KK   +  M P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  PP IN+RIR RLFYL*
Sbjct:  191 NNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTET--DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV--SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYEN--QTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          
BLAST of Pgr_018247 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 215.698 bits (548), Expect = 3.897e-59
Identity = 164/601 (27.29%), Postives = 289/601 (48.09%), Query Frame = 2
Query:  263 IDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGREL-PAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQ----RMNCGPND-IEKCLTDVAR---AGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLF-----NRG--NNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL* 2011
            I+Q++G+ ++T +NN+ YRI+D+    +   +F+ G   ++Y +YFK  Y + ++  EQP ++++      +    +G +          +   IP ELC L G +D    +  L + L    +  P++R E +  + + +   E +  L+  W + I+   + I   ++ P +    N   ++     ++K       +      E  +++  ++     N +       K+ R+    G+     MN   ND  E+ L ++ R    G       L  V +DR  A  K   +   + +Q V  +  T K   +   V+    +Q+ +K G + W V++ ++  M+VG+D +H+ K   +S+ A V S N+  T++ S  +  +  +E    L       L  +    + LP+ I +YRDGV D QL + +  E++    + E    +     P +VY +V+KR+ T+L+     N+G  NNPNPGTIVD  + + N Y+FFLVSQ   +GT TPT+Y VL D    +         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+  K     ++ +    RLFYL*
Sbjct:  403 INQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNRGPKGSKEVDG-----GLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMN---NDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK---PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975          
BLAST of Pgr_018247 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 118.242 bits (295), Expect = 3.177e-27
Identity = 111/431 (25.75%), Postives = 187/431 (43.39%), Query Frame = 2
Query:  719 WDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDD--WKF-GRVQFNIRNDRAHEIDVIVVDRN--DFNYKNFIQDVEFELKNMRINARIGQRMNC----GPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAFT-IQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPT------MIVGMDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLF--------NRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 1930
            + + ++ +  +I+GR +PA ++    +   +  P    W   G+  F+    +   I      R   + + + F Q ++ ++ N      +GQ   C    G + +E     +  + +    I +V       YA VK    I  GL TQCV  +N  NK   +     S   +++  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F       P RI+ YRDGV + Q     N E+ A++   E   K   S  P + +++V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ P++Y+VL D    S          +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  466 FGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVREDSLRTFTQQLQ-KISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN-VNKPSPQ---TLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Pgr_018247 vs. Smed Unigenes AA
Match: SMU15002348 (Asxlregen_comp67380_c1_seq2|m.28664|m.41329)

HSP 1 Score: 116.701 bits (291), Expect = 8.721e-27
Identity = 112/424 (26.42%), Postives = 189/424 (44.58%), Query Frame = 2
Query:  896 DRNDFNYKNFIQDVEFELKN--MRINARI---GQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAF-TIQTGLLTQCVTTRNGTNKNDKRRKVVS---SKTVMQVFSKFGYDPWTVE-LKLRPT----MIVGMDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKN---FALALADFKNR-----YDI----LPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKL--------FNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPI---------------INERIRNRLFYL* 2011
            +R ++  +N +  +E EL    +++N +I    +      +DI+K +  +         + +V V +D  Y  VK    I+ G++TQC+   N       R+K +S      +++V +K G   W ++ ++  P     M+ G+D  H   N    KS+ A V SIN T T Y + +     +       GK+     + + D   R     YD+    LP  ++ YRDGV + Q +   N E+ A++   E+  KN     P++ YIIV+KR   +           R  N  PG ++D +I     ++F+L S    +GT+ P +Y V+ D    +          N+LQ+ TY L ++ F    +I  P P HYAH LA   G++ K     I               INE  +N++F++*
Sbjct:  578 ERREYGNENELYAIEIELPKAAIKVNVKILKDNKFCYVSNDDIKKSIEKIKED----LDLLVVVVRNDVEYKLVKDIGDIELGIVTQCICYENLC-----RQKNLSQYMGNLMLKVNAKLGGVNWEIKNIEYAPIKGLFMVFGVDVTHPSNNDGLSKSVAAVVGSINKTATIYSAVIKKQLSKD------GKDAVEIVVEMEDMVQRLIKVFYDLNQSKLPDHLIFYRDGVSEGQFEIVFNHEIAAIQYACEKFKKNYK---PKITYIIVQKRHNIRFCPITLEDSVGRCKNVLPGVVIDNDITHSREFDFYLCSHEGIQGTSKPVHYYVILDENRWNS---------NDLQEFTYFLCYVCFRCTRSISYPAPTHYAH-LAAFRGRILKDDEDNISLSSENESIGLPDISINEFHQNKMFFI* 973          
BLAST of Pgr_018247 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 525/675 (77.78%), Postives = 598/675 (88.59%), Query Frame = 2
Query:    2 NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKYNNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXX-----XXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL 2008
            NNLQVMLGQERIGK YFLS NITK EV +N+GPT+FE N+FKVLGGF TTLQRGT   G +TTLLYIERINRVLN+NSV+K YNR +IDQ+IGRDIITKYNNKTYRIS++KEM+++EKFE+G RTL+YAEYFKERYNI L Q +QPFV+TRVK+       ++      +E    APEE D++LNIPGELCFLCGFSDQEKSN+DLQK+LG VLKREPRERL+DIP YC W+   +A++ +  +W L+IDNKPLEIEGRELP  +V+S   +INE++ DDWKFGRVQF+I+ DR HEIDV++VDRNDF YKNF+ DVE EL+NMRI+AR+G+   CGPND+E+CL D AR+GS  AK+ALVFVPDDR YA+VK+FT+ TGLLTQCVTTRNGTN+NDKRRKVVSSKTVMQ+F+KFGYDPWTVE+KLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VN+PKGRQEFHETLGKNF LAL DFK RYDILPQRI+++RDGVGD+QLQFTKNFEVDAMKP++E IYK  G  +PQ++Y+IVKKRVGTKLFNRGNNPNPGT+VDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLL+KK TMDPM PNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL
Sbjct:  159 NNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of Pgr_018247 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 997.268 bits (2577), Expect = 0.000e+0
Identity = 475/669 (71.00%), Postives = 560/669 (83.71%), Query Frame = 2
Query:    2 NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKYNNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL 2008
            NNLQ+++GQE+IGK YFL +N  K  V KN GPT+FE NNFKVLGGF TTLQRGT   G +TTLLYIERINRVLN+NSVL  YNR NIDQ+IGRDI+TKYNNKTYRIS++KEM+I E FE+  RTL+YA+YFKERYNI+L   +QPFV+TRVK+  RR  RKE  E   P     D++LNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERL+DIP +C+W+     S  +  +W L+IDN PLEIEGRELP  +V+S  QRINE+I DDWKFG+VQFN++    HEIDV++VDRND  Y NF+ DVE+E+K +R +A+IG+ + C  ND+E+ L DV R+GS  AKIALVFVPDDR YA+VK+FTI TGLLTQCVTTRNGTN+NDKRR+VVSSKTVMQ+FSKFGYDPWT+++K+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF N+PKG+QEFH+TL  NF  AL +FK  Y ILP RIM+YRDGVGDSQLQFTK FEVDAMKP+VE IYK  G  +PQ++Y+IVKKR+GTKLFNRG+N NPGTIVDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR  +K   ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKG+ P +INERIRNRLFYL
Sbjct:  152 NNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDM--DLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of Pgr_018247 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 388/670 (57.91%), Postives = 521/670 (77.76%), Query Frame = 2
Query:    2 NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKYNNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKAT-MDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL 2008
            NN+Q+ +GQE+IG+ +FL +N     + +  GP++F+M+NFK+LGG++TT+ RGT   G  +TLLY+ERINRVLNEN+V+ +Y R+ IDQ+IGRDIITKYNNKTYRISD+KEM + ++ +LG++ ++Y  YFK+RYNI+L+  +QPFVI+RVKR + RP  K   E   P     D SL+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL DI  +C+W   G++   + K W + I+ +P+ I GREL  V++ SN  +IN +IPDDWKFG ++F++    AH   V+VVDRN  ++ NFI+DV+ E+  +RIN  +    +C  N++E  LTD  R   +   +ALVF+PDD+ YA+VK FT+ TGLLTQCVT RNG+N++D+RRK V+ K+VMQ+FSK GYDPW + LK+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN+ KG+ EFHE LGKNF  AL  F+N+++ +P R++IYRDGVGDSQL FTK FE DA+  M+E+IY+N   +LPQ++Y++VKKR+  K F  G NPNPGT+VD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+  +KK   +  M P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  PP IN+RIR RLFYL
Sbjct:  148 NNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTET--DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV--SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYEN--QTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of Pgr_018247 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 248.44 bits (633), Expect = 2.597e-69
Identity = 190/648 (29.32%), Postives = 307/648 (47.38%), Query Frame = 2
Query:  140 FATTLQRGTTREGAMTTLLYIERI--------NRVLNENSVLKI------------YNRNNIDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIP--DDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNM--RINARIGQRMNCG-----PNDIEKCLTDVARAGSNAAKIALVFVPDDRT--YARVKAF-TIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSL-PQLVYIIVKKRVGTKLFNRGN----NPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGTN 1963
            F     R T   G MTT+L  E          ++VL   +VL              +      +++G  I+TKYNNKTYRI D+  + +    F+ G+  +++  YFK +Y + +    Q  +++ VKR         G             ++ +P E C+L G +D+ +++ ++ K L S  +  P +R   I      +N+       +  W L  +NK L + GR LP+  ++    R  E  P   DW        +       I  + +D     Y     DV   L     +++  +G RM         +  E  L  + +  +   ++ +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VE+ LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL  +    + LP RI++YRDGVGD  LQ   ++EV    P + +  K MG    P+L  ++VKKR+ ++ F R +    NP PGT++D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:  237 FNIPQHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGG-RAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEV----PQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLK---------PDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of Pgr_018247 vs. uniprot
Match: gi|226701015|sp|A6N7Y9|PIWL1_CHICK (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 247.669 bits (631), Expect = 5.164e-69
Identity = 182/603 (30.18%), Postives = 293/603 (48.59%), Query Frame = 2
Query:  269 QMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERT-LTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVM--SNNQRINERIPDDWKFGRVQFNIRNDRAHEID--VIVVDRNDFNYKNFIQDVEFELKNM-RINARIGQRMNCGPNDIE---------KCLTDVARAGSNAAKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSL-PQLVYIIVKKRVGTKLFNRGN----NPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGTNPPIINERIRNRLFYL 2008
            ++IG  ++TKYNN+TYR+ D+  + + +  F   + + ++Y +Y+K +YN  +    QP +I++ +R                          IP ELC+L G +++ +++ ++ K L    +  P +R  +I    + + K E     ++ W L  D+  L   GR + A +++   N    N +  D  +  RV   I    A  +D  +++  R +++  N +      L+N+ ++   +G RMN     IE         + L       +N     L     D+  A  K       + +QCV  R  T    +    + +K  +Q+  K G + W+VE+ L+  MIVG+D YH+  S K+SI   V S+N   T++ S        QE  + L      AL ++      LP RI++YRDGVGD QL    N+EV    P   +  K +G    P+L  I+VKKRV T+ F +      NP PGT+VD E+ +P +Y+FF+VSQ    G   PT+YNV+ DT  L          P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + +RL+YL
Sbjct:  310 ELIGVIVLTKYNNRTYRVDDIDWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRRKRGNVTVGPVVL--------------IP-ELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIH---AKPLDNWLLIYTRRNYDAANML------LQNLFKVTPSMGIRMN-KATMIEVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEV----PQFLDCLKTVGKDYNPRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDTSKLK---------PDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLLLSDRLYYL 867          
BLAST of Pgr_018247 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 245.358 bits (625), Expect = 1.701e-69
Identity = 181/581 (31.15%), Postives = 298/581 (51.29%), Query Frame = 2
Query:  272 MIGRDIITKYNNKTYRISDMKEMSIE-EKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRI---NERIPDDW--KFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTD---------VARAGSNAAKIALVFV--PDDRTYARVKAFT-IQTGLLTQCVTTRNGTNKNDKRRKVVS--SKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSL-PQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 1945
            ++G  I+T YNNKTYRI D+   S    KF+  +  ++Y +Y+K+RYNI ++  +QP V++R      R                 D ++ I  EL    G +D  +++    +++    +  P  R+E + ++ + +   + S   +K W++ +D+  +EI  R LP  +++  NQ+I   + R   DW  +F R     +N   +   VI   RN    + F+Q       +M++N        C P  I + + D         +  A +N  +I +V +  P++  Y+ +K  T +   + +Q VT +    +  K   ++S  +K V+Q+ +K    PW V + L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N A AL  ++ ++  LP+RI+ +RDGVGD QL    N EV+ +K  ++EIYK+ G     ++ +IIV KR+ ++ F    NP PGT+VD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L+          ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  233 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGN--------------DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNP--IYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          
BLAST of Pgr_018247 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 245.358 bits (625), Expect = 3.274e-69
Identity = 181/581 (31.15%), Postives = 298/581 (51.29%), Query Frame = 2
Query:  272 MIGRDIITKYNNKTYRISDMKEMSIE-EKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRI---NERIPDDW--KFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTD---------VARAGSNAAKIALVFV--PDDRTYARVKAFT-IQTGLLTQCVTTRNGTNKNDKRRKVVS--SKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSL-PQLVYIIVKKRVGTKLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 1945
            ++G  I+T YNNKTYRI D+   S    KF+  +  ++Y +Y+K+RYNI ++  +QP V++R      R                 D ++ I  EL    G +D  +++    +++    +  P  R+E + ++ + +   + S   +K W++ +D+  +EI  R LP  +++  NQ+I   + R   DW  +F R     +N   +   VI   RN    + F+Q       +M++N        C P  I + + D         +  A +N  +I +V +  P++  Y+ +K  T +   + +Q VT +    +  K   ++S  +K V+Q+ +K    PW V + L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N A AL  ++ ++  LP+RI+ +RDGVGD QL    N EV+ +K  ++EIYK+ G     ++ +IIV KR+ ++ F    NP PGT+VD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L+          ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  304 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGN--------------DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNP--IYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          
BLAST of Pgr_018247 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 240.35 bits (612), Expect = 2.129e-67
Identity = 179/664 (26.96%), Postives = 323/664 (48.64%), Query Frame = 2
Query:   98 PTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKI-----------YNRNNIDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMR-------INARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVP---DDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGN----NPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL 2008
            P    +   +V  G+ T +      +G +  +L  +  +R+L + +VL++           Y  +    ++G  ++T+YNN+TY+I+D+  + +   +FE+     +Y EY+K+ +NI+++   QP + +  K       R+             ++   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  + E V+   A+  ++  W L + N   +I GR++   ++  +   ++     ++    V  N      H    I++     + +N+ Q     L NM+       +N      ++   + I+  +  + R  +   ++ +       DDR  A  K    +  + +Q +  +  T +ND + + V  K V+Q+  K G   WTV++  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL  ++ R   LP  I+IYRDG+GD QL    N+E+    P  E +  N      ++ YI+V+KR+ T++F+       NP PGT+VD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  +      + E +  +LFYL
Sbjct:  251 PKIIPLAKLEVWPGYVTAVDE---YKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERE-------------NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVT-NEMLKVVHLSKWIII-----HLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Pgr_018247 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 240.35 bits (612), Expect = 2.129e-67
Identity = 179/664 (26.96%), Postives = 323/664 (48.64%), Query Frame = 2
Query:   98 PTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKI-----------YNRNNIDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMR-------INARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVP---DDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGN----NPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL 2008
            P    +   +V  G+ T +      +G +  +L  +  +R+L + +VL++           Y  +    ++G  ++T+YNN+TY+I+D+  + +   +FE+     +Y EY+K+ +NI+++   QP + +  K       R+             ++   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  + E V+   A+  ++  W L + N   +I GR++   ++  +   ++     ++    V  N      H    I++     + +N+ Q     L NM+       +N      ++   + I+  +  + R  +   ++ +       DDR  A  K    +  + +Q +  +  T +ND + + V  K V+Q+  K G   WTV++  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL  ++ R   LP  I+IYRDG+GD QL    N+E+    P  E +  N      ++ YI+V+KR+ T++F+       NP PGT+VD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  +      + E +  +LFYL
Sbjct:  251 PKIIPLAKLEVWPGYVTAVDE---YKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERE-------------NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVT-NEMLKVVHLSKWIII-----HLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Pgr_018247 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 240.35 bits (612), Expect = 2.129e-67
Identity = 179/664 (26.96%), Postives = 323/664 (48.64%), Query Frame = 2
Query:   98 PTYFEMNNFKVLGGFATTLQRGTTREGAMTTLLYIERINRVLNENSVLKI-----------YNRNNIDQMIGRDIITKYNNKTYRISDMK-EMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVITXXXXXXXXXXXXXXXXXXXXXXXXXDISLNIPGELCFLCGFSDQEKSNLDLQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLEIEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDRNDFNYKNFIQDVEFELKNMR-------INARIGQRMNCGPNDIEKCLTDVARAGSNAAKIALVFVP---DDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSKTVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGVGDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNRGN----NPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSKKATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGTNPPIINERIRNRLFYL 2008
            P    +   +V  G+ T +      +G +  +L  +  +R+L + +VL++           Y  +    ++G  ++T+YNN+TY+I+D+  + +   +FE+     +Y EY+K+ +NI+++   QP + +  K       R+             ++   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  + E V+   A+  ++  W L + N   +I GR++   ++  +   ++     ++    V  N      H    I++     + +N+ Q     L NM+       +N      ++   + I+  +  + R  +   ++ +       DDR  A  K    +  + +Q +  +  T +ND + + V  K V+Q+  K G   WTV++  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL  ++ R   LP  I+IYRDG+GD QL    N+E+    P  E +  N      ++ YI+V+KR+ T++F+       NP PGT+VD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  +      + E +  +LFYL
Sbjct:  251 PKIIPLAKLEVWPGYVTAVDE---YKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERE-------------NLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVT-NEMLKVVHLSKWIII-----HLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
The following BLAST results are available for this feature:
BLAST of Pgr_018247 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24431985|ref|NP_060538.2|1.411e-6226.39piwi-like protein 2 [Homo sapiens][more]
gi|209180418|ref|NP_001129193.1|1.411e-6226.39piwi-like protein 2 [Homo sapiens][more]
gi|364023796|ref|NP_001242904.1|7.659e-6227.85piwi-like protein 3 isoform 2 [Homo sapiens][more]
gi|767975980|ref|XP_011537308.1|7.489e-6129.62PREDICTED: piwi-like protein 1 isoform X1 [Homo sa... [more]
gi|153792298|ref|NP_001008496.2|1.933e-6027.79piwi-like protein 3 isoform 1 [Homo sapiens][more]
back to top
BLAST of Pgr_018247 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+077.47SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261770.000e+057.97SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001113.897e-5927.29Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389363.177e-2725.75dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150023488.721e-2726.42Asxlregen_comp67380_c1_seq2|m.28664|m.41329[more]
back to top
BLAST of Pgr_018247 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+077.78RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+071.00RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+057.91RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE2.597e-6929.32RecName: Full=Piwi-like protein 1[more]
gi|226701015|sp|A6N7Y9|PIWL1_CHICK5.164e-6930.18RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Pgr_018247 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|161076864|ref|NP_001097144.1|1.701e-6931.15aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|3.274e-6931.15aubergine, isoform A [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|2.129e-6726.96argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|2.129e-6726.96argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|2.129e-6726.96argonaute 3, isoform F [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_018247 ID=Pgr_018247|Name=Pgr_018247|organism=Phagocata gracilis|type=mRNA|length=2088bp
GAACAATCTGCAAGTGATGCTCGGTCAAGAGAGAATAGGAAAAGCTTATT
TCCTCAGTGCTAATATCACAAAGAGTGAAGTGTCAAAAAACGCCGGTCCG
ACATACTTTGAAATGAACAATTTTAAGGTTCTAGGGGGTTTCGCTACAAC
ACTGCAGAGAGGAACTACACGAGAAGGAGCAATGACGACATTATTATATA
TTGAAAGAATTAATAGAGTACTTAACGAAAATTCAGTTCTTAAGATTTAC
AACAGGAACAATATCGATCAAATGATTGGCCGAGACATTATAACTAAGTA
TAACAATAAGACCTACAGAATTAGTGACATGAAAGAAATGTCTATCGAGG
AGAAATTTGAATTAGGTGAACGAACTTTGACTTATGCTGAGTATTTCAAG
GAACGATACAATATAAGCCTTCAACAAACAGAGCAACCTTTTGTCATTAC
CAGAGTTAAAAGGCCCGTCAGACGTCCACATCGCAAAGAAGGAGAGGAGG
CACCACCTCCTGCACCAGAGGAACCAGATATTTCGTTAAACATTCCAGGC
GAATTGTGTTTTCTGTGTGGATTCTCAGACCAAGAAAAGTCGAATTTAGA
CTTACAGAAAAGCTTGGGTTCCGTTCTTAAACGAGAGCCAAGAGAAAGGT
TGGAGGATATTCCTGTTTACTGTGAATGGGTGAATAAAGGGGAAGCTTCG
TCGGTATTAATCAAACAATGGGACTTGAGAATAGATAATAAACCACTGGA
AATAGAAGGCCGAGAACTTCCAGCCGTCGAGGTCATGAGTAACAACCAAC
GAATCAACGAAAGGATACCAGACGATTGGAAGTTTGGTCGCGTTCAATTC
AACATAAGAAATGATAGAGCGCACGAAATTGATGTAATCGTAGTCGATAG
AAATGATTTTAATTACAAGAATTTCATACAAGATGTTGAGTTTGAATTGA
AGAATATGCGAATAAATGCGAGAATTGGTCAAAGAATGAATTGTGGTCCA
AATGATATTGAGAAGTGTCTGACTGATGTTGCGAGAGCGGGAAGCAATGC
TGCTAAGATTGCGTTAGTGTTTGTGCCAGACGATAGAACATATGCCCGAG
TTAAAGCATTCACAATTCAAACTGGACTCCTCACTCAATGTGTCACAACG
AGAAATGGCACTAATAAGAACGACAAGAGACGAAAGGTGGTTTCTAGTAA
GACAGTTATGCAGGTATTTTCAAAGTTTGGTTATGACCCCTGGACGGTGG
AATTGAAGTTGCGCCCAACAATGATAGTCGGTATGGATACGTACCACAAT
AAGTCGAGCAAGAAATCGATTCAGGCTTCAGTTTTCTCGATCAACAGTAC
TTTCACTCAGTATATGAGCTTTGTAAATGCTCCGAAAGGAAGACAAGAAT
TTCATGAGACATTAGGCAAAAATTTCGCATTGGCTCTGGCTGACTTTAAG
AATCGTTATGACATATTGCCACAAAGAATCATGATATACAGAGATGGAGT
GGGCGATTCTCAGTTACAATTCACGAAGAATTTCGAGGTCGATGCTATGA
AGCCAATGGTAGAGGAAATTTACAAGAACATGGGGAGCAGTCTACCGCAG
TTAGTGTACATTATTGTGAAGAAGAGGGTCGGTACGAAATTGTTCAATCG
GGGTAACAATCCAAATCCGGGTACAATTGTTGACAAGGAGATTGTGAAGC
CAAACTTTTATGAATTTTTCCTGGTCTCACAACGAACTACAAAGGGAACT
GCAACACCGACAAATTACAATGTTCTTGAAGATACTAGATTACTGTCAAA
GAAGGCCACTATGGACCCGATGCCTCCTAACGAGCTACAGAAGATTACCT
ATGCGTTGACGCATTTGTATTTCAACTGGATGGGCACCATTCGAGTGCCG
GTACCAGTGCATTATGCACATCGATTGGCTGAATTAGTTGGTAAGGTCCA
CAAGGGCACCAATCCTCCGATTATAAACGAGAGAATCAGGAACAGATTGT
TCTATTTGTAACTTAGATTAATGTTGTCATCCGAGTTTATGTTCTCGATT
TTATGTTGCTTATAAATTATATATCGTTTTTGATTGTT

Design Primers for Pgr_018247

back to top

protein sequence

>Pgr_018247-protein ID=Pgr_018247-protein|Name=Pgr_018247|organism=Phagocata gracilis|type=polypeptide|length=670bp
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
back to top

coding sequence

>Pgr_018247.2.2011 ID=Pgr_018247.2.2011|Name=Pgr_018247.2.2011|organism=Phagocata gracilis|type=CDS|length=2010bp
AACAATCTGCAAGTGATGCTCGGTCAAGAGAGAATAGGAAAAGCTTATTT
CCTCAGTGCTAATATCACAAAGAGTGAAGTGTCAAAAAACGCCGGTCCGA
CATACTTTGAAATGAACAATTTTAAGGTTCTAGGGGGTTTCGCTACAACA
CTGCAGAGAGGAACTACACGAGAAGGAGCAATGACGACATTATTATATAT
TGAAAGAATTAATAGAGTACTTAACGAAAATTCAGTTCTTAAGATTTACA
ACAGGAACAATATCGATCAAATGATTGGCCGAGACATTATAACTAAGTAT
AACAATAAGACCTACAGAATTAGTGACATGAAAGAAATGTCTATCGAGGA
GAAATTTGAATTAGGTGAACGAACTTTGACTTATGCTGAGTATTTCAAGG
AACGATACAATATAAGCCTTCAACAAACAGAGCAACCTTTTGTCATTACC
AGAGTTAAAAGGCCCGTCAGACGTCCACATCGCAAAGAAGGAGAGGAGGC
ACCACCTCCTGCACCAGAGGAACCAGATATTTCGTTAAACATTCCAGGCG
AATTGTGTTTTCTGTGTGGATTCTCAGACCAAGAAAAGTCGAATTTAGAC
TTACAGAAAAGCTTGGGTTCCGTTCTTAAACGAGAGCCAAGAGAAAGGTT
GGAGGATATTCCTGTTTACTGTGAATGGGTGAATAAAGGGGAAGCTTCGT
CGGTATTAATCAAACAATGGGACTTGAGAATAGATAATAAACCACTGGAA
ATAGAAGGCCGAGAACTTCCAGCCGTCGAGGTCATGAGTAACAACCAACG
AATCAACGAAAGGATACCAGACGATTGGAAGTTTGGTCGCGTTCAATTCA
ACATAAGAAATGATAGAGCGCACGAAATTGATGTAATCGTAGTCGATAGA
AATGATTTTAATTACAAGAATTTCATACAAGATGTTGAGTTTGAATTGAA
GAATATGCGAATAAATGCGAGAATTGGTCAAAGAATGAATTGTGGTCCAA
ATGATATTGAGAAGTGTCTGACTGATGTTGCGAGAGCGGGAAGCAATGCT
GCTAAGATTGCGTTAGTGTTTGTGCCAGACGATAGAACATATGCCCGAGT
TAAAGCATTCACAATTCAAACTGGACTCCTCACTCAATGTGTCACAACGA
GAAATGGCACTAATAAGAACGACAAGAGACGAAAGGTGGTTTCTAGTAAG
ACAGTTATGCAGGTATTTTCAAAGTTTGGTTATGACCCCTGGACGGTGGA
ATTGAAGTTGCGCCCAACAATGATAGTCGGTATGGATACGTACCACAATA
AGTCGAGCAAGAAATCGATTCAGGCTTCAGTTTTCTCGATCAACAGTACT
TTCACTCAGTATATGAGCTTTGTAAATGCTCCGAAAGGAAGACAAGAATT
TCATGAGACATTAGGCAAAAATTTCGCATTGGCTCTGGCTGACTTTAAGA
ATCGTTATGACATATTGCCACAAAGAATCATGATATACAGAGATGGAGTG
GGCGATTCTCAGTTACAATTCACGAAGAATTTCGAGGTCGATGCTATGAA
GCCAATGGTAGAGGAAATTTACAAGAACATGGGGAGCAGTCTACCGCAGT
TAGTGTACATTATTGTGAAGAAGAGGGTCGGTACGAAATTGTTCAATCGG
GGTAACAATCCAAATCCGGGTACAATTGTTGACAAGGAGATTGTGAAGCC
AAACTTTTATGAATTTTTCCTGGTCTCACAACGAACTACAAAGGGAACTG
CAACACCGACAAATTACAATGTTCTTGAAGATACTAGATTACTGTCAAAG
AAGGCCACTATGGACCCGATGCCTCCTAACGAGCTACAGAAGATTACCTA
TGCGTTGACGCATTTGTATTTCAACTGGATGGGCACCATTCGAGTGCCGG
TACCAGTGCATTATGCACATCGATTGGCTGAATTAGTTGGTAAGGTCCAC
AAGGGCACCAATCCTCCGATTATAAACGAGAGAATCAGGAACAGATTGTT
CTATTTGTAA
back to top
Gene Groups
Pgr_018247 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.