Pgr_016029, Pgr_016029 (mRNA) Phagocata gracilis

Overview
NamePgr_016029
Unique NamePgr_016029
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2105
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_016029 vs. RefSeq Human
Match: gi|767975978|ref|XP_011537307.1| (PREDICTED: piwi-like protein 1 isoform X3 [Homo sapiens])

HSP 1 Score: 155.606 bits (392), Expect = 1.484e-38
Identity = 162/664 (24.40%), Postives = 297/664 (44.73%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINE-FTE----DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPD---DKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLS-FINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA----DALK 2103
            K G+ G  V+L++N  + +       Y Y +  + +  A + +  ++   Q  + +     FDG  LF  ++   +  + E F++    +D +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R   R+                      + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      +I   RN       IQ++      + +  +   + +   +  E+ L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQYE-----NSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---RRGPGGTLPGP------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLK 725          
BLAST of Pgr_016029 vs. RefSeq Human
Match: gi|768044486|ref|XP_011544923.1| (PREDICTED: piwi-like protein 1 isoform X3 [Homo sapiens])

HSP 1 Score: 155.606 bits (392), Expect = 1.484e-38
Identity = 162/664 (24.40%), Postives = 297/664 (44.73%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINE-FTE----DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPD---DKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLS-FINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA----DALK 2103
            K G+ G  V+L++N  + +       Y Y +  + +  A + +  ++   Q  + +     FDG  LF  ++   +  + E F++    +D +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R   R+                      + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      +I   RN       IQ++      + +  +   + +   +  E+ L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRL--QQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQYE-----NSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---RRGPGGTLPGP------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLK 725          
BLAST of Pgr_016029 vs. RefSeq Human
Match: gi|300244501|ref|NP_001177900.1| (piwi-like protein 1 isoform 2 [Homo sapiens])

HSP 1 Score: 155.606 bits (392), Expect = 1.506e-38
Identity = 162/663 (24.43%), Postives = 300/663 (45.25%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGE-SDINEFTE--DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDK--TYARVKNFTLSTGLLT--QCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLS-FINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA----DALK 2103
            K G+ G  V+L++N  + +       Y Y +  + +  A + +  ++   Q  + +     FDG  LF  ++   + +++   T   +D +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R   R+                      + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      +I   RN       IQ++      + +  +   + +   +  E+ L  + ++     ++ +  +  ++   Y  +K + L T   T  QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQYE-----NSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---RRGPGGTLPGP------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKY-LCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLK 725          
BLAST of Pgr_016029 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 155.221 bits (391), Expect = 1.987e-38
Identity = 161/662 (24.32%), Postives = 296/662 (44.71%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGE-SDINEFTE--DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPD---DKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLS-FINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA----DALK 2103
            K G+ G  V+L++N  + +       Y Y +  + +  A + +  ++   Q  + +     FDG  LF  ++   + +++   T   +D +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R   R+                      + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      +I   RN       IQ++      + +  +   + +   +  E+ L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQYE-----NSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---RRGPGGTLPGP------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLK 725          
BLAST of Pgr_016029 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 155.221 bits (391), Expect = 1.987e-38
Identity = 161/662 (24.32%), Postives = 296/662 (44.71%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGE-SDINEFTE--DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVV------------NAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLA-GRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV--NERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPD---DKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLS-FINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA----DALK 2103
            K G+ G  V+L++N  + +       Y Y +  + +  A + +  ++   Q  + +     FDG  LF  ++   + +++   T   +D +ITI     +   +    Q  N++F  +   M  ++IGR Y+             + P     +   +  GF+T++ +       +S +L  +  ++VL   +V+            + + +  S +LIG  ++TKYNNKTYR+ DI  + +    F  A G ++S+ +Y++++YN ++    QP ++++ +R   R+                      + IP ELC+L G +D+ + + ++ K+L    +  P QR  ++    D+I K++     +++W L  ++  L   GR L    +  GG+    N +  D  K  R     S +      +I   RN       IQ++      + +  +   + +   +  E+ L  + ++     ++ +  +     DK  A  K         +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S  I   RG QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALL--FQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPNDPIDIPSHRLVIWPGFTTSILQYE-----NSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR---RRGPGGTLPGP------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLK 725          
BLAST of Pgr_016029 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 427/657 (64.99%), Postives = 529/657 (80.52%), Query Frame = 1
Query:  151 LQRRFRILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXX------MTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADALK 2103
            L+R FRI+EPNLQP DITEK GNIG+TVKL SNF KFS+   E F MYD V S +G++PK KL+ I +V Q N L G FCFDGRRLFT EKWHGESDI EF+ D+KK+T+R ++ +   TEEYYQM+NV+ NN+QV +GQERIG+ YFL  N  K +V + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQLIGRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++ + R++K ++ E    E   E E E      MTLNIPGELCFLCGFSDQEK N DLQKNLG +LKREPR+RLDDIPA+C+WI  S+ A+    +W L+++N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + HEID++++DRNDF Y+ F+ DV+ ELRN+ ++A+V  V  CGPND+E  L D  R      KMALVFVPDD+ YA+VK+FT+STGLLTQCVTTRNGTNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ KKSIQASV+SINSTFTQY+SF+NSP+GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+K
Sbjct:   28 LRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMK 684          
BLAST of Pgr_016029 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 360/651 (55.30%), Postives = 483/651 (74.19%), Query Frame = 1
Query:  151 LQRRFRILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIR-KKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADAL 2100
            LQRRF I+EP LQP  +T+K+G  G+ V L SN+A F+I     FYMYDVV+ +  I  + KL+++     + N   PFCFDGRRLFT  KWH + D       D +I+IR +T     +EEYYQM+N++FNNIQ+FMGQE+IGR +FLG+N +   + +G  P++F+++NF++LGG+STT+ RGT  +GT+STLLY+ERINRVLNEN+VV+ Y + + DQLIGRDIITKYNNKTYRISDIKEM V+++  L  +K+SY +YFK+RYNI L++  QPFV++R++R+++R K+KTEN  E P E         +L+IPGELC+LCGFSD E+ N +LQKNLG +LKREPR+RL+DI  FC W G + K+  +MK W + +E +P+ I GREL PVD+ S   K+N +IPDDWKFG +KF       H   ++V+DRN  ++  FI+DVK E+  L +N  + S+  C  N++E  LTD +R S+  V MALVF+PDDK YA+VKNFT+STGLLTQCVT RNG+NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+HSKTGK+S+QASV+SI++ F+QY+SF+NS +G+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK FE DA+
Sbjct:   62 LQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETD------QSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAV 699          
BLAST of Pgr_016029 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 118.242 bits (295), Expect = 3.387e-27
Identity = 144/656 (21.95%), Postives = 282/656 (42.99%), Query Frame = 1
Query:  190 PTDITEKMG---NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTN--NLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIR----FITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGAN---TDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEID--IIVIDRNDFNYQK-FIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVF---VPDDKTYARVKNFT-LSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEAD 2094
            PT I E      +   ++ L++N+ K   +     Y Y V  +    +   ++KI+  + +++   ++    FDG  L+  +    +  I +  +   K  +     F  NV     E   + NV+F  I+  +   +IGR YF        D+R +    G     + NF   GG         +     S    +  IN+ +N    +   +    +QL+G+ ++T +NN+ YRI+DI    +   +FD  G K+SY DYFK  Y ++++   QP +++        K  + + +    +   E +  +   IP ELC L G +D    +  L + L    +  P++R + +  F D I   E+A   +  W + +E   + I   ++ P +++  G + +    +  +F +            I+  I++  ++        +Q + ++   + V      + +   +  E  L ++ R     V++ +     V +D+ Y  +K F  +   + +Q V  +  T +   +   VA    +QI +K G + W V+I ++  M+VGLD +H   G+ +S+ A V S N+  T++ S  +     +E   VL     + L+ +  +    P+ I +YRDGV D Q+ + +  E +
Sbjct:  195 PTQIKEPCNTRNDSSPSLTLSANYVKVRTTQPH-IYQYHVSFAPPIDSRLMRIKIVQGLSESDLGVVKEARAFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFS--ECPMVYNVLFKRIENSLRMVKIGRDYFYPEKKIVLDRRRMEIWPG-YVTSIQNFD--GGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAA---INQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVS--------KSNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIE 828          
BLAST of Pgr_016029 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 65.0846 bits (157), Expect = 1.221e-10
Identity = 100/450 (22.22%), Postives = 181/450 (40.22%), Query Frame = 1
Query:  850 KTYRISDIKEMSV-SEQFDLAGRK-----LSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSE-KASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDD--WKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQD-----VKNELRNLNVNAKVTSV-EKC------GPNDIESILTDIMRRSRDSVKMALVFVPDD-KTYARVKNFT-LSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPT------MIVGLDTYHSKTG---KKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADALK 2103
            + YR+ ++   S  S+ F L   +      +   YF++RY +KLQH + P +          +K T                     +P E+C +       K   D+Q +   ++K   R   D      + + +S   A   ++ + + V  R  +I+GR +P   +  GG+   +  P    W     +F +       I+I V     F  Q+ +++        +L+ ++ +A +  V + C      G + +E +    ++ S   +++ +V +P     YA VK    +  GL TQCV  +N    ++K      S   ++I  K G     +   +RP       + +G D  H   G   K SI A V S+++  ++Y + ++    RQE  + L       L QF+      P RI+ YRDGV + Q       E  A++
Sbjct:  346 RKYRVCNVTRRSAQSQTFPLQSEQGQTIECTVTKYFQDRYGMKLQHPHLPCLQVGQE-----QKHT--------------------YLPLEVCNIVSGQRCIKKLTDMQTST--MIKATARSAPDREKEINNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSG------IEIKVWAIACFAPQRTVREDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMF-RYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR 757          
BLAST of Pgr_016029 vs. Smed Unigenes AA
Match: SMU15015027 (SmedAsxldir_c97534_g1_i3|m.40524|m.26292)

HSP 1 Score: 59.3066 bits (142), Expect = 2.199e-10
Identity = 35/87 (40.23%), Postives = 57/87 (65.52%), Query Frame = 1
Query:  880 MSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKK-KTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQE 1137
            M V+++  L  +K+SY +YFK+RYNI L++  QPFV++R++R+V+R+K K EN      EP    E + +L+I GEL +     +Q+
Sbjct:    1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSVVRQKEKIEN------EPEGPTETDQSLSISGELGYGLELVNQK 81          
BLAST of Pgr_016029 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 425/654 (64.98%), Postives = 527/654 (80.58%), Query Frame = 1
Query:  151 LQRRFRILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXX--MTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSF-INSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADALK 2103
            L+  FRI+EPNLQP DITEK GNIG+TVKL SNF KFS+   E F MYD V S +G++PK KL+ I +V Q N L G FCFDGRRLFT EKWHGESDI EF+ D+KK+T+R ++ +   TEEYYQM+NV+ NN+QV +GQERIG+ YFL  N  K +V + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQLIGRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++ + R++K ++ E    E   E   E  MTLNIPGELCFLCGFSDQEK N DLQKNLG +LKREPR+RLDDIPA+C+WI  S+ A+    +W L+++N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + HEID++++DRNDF Y+ F+ DV+ ELRN+ ++A+V  V  CGPND+E  L D  R      KMALVFVPDD+ YA+VK+FT+STGLLTQCVTTRNGTNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ KKSIQASV+SINSTFTQY+SF +NSP+GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+K
Sbjct:   28 LRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMK 681          
BLAST of Pgr_016029 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 395/651 (60.68%), Postives = 504/651 (77.42%), Query Frame = 1
Query:  151 LQRRFRILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADALK 2103
            LQ+RFRI+EP+LQP +  +K+GN+GK V+L SNF KFS++  E + MYD   S MG++PK KL+I+ ++ +  NL G FC+DGRRLFT + W   SDI EFT D+KK+++R ++   + TEEYYQM+NV+ NN+Q+ MGQE+IG+ YFLG+N++K +V K  GPT+FE NNF+VLGGF TTLQRGTRP+G  +TLLYIERINRVLN+NSV+  Y++   DQLIGRDI+TKYNNKTYRIS+IKEM+++E F++ GR LSY  YFKERYNI L    QPFVLTR+++   R K+ E+ E    E        +TLNI GELCFLCGFSDQEK N DLQKNLG +LKR PR+RLDDIP+FCDWI  +  +     +W L+++N PLEIEGRELP  DV+SGGQ++NE+I DDWKFG+V+F       HEID++++DRND  Y  F+ DV+ E++ L  +AK+  V  C  ND+E  L D+MR      K+ALVFVPDD+ YA+VK+FT+STGLLTQCVTTRNGTNR DKRRQVV+SK+VMQIFSKFGYDPW ++IK+RPTMIVG+DT+H+K  KKSI ASV+SINSTF+QY+SF NSP+G+QEFH+ L  NF AAL +F   Y+I P RIM+YRDGVGDSQ+ FTK FE DA+K
Sbjct:   21 LQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMD-----LTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMK 666          
BLAST of Pgr_016029 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 360/651 (55.30%), Postives = 483/651 (74.19%), Query Frame = 1
Query:  151 LQRRFRILEPNLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIR-KKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADAL 2100
            LQRRF I+EP LQP  +T+K+G  G+ V L SN+A F+I     FYMYDVV+ +  I  + KL+++     + N   PFCFDGRRLFT  KWH + D       D +I+IR +T     +EEYYQM+N++FNNIQ+FMGQE+IGR +FLG+N +   + +G  P++F+++NF++LGG+STT+ RGT  +GT+STLLY+ERINRVLNEN+VV+ Y + + DQLIGRDIITKYNNKTYRISDIKEM V+++  L  +K+SY +YFK+RYNI L++  QPFV++R++R+++R K+KTEN  E P E         +L+IPGELC+LCGFSD E+ N +LQKNLG +LKREPR+RL+DI  FC W G + K+  +MK W + +E +P+ I GREL PVD+ S   K+N +IPDDWKFG +KF       H   ++V+DRN  ++  FI+DVK E+  L +N  + S+  C  N++E  LTD +R S+  V MALVF+PDDK YA+VKNFT+STGLLTQCVT RNG+NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+HSKTGK+S+QASV+SI++ F+QY+SF+NS +G+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK FE DA+
Sbjct:   19 LQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETD------QSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAV 656          
BLAST of Pgr_016029 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 167.548 bits (423), Expect = 4.360e-42
Identity = 165/664 (24.85%), Postives = 280/664 (42.17%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKV--QQTNNLRGPFCFDGRRLFTGEKW-HGESDINEFTEDDKK--ITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVN------------AYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDI--------------ESILTDIMRRSRDSVKMALVFVPDDKT--YARVKNF-TLSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYH-SKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA 2091
            K G  G  ++L +NF +     +   Y Y V        P    ++ S +  Q    L     FDG  LF   K  + E+ +   T + +K  IT+     +   +    Q  N++F  I   +  ++IGR Y+   N D         P     +   +  GF TT+ +       SS +L  +  ++VL   +V++             + +  + +L+G  I+TKYNNKTYRI DI  + + +  F     ++S+ +YFK +Y + +   NQ  +++ ++R     +                     + +P E C+L G +D+ + + ++ K+L    +  P QR   I      I ++    + +  W L  EN+ L + GR LP   ++ GG+       + W      ++   R    I  + +D     Y +   DV   L  L    KV+     GP  I              ES+L  + +      +M +V +P ++   Y  VK +  +     +QCV +R  T    +    VA+K  +Q+  K G + W+VEI LR  MIVG+D YH +  GK+SI A V S+N   +++ S        QE  + L  +   AL+ +       P RI++YRDGVGD  +     +E 
Sbjct:  102 KTGVSGTAIELRANFMRLLSRPMWALYQYHVDYK----PPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---NPDD--------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPG---------------PAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEY---NPWT---ADWSKEMRGLPLISCMSLDNWLMFYTRRNADVAQSL--LQTLNKVS-----GPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEV 714          
BLAST of Pgr_016029 vs. uniprot
Match: gi|226701333|sp|Q8CGT6|PIWL4_MOUSE (RecName: Full=Piwi-like protein 4; Short=mAgo5)

HSP 1 Score: 157.532 bits (397), Expect = 1.029e-38
Identity = 161/660 (24.39%), Postives = 280/660 (42.42%), Query Frame = 1
Query:  208 KMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDK-----KITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERIN-RVLNENSVVN------------AYSKGRSDQLIGRDIITKYNNKTYRISDI----KEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDW-KFGRVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKT--YARVKNFTLS-TGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQAS-VYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADAL 2100
            K G+ G  V+L +N     +      Y Y V  S   +A + +L+I      +        FDG  LF  EK   +  + E T + +     KIT+   + +   +    Q  NV+F  I   +   +IGR ++           K S P         +  GF+ ++          S LL+   +N +VL   +V++             +++    QL+G  ++T+YNNKTYRI DI    K     ++ D  G +++Y DY+K++Y+I L   NQP +++ ++R     K+ +N E               +++  ELCFL G S Q   +  L K +    +  P  R   +    D I ++  A   ++ W L   ++ L + GR +P   ++            DW K  R     SS+  +   I+  +R +   + F+  ++    ++  N     + K       + L  I       V++ +  +P ++   Y  +K +  S   + +QCV TR     ++K+  +  VA+K  MQ+  K G + W+VEI L+  M+VG+D       K  +    V SINS  T++ S     R   +  + L      AL +++      P RI++YRDGVG+ Q+     +E   L
Sbjct:   93 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSP-DLASR-RLRIALLYNHSILSDKAKAFDGASLFLSEKL--DQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFY-----------KPSEPVEIPQYKLSLWPGFAISVSH------FESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRD--GSEVTYVDYYKQQYDITLSDLNQPVLVSLLKR-----KRNDNSEPQM------------VHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFELETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDETP-AAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRT----LNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQL 706          
BLAST of Pgr_016029 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 157.147 bits (396), Expect = 1.145e-39
Identity = 165/681 (24.23%), Postives = 293/681 (43.02%), Query Frame = 1
Query:  187 QPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTE--------DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQ----------LIGRDIITKYNNKTYRISDIKEMSVSE-QFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV---NERIPDDWKFGRVKFTTSSR-KNHEID---IIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGP---------NDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFT-LSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFT-QYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADALK 2103
            +P  +T K G +G  + + +N+ K       T Y Y V  +    A + +    S + +   + G + FDG  +F   ++    D     E        ++ +I I+ + +V +   E +Q++N++       +  + + R Y+                    + NFR  +  G+ T++++       +  LL  E  ++V+   ++ N  S    D           ++G  I+T YNNKTYRI D+   S    +F     ++SY DY+K+RYNI ++   QP V++R     IR    +                  + I  EL    G +D  + +    + +    +  P +R++ +  F   +   +++   +K WN+ +++  +EI  R LPP  ++ G QK+   + R   DW     +F T S  KN  I+   +I   RN    Q+F+Q       ++ +N        C P         N   S   D    +   + M ++  P+++ Y+ +K  T +   + +Q VT +    R  K   +  +A+K V+Q+ +K    PW V I L   M VG D  HS   K KS  A V +++   + +Y S +N     QE  E +  N A AL+ +  ++   P+RI+ +RDGVGD Q+Y     E + LK
Sbjct:   25 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRR---SFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-------------DPQAKINLENFRMQLWPGYQTSIRQHE-----NDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQ-----------------AIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTN---EFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLK 655          
BLAST of Pgr_016029 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 157.147 bits (396), Expect = 1.636e-39
Identity = 165/681 (24.23%), Postives = 293/681 (43.02%), Query Frame = 1
Query:  187 QPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTE--------DDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQ----------LIGRDIITKYNNKTYRISDIKEMSVS-EQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKV---NERIPDDWKFGRVKFTTSSR-KNHEID---IIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGP---------NDIESILTDIMRRSRDSVKMALVFVPDDKTYARVKNFT-LSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFT-QYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEADALK 2103
            +P  +T K G +G  + + +N+ K       T Y Y V  +    A + +    S + +   + G + FDG  +F   ++    D     E        ++ +I I+ + +V +   E +Q++N++       +  + + R Y+                    + NFR  +  G+ T++++       +  LL  E  ++V+   ++ N  S    D           ++G  I+T YNNKTYRI D+   S    +F     ++SY DY+K+RYNI ++   QP V++R     IR    +                  + I  EL    G +D  + +    + +    +  P +R++ +  F   +   +++   +K WN+ +++  +EI  R LPP  ++ G QK+   + R   DW     +F T S  KN  I+   +I   RN    Q+F+Q       ++ +N        C P         N   S   D    +   + M ++  P+++ Y+ +K  T +   + +Q VT +    R  K   +  +A+K V+Q+ +K    PW V I L   M VG D  HS   K KS  A V +++   + +Y S +N     QE  E +  N A AL+ +  ++   P+RI+ +RDGVGD Q+Y     E + LK
Sbjct:   96 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRR---SFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-------------DPQAKINLENFRMQLWPGYQTSIRQHE-----NDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQ-----------------AIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARA--DWTN---EFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNI-------CNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLK 726          
BLAST of Pgr_016029 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 155.606 bits (392), Expect = 4.673e-39
Identity = 151/667 (22.64%), Postives = 284/667 (42.58%), Query Frame = 1
Query:  181 NLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDK-----KITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRD----------IITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFG---RVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKT--YARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHS-KTGKKSIQASVYSI----NSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA 2091
            N +P ++  K G  G  V L +NF +           Y V        P+ ++ ++S     N L   + FDG +LFT  K+  E +I   +   K     KI+I+F+  ++     + Q++N++       +  E +GR  F     D R  AK       E+  F+  +  G+ T++++  +       LL  E  ++V+   ++ +   +   +    +D          ++T YNN+TYRI+D+    +    F   GR +S+ +Y+  +YNI+++  NQP ++++ R   ++   +E                + + IP ELC + G + + + N  L + +    +  P+QR D + AF   +  + ++   +++WN+ ++    E++GR +   ++V    KV      DW+     +   TT S       +I   RN    +  +  +      + +  +         +   + +  +    R   K+ L  VP+D    Y+ +K      G + + V T+  T +  K R +  +A+K  +Q+  K GY PW +E+ L   M +G D   S +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +     FE 
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLS--NHANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF-----DPR--AK------IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASE----------------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEV 700          
BLAST of Pgr_016029 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 155.606 bits (392), Expect = 4.673e-39
Identity = 151/667 (22.64%), Postives = 284/667 (42.58%), Query Frame = 1
Query:  181 NLQPTDITEKMGNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDK-----KITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFR--VLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQLIGRD----------IITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFG---RVKFTTSSRKNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPDDKT--YARVKNFTLSTGLLTQCVTTRNGTNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHS-KTGKKSIQASVYSI----NSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFEA 2091
            N +P ++  K G  G  V L +NF +           Y V        P+ ++ ++S     N L   + FDG +LFT  K+  E +I   +   K     KI+I+F+  ++     + Q++N++       +  E +GR  F     D R  AK       E+  F+  +  G+ T++++  +       LL  E  ++V+   ++ +   +   +    +D          ++T YNN+TYRI+D+    +    F   GR +S+ +Y+  +YNI+++  NQP ++++ R   ++   +E                + + IP ELC + G + + + N  L + +    +  P+QR D + AF   +  + ++   +++WN+ ++    E++GR +   ++V    KV      DW+     +   TT S       +I   RN    +  +  +      + +  +         +   + +  +    R   K+ L  VP+D    Y+ +K      G + + V T+  T +  K R +  +A+K  +Q+  K GY PW +E+ L   M +G D   S +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +     FE 
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLS--NHANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF-----DPR--AK------IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASE----------------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEV 700          
BLAST of Pgr_016029 vs. RefSeq Drosophila melanogaster
Match: gi|281366635|ref|NP_001163498.1| (argonaute 3, isoform G [Drosophila melanogaster])

HSP 1 Score: 150.214 bits (378), Expect = 2.732e-37
Identity = 142/650 (21.85%), Postives = 273/650 (42.00%), Query Frame = 1
Query:  214 GNIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQTNNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSV-----------VNAYSKGRSDQLIGRDIITKYNNKTYRISDIK-EMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKTENXXXXXXXXXXXXXXXMTLNIPGELCFLCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMKEWNLRVENRPLEIEGRELPPVDV------VSGGQKVNERIPDDWKFGRVKFTTSSRKN-HEIDIIVIDRNDFNYQ--KFIQDVKNELRNLNVNAKVTSVEKCGPNDIESILTDIMRRSRDSVKMALVFVPD--DKTYARVKNFTLS-TGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMYFTKTFE 2088
            G+ G +V +  N+ K +    +  + Y+V       +   ++K ++     + L G   FDG  L+       +  +     +D ++ IR +           Q+ N++F+ +   +   +  R  F             S P    +    V  G+ T +      +     +L  +  +R+L + +V           V  Y +     L+G  ++T+YNN+TY+I+DI  + + + QF++     SY +Y+K+ +NI ++  NQP + +  +   I  ++ EN               +   +  ELC+L G  D+ + +N L + +    +  P QR   +  F + +  +  A   +  W L + N   +I GR++    +      VS G+          +F +   T    K  H    I+I   ++       + ++K    +L +N    ++     + I++ +  + R    + +M +    +  D  YA +K    S   + +Q +  +   N +  R   V  K V+Q+  K G   W V+I  +  MI G+D+YH  + +  S+ A V SINS+++Q+ S       R+E    L  +F  AL+ +  +    P  I+IYRDG+GD Q+Y    +E
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLN--DHKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-----------DPSRPKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAER-EN---------------LQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSA--------EFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRS--VVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE 727          
The following BLAST results are available for this feature:
BLAST of Pgr_016029 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767975978|ref|XP_011537307.1|1.484e-3824.40PREDICTED: piwi-like protein 1 isoform X3 [Homo sa... [more]
gi|768044486|ref|XP_011544923.1|1.484e-3824.40PREDICTED: piwi-like protein 1 isoform X3 [Homo sa... [more]
gi|300244501|ref|NP_001177900.1|1.506e-3824.43piwi-like protein 1 isoform 2 [Homo sapiens][more]
gi|66346725|ref|NP_004755.2|1.987e-3824.32piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|1.987e-3824.32PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Pgr_016029 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+064.99SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261770.000e+055.30SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001113.387e-2721.95Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389361.221e-1022.22dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150150272.199e-1040.23SmedAsxldir_c97534_g1_i3|m.40524|m.26292[more]
back to top
BLAST of Pgr_016029 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+064.98RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+060.68RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+055.30RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE4.360e-4224.85RecName: Full=Piwi-like protein 1[more]
gi|226701333|sp|Q8CGT6|PIWL4_MOUSE1.029e-3824.39RecName: Full=Piwi-like protein 4; Short=mAgo5[more]
back to top
BLAST of Pgr_016029 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|161076864|ref|NP_001097144.1|1.145e-3924.23aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|1.636e-3924.23aubergine, isoform A [Drosophila melanogaster][more]
gi|17136736|ref|NP_476875.1|4.673e-3922.64piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|4.673e-3922.64piwi, isoform B [Drosophila melanogaster][more]
gi|281366635|ref|NP_001163498.1|2.732e-3721.85argonaute 3, isoform G [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_016029 ID=Pgr_016029|Name=Pgr_016029|organism=Phagocata gracilis|type=mRNA|length=2105bp
TTACGTTAAAAGTATTTATTTTGTTGTTTGTTTTAACTAATTAAAGTTGT
TGTTTTTTATCAAAAAATGGAGGATTTAAATCCGCCGAAAATAAGAAAAA
CTGATAATGGTGATAGAGGAGGCAAAGGACCGAGAGGAAATCGTGGTGGC
CTGCAAAGAAGATTTAGAATATTGGAGCCAAATCTTCAACCAACTGATAT
TACCGAAAAAATGGGTAATATTGGCAAGACAGTCAAGTTGGCATCAAATT
TTGCTAAATTTTCAATTTCTAATGTTGAAACGTTTTATATGTATGATGTA
GTTCTAAGTGATATGGGGATTGCTCCTAAAGGTAAATTGAAAATTATCAG
CAAGGTACAACAGACAAACAATTTACGAGGTCCGTTTTGCTTTGATGGTC
GAAGATTGTTTACTGGCGAAAAATGGCACGGAGAAAGTGACATCAATGAG
TTTACAGAAGATGACAAAAAAATAACTATTCGATTTATTACTAATGTTAC
AGCAGGCACCGAGGAATACTATCAAATGGTAAACGTTATGTTTAATAATA
TTCAGGTATTCATGGGCCAAGAACGAATTGGTCGTGCCTATTTTTTGGGC
GCTAATACGGATAAAAGAGACGTGGCTAAGGGATCTGGACCAACTTATTT
TGAAGTGAATAATTTTCGGGTTCTTGGTGGTTTTTCGACCACATTACAAA
GAGGAACGAGACCAGATGGCACTAGTTCAACTTTACTATATATAGAAAGA
ATAAATCGTGTACTCAATGAAAACAGTGTAGTAAATGCGTATAGTAAAGG
TCGATCGGATCAACTTATTGGTAGAGATATCATTACAAAATACAATAATA
AAACATATAGAATTAGTGATATAAAAGAGATGTCAGTCAGTGAGCAGTTT
GATCTGGCTGGCAGAAAATTGTCATATTATGACTATTTCAAAGAACGTTA
TAATATCAAGTTACAACATTCTAATCAACCTTTTGTACTAACGCGAATGC
GTAGAACAGTTATCAGAAAAAAGAAAACAGAAAACCCTGAAGAGGCACCA
GATGAGCCTCCAGCGGAACCTGAACCTGAAATGACATTAAATATTCCCGG
AGAGTTATGCTTTCTTTGTGGATTTTCTGATCAGGAAAAGGGTAATAATG
ATCTTCAAAAAAATCTTGGTGGTATTCTTAAAAGAGAGCCTAGACAGCGA
TTGGATGATATACCAGCATTCTGCGATTGGATTGGTAAAAGTGAAAAGGC
AAGTAGTTTTATGAAAGAATGGAATCTTAGAGTAGAAAATCGTCCACTAG
AAATTGAAGGCCGAGAACTACCTCCGGTAGATGTTGTTTCTGGTGGACAG
AAAGTAAATGAACGTATACCGGATGACTGGAAATTCGGTCGAGTAAAGTT
TACGACAAGTAGTCGTAAAAATCATGAGATCGACATTATTGTCATAGATA
GAAATGATTTTAATTATCAAAAATTTATTCAAGATGTAAAAAATGAATTG
AGAAATTTAAATGTGAATGCTAAAGTTACGAGTGTTGAGAAATGTGGTCC
GAATGATATAGAAAGTATTCTTACTGATATTATGCGTAGATCACGTGATT
CGGTAAAAATGGCATTAGTTTTTGTTCCAGACGATAAAACGTATGCTAGA
GTCAAAAATTTTACTTTGAGCACTGGACTATTAACACAATGTGTTACTAC
TCGCAATGGCACCAATCGAATGGACAAACGTCGTCAAGTTGTGGCAAGCA
AGTCGGTAATGCAGATTTTTTCAAAGTTTGGATATGATCCATGGAATGTT
GAGATCAAACTTCGTCCTACAATGATAGTTGGTCTAGATACATATCATAG
TAAGACAGGGAAGAAATCTATTCAAGCATCGGTTTATTCAATTAATAGTA
CATTCACGCAATATTTGAGTTTCATTAATTCGCCTCGTGGACGTCAAGAA
TTTCACGAAGTTCTTGGGCGCAATTTCGCAGCTGCATTGCAACAATTTCA
TTCTAAGTATGAAATATATCCACAGCGCATAATGATTTACCGCGATGGCG
TTGGTGATTCGCAAATGTACTTTACGAAAACTTTTGAGGCTGATGCACTA
AAGCC

Design Primers for Pgr_016029

back to top

protein sequence

>Pgr_016029-protein ID=Pgr_016029-protein|Name=Pgr_016029|organism=Phagocata gracilis|type=polypeptide|length=679bp
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
back to top

coding sequence

>Pgr_016029.67.2103 ID=Pgr_016029.67.2103|Name=Pgr_016029.67.2103|organism=Phagocata gracilis|type=CDS|length=2037bp
ATGGAGGATTTAAATCCGCCGAAAATAAGAAAAACTGATAATGGTGATAG
AGGAGGCAAAGGACCGAGAGGAAATCGTGGTGGCCTGCAAAGAAGATTTA
GAATATTGGAGCCAAATCTTCAACCAACTGATATTACCGAAAAAATGGGT
AATATTGGCAAGACAGTCAAGTTGGCATCAAATTTTGCTAAATTTTCAAT
TTCTAATGTTGAAACGTTTTATATGTATGATGTAGTTCTAAGTGATATGG
GGATTGCTCCTAAAGGTAAATTGAAAATTATCAGCAAGGTACAACAGACA
AACAATTTACGAGGTCCGTTTTGCTTTGATGGTCGAAGATTGTTTACTGG
CGAAAAATGGCACGGAGAAAGTGACATCAATGAGTTTACAGAAGATGACA
AAAAAATAACTATTCGATTTATTACTAATGTTACAGCAGGCACCGAGGAA
TACTATCAAATGGTAAACGTTATGTTTAATAATATTCAGGTATTCATGGG
CCAAGAACGAATTGGTCGTGCCTATTTTTTGGGCGCTAATACGGATAAAA
GAGACGTGGCTAAGGGATCTGGACCAACTTATTTTGAAGTGAATAATTTT
CGGGTTCTTGGTGGTTTTTCGACCACATTACAAAGAGGAACGAGACCAGA
TGGCACTAGTTCAACTTTACTATATATAGAAAGAATAAATCGTGTACTCA
ATGAAAACAGTGTAGTAAATGCGTATAGTAAAGGTCGATCGGATCAACTT
ATTGGTAGAGATATCATTACAAAATACAATAATAAAACATATAGAATTAG
TGATATAAAAGAGATGTCAGTCAGTGAGCAGTTTGATCTGGCTGGCAGAA
AATTGTCATATTATGACTATTTCAAAGAACGTTATAATATCAAGTTACAA
CATTCTAATCAACCTTTTGTACTAACGCGAATGCGTAGAACAGTTATCAG
AAAAAAGAAAACAGAAAACCCTGAAGAGGCACCAGATGAGCCTCCAGCGG
AACCTGAACCTGAAATGACATTAAATATTCCCGGAGAGTTATGCTTTCTT
TGTGGATTTTCTGATCAGGAAAAGGGTAATAATGATCTTCAAAAAAATCT
TGGTGGTATTCTTAAAAGAGAGCCTAGACAGCGATTGGATGATATACCAG
CATTCTGCGATTGGATTGGTAAAAGTGAAAAGGCAAGTAGTTTTATGAAA
GAATGGAATCTTAGAGTAGAAAATCGTCCACTAGAAATTGAAGGCCGAGA
ACTACCTCCGGTAGATGTTGTTTCTGGTGGACAGAAAGTAAATGAACGTA
TACCGGATGACTGGAAATTCGGTCGAGTAAAGTTTACGACAAGTAGTCGT
AAAAATCATGAGATCGACATTATTGTCATAGATAGAAATGATTTTAATTA
TCAAAAATTTATTCAAGATGTAAAAAATGAATTGAGAAATTTAAATGTGA
ATGCTAAAGTTACGAGTGTTGAGAAATGTGGTCCGAATGATATAGAAAGT
ATTCTTACTGATATTATGCGTAGATCACGTGATTCGGTAAAAATGGCATT
AGTTTTTGTTCCAGACGATAAAACGTATGCTAGAGTCAAAAATTTTACTT
TGAGCACTGGACTATTAACACAATGTGTTACTACTCGCAATGGCACCAAT
CGAATGGACAAACGTCGTCAAGTTGTGGCAAGCAAGTCGGTAATGCAGAT
TTTTTCAAAGTTTGGATATGATCCATGGAATGTTGAGATCAAACTTCGTC
CTACAATGATAGTTGGTCTAGATACATATCATAGTAAGACAGGGAAGAAA
TCTATTCAAGCATCGGTTTATTCAATTAATAGTACATTCACGCAATATTT
GAGTTTCATTAATTCGCCTCGTGGACGTCAAGAATTTCACGAAGTTCTTG
GGCGCAATTTCGCAGCTGCATTGCAACAATTTCATTCTAAGTATGAAATA
TATCCACAGCGCATAATGATTTACCGCGATGGCGTTGGTGATTCGCAAAT
GTACTTTACGAAAACTTTTGAGGCTGATGCACTAAAG
back to top
Gene Groups
Pgr_016029 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.