Pgr_015739, Pgr_015739 (mRNA) Phagocata gracilis

Overview
NamePgr_015739
Unique NamePgr_015739
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2317
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_015739 vs. RefSeq Human
Match: gi|6005762|ref|NP_009128.1| (frizzled-10 precursor [Homo sapiens])

HSP 1 Score: 352.829 bits (904), Expect = 4.877e-110
Identity = 200/553 (36.17%), Postives = 306/553 (55.33%), Query Frame = 3
Query:  300 TSMDVY----NQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGK---MCLAPESFVLDKETSTESTHPNIMKELQ---QQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYK-------YSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK--KTFRQCC 1901
            +SMD+      +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ ++ PL+   C  +L+ FLCS+Y P+C  +  T  P    C+ +C   + +C P M +++   WPD LDC KLP       +C+   +   D+ T      P + +  +    Q   L   G   G   +  K         C P             +     D+ ++  DK FA VWL  W++LC  SS FT++TF  +  RF YPE+PI+FLS+CY   S G L+    G  +I C   + Q  +++  G E T C ++FL+LYYF  AS+LWWVVLT+TWFL+A + WG EAIE+ SS FHL  W  P++K+I IL++ +V  DELTG+C+VG+  + +L GFVL+P   YL+ G +F+  G++++  +R+            N  +LEKLM +IG+FS+LY VP TC IA Y  + L   ++++ L   +K        + DC++A                ++P+ E+ M++IFM LV+GITSG+WIW +K  ++++Q C
Sbjct:   22 SSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAP-------------LCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQTKTLDCLMAA---------------SIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVC 535          
BLAST of Pgr_015739 vs. RefSeq Human
Match: gi|4503835|ref|NP_003499.1| (frizzled-9 precursor [Homo sapiens])

HSP 1 Score: 347.051 bits (889), Expect = 1.104e-107
Identity = 206/571 (36.08%), Postives = 308/571 (53.94%), Query Frame = 3
Query:  324 CTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAG---KMCL-APESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIK--FNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYD---FLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK--KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKP 2003
            C  +  P+C+ I Y  TRMPNL+G  SQ EA+  + ++ PL+   C  +L+ FLCS+Y P+C  +  T  P  RP   +C   + RC P M +++   WPD LDC +LP       +C+ APE+         +      +     +    + PG     + +  +  + + +++              SC  RC   ++  ++  DK FA VW+  WS LC  S+ FT++TF    +RF YPE+PI+FLS+CY   S   L+ AV G +++ C    DQ     +++  G E T C ++FL+LYYF  AS+LWWVVLT+TWFL+A + WG EAIE+  S FH+  WG P+LK+I IL L KV  DELTGLC+V +    +L GFVLVP   YL+ G +FL  G++++  +RK            N ++LEKLM KIG+FSILY VP TC I  YV + L      +    L      C  A G      +  +L   ++P+  + ML+IFM+LV+GITSG+W+W +K  +T++  C  ++   +G+  +    +   S   G +  Y  P
Sbjct:   39 CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRP---MCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKFQYVEKSR--------------SCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC----DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLN-----MDFWRLRATEQPCAAAAGPGGR--RDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLC--YRKIAAGRA-RAKACRAPGSYGRGTHCHYKAP 572          
BLAST of Pgr_015739 vs. RefSeq Human
Match: gi|22547161|ref|NP_036325.2| (frizzled-4 precursor [Homo sapiens])

HSP 1 Score: 342.043 bits (876), Expect = 1.584e-106
Identity = 200/570 (35.09%), Postives = 299/570 (52.46%), Query Frame = 3
Query:  318 NQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGK---MCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIK-FNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNKKTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGN 2015
             +C  I   +CQ++ Y  T+MPNL+G   Q +A  ++  + PLI   CS  L+ FLCS+Y P+C  E    P  + PC  +CL VK RCEP +K+ +   WP+ L+C K P       MC+       D+E       P             ++PG                  +    S   + +  +L+CV +C  D   ++   K F ++W+  W+ LC +S+ FT++TF  +++RF YPE+PI+FLS+CY   S   ++   +GR  I C         L+  G + T C IIFL++Y+F  AS++WWV+LT+TWFL+A   WG EAIE  SS FH+  W  P++K+I ILI+  VD DELTGLC+VGN +L +L GFV+ P   YL+ G  F++ G +++ K+R +  +     D     +LE+LM KIG+FS+LY VP TC IA Y         +E++   L++YS D                       +  + ML+IFM+L++GITSG+WIW  K       C  +  NSGK          + +K GN   ++KP  G+
Sbjct:   43 RRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMC-TEKINIP--IGPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFPPQNDHNHMCMEGPG---DEEVPLPHKTP-------------IQPGEE--------------CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQK-----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACY--------FYEISNWALFRYSAD---------------------DSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGK---------VKREKRGNG--WVKPGKGS 533          
BLAST of Pgr_015739 vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 341.658 bits (875), Expect = 5.172e-105
Identity = 197/537 (36.69%), Postives = 285/537 (53.07%), Query Frame = 3
Query:  297 GTSMDVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPI--AGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDAD-----IKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDAL--KSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            G S+  +  C  IS P+C DI Y  T MPNL+G  +Q +A   +  +YPL+ +QCS  LK FLCSMY P+C    Q  PP    C+ LC   +  CE  M +K+   WPD L C+K P+  AG++C+   +   DK T T S  P       Q      R G   GA     + + S      +PS LN        C   C+       + F   +  F+  W+  WS+LC  S+LFT++T+  +  RF YPE+PI+FLS CY   +   + G +L  R +    + +     V+ G +   C I+F+MLY+FS AS++WWV+L++TWFL+A   WG EAIE+ S  FHL  W  P++K+I IL L +VD D L+G+CFVG N++ +L GFVL P  VYL  G +FL  G++S+ ++R + ++     D    ++LEKLM +IG+FS+LY VP T  IA Y  +      W      +    Y+  C   +    +         P  P   + M++  M L++GITSG WIW  K
Sbjct:  107 GISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPP----CRSLCERARQGCEALM-NKFGFQWPDTLKCEKFPVHGAGELCVGQNT--SDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGAS-ERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIR-TIMKH----DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPH-----PPMSPDFTVFMIKYLMTLIVGITSGFWIWSGK 625          
BLAST of Pgr_015739 vs. RefSeq Human
Match: gi|4503827|ref|NP_001457.1| (frizzled-2 precursor [Homo sapiens])

HSP 1 Score: 333.569 bits (854), Expect = 6.405e-103
Identity = 194/546 (35.53%), Postives = 283/546 (51.83%), Query Frame = 3
Query:  294 DGTSMDVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAG--KMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCL--PSQLNLGLHTNLSCVHRC-----DADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQP--------ALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
             G S+  +  C  IS P+C DI Y  T MPNL+G  +Q +A   +  +YPL+ +QCS  L+ FLCSMY P+C    Q  PP    C+ +C   +  CE  M +K+   WP+ L C+  P  G  ++C+  ++   D   +  +T P     LQ          G  GA    A +E      + L  PS L+        C   C     D  + F+  +  FA +W++ WS+LC  S+ FT+ T+  +  RF YPE+PI+FLS CY   S   + G VL  R +    +++     V  G +   C I+F+MLY+FS AS++WWV+L++TWFL+A   WG EAIE+ S  FHL  W  P++K+I IL + ++D D L+G+CFVG N L  L GFVL P  VYL  G +FL  G++S+ ++R + ++     D    ++LE+LM +IG+FS+LY VP T  IA Y  +     H+E                   SW    C +L  P          P   + M++  M L++GITSG WIW  K
Sbjct:   29 KGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPP----CRSICERARQGCEALM-NKFGFQWPERLRCEHFPRHGAEQICVG-QNHSEDGAPALLTTAPP--PGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIR-TIMKH----DGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWE------------------RSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGK 543          
BLAST of Pgr_015739 vs. Smed Unigenes AA
Match: SMU15029711 (SmedSxlregen_c141340_g1_i1|m.45153|m.4173)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 329/581 (56.63%), Postives = 429/581 (73.84%), Query Frame = 3
Query:  246 LLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGAS-LDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNKKTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNN 1985
            L+C   F+     R       D+Y QC  I EP CQD+ Y++T MPNL+G  SQ EASKR RD+ PLIN++CS+YLKLFLCS+YFP+C+ ++  S   V+PC+ LC HVK RCEP MK+ +++ W +ELDC+K P  GK+CL P+SF  D+     ++  +  ++L ++LQ LV  G R G S L+I +    +   +CLPS++N+G   N+SC   C A+++FN  DK FAN+WL+GWS+LC  S L TI+ FSCNTNRFLYPEKPIVFLSICYFF + GNL GA+LGR  + CR +ND+ DF+V +G E TWCKI FLM+Y+F +ASALWWVVLT+TWFLSASRHWG+EAIES+SS+ HL+ W  P+LKSI ILILHK+D DELTG CFVGN++   L GFV+VP ++YL  GI FL++GYIS+LKVR+SFL++P CIDTNNLKRLEKLMAKIG+FSILY++PV C+I SY+VDA K  +F++ LK L+++SP+C+   G++WS  KCV ++QP LPS EMRMLRIFMNLVIGITSGIWIWGNKKT + C    + +   K  +     + +S    NN
Sbjct:   28 LICISGFINIINGRRFG----DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQ-LVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNN 603          
BLAST of Pgr_015739 vs. Smed Unigenes AA
Match: SMU15005387 (SmedAsxldir_c106380_g2_i1|m.75515|m.16659)

HSP 1 Score: 370.163 bits (949), Expect = 1.025e-116
Identity = 199/541 (36.78%), Postives = 314/541 (58.04%), Query Frame = 3
Query:  309 DVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPIC-DAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQL-------NLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTN-RFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYD--FLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCI---DTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNKKTF 1889
            DVYN+C  I++ +CQ ++Y  TRMPN +GI +Q +++KR+ DY+PLIN QCS+Y + FLC+ YFP+C D   +T    + PC+ +C  V+ RCEPFMK  +++ WP EL+C K P+  ++C+ P ++ LD+  S  +   + +K+   + +S+    G N  +  +   E  ++  KCL S +       N     + SCV +CD++I ++  DK  A +W   W++LCL+SS+  I TF  +   RFLYPE+PI+F+ +CY      NL    L R+ ++C+  +   +   L+  G E   C + FL +YYF   +ALWW++L ++ +L++ R W  E +E +S+  H++ W  P++ +  +LILHK+DPDEL G C+VG  +  S L F+L+P+I+  + G   L L + S++ +R++       +      N + LEK +AK GIF  +Y VP+TC I   +   L    +     I      +CV   GL WS   C+  +   LP  E+R+L IF  LVIGITSG+W+W NKKT 
Sbjct:   33 DVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETK--TLLPCREMCEKVQIRCEPFMK-AFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDG-NVKTNRLENFETEIN-LKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGL--PLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTL 566          
BLAST of Pgr_015739 vs. Smed Unigenes AA
Match: SMU15014534 (SmedAsxldir_c94917_g1_i1|m.35515|m.3335)

HSP 1 Score: 310.457 bits (794), Expect = 5.331e-93
Identity = 199/640 (31.09%), Postives = 310/640 (48.44%), Query Frame = 3
Query:  294 DGTSMDVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPI---------------------AGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGAS-----LDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQ----YDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIAS--YVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNKK--TFRQCC-------CFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQ--------NWTYCPSVLSEPT 2066
            D T+ D   +C +I  P+C+DI Y  T MPN+    +Q+EA      +YPL+ ++CS  L+ FLCS+Y PIC  +   S P   PC+ +C  VK  C+P ++ KY   WP++++CD+ P+                     A  + LAP+    +   S +    N++ E+  QL            S     +DIA+I ++            LG+    +C   C +    +  D+ F   WL  W+++CLLS+   + TFS +  R+ YPE+PI+F+SICYF  S G L+  V+G  ++ C     +       L   G+    C I+FL++YYF  A++LWWV+LT+TWFL+A   WG EAI   S ++H + W  P +KSI  L +  VD D ++G+C+VGN    +L+ FVL P +VYL  G   L  G+ S+ ++R     Q         ++LEKLM +IG+FS+LY  P    +A   Y +     W+  L        S DC  +     +L +         PS  + M + FM + +G+TSG WIW  K   +++  C       C  +  N    +  +E++     +  NN   L   +G+  SQ          T+CP   S P+
Sbjct:   34 DNTNRD-KGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLP---PCRSVCERVKKGCDPLLQ-KYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKE--QNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVS-----TLGM---FNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTG----GKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNL--------SCDCFDSNRHQLNLPR---------PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNN---LGMDNGSCNSQLGGTKSSSGVTHCPYTHSHPS 634          
BLAST of Pgr_015739 vs. Smed Unigenes AA
Match: SMU15005581 (SmedAsxldir_c106676_g1_i1|m.77561|m.15397)

HSP 1 Score: 294.278 bits (752), Expect = 4.938e-88
Identity = 195/572 (34.09%), Postives = 288/572 (50.35%), Query Frame = 3
Query:  231 MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQ--CTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDF-----LVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIAS---------------YVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            +KY  ++ F  FL+    R V+    D YNQ  C  I  P CQ + Y  T  PN +  ++Q+EA+  I +Y PL+ ++C   L+LFLCS+YFP+C    +  PP    C+ LCL +K  CEP +K K+   WP  + CD  P    +C      + D +T  ES  PN+     + LQ  V           I   + S+ +   +P         NL                + FA VW+  WS +C+ S+LFT++TF  +  RF YPE+PI+FLS CY       + G  L  +     P+ ++        +V  G +   C I+F++LY+FS ASA+WWVVLT+TW+L+A  HW  E+I   S  FH   W  P+ K+I IL L KVD D LTG+CF G +   +L GF++ P  +YL+ G  FL  G++S+ ++R       S  D     +LEKL+ +IGIFS+LY+VP    IA                Y++D  +S  ++   K ++ + P       L +S            P  E+ M++  M+L++GITSGIWIW  K
Sbjct:   11 IKYFLIVSF-VFLFINNIRAVN----DPYNQPNCEKIKVPACQGLLYQMTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVCTIMKKALPP----CRSLCLQIKKECEPILK-KFYFKWPQSMSCDLYP-ENNLC------IRDNQTEKESA-PNVSLSCPKSLQIPV------SYDFKIRLSQNSVIQDCGIPCNRYYFNEPNL----------------RKFARVWVALWSFMCVGSTLFTVLTFLIDMKRFQYPERPIIFLSACYLVVGLTYVAGFFLNDKVACAGPFTNKDSTGKTPKIVVQGTKFESCIILFMLLYFFSMASAIWWVVLTITWYLAAKCHWAHESIGRNSQYFHFAAWAIPAGKTIGILALSKVDGDPLTGVCFTGLSDPSTLRGFLIAPLCIYLLIGTGFLIAGFVSMFEIRTIIKTGGSKTD-----KLEKLITRIGIFSVLYVVPAVVVIACYFHESMNLYKWMQRWYLIDICRSAEYKDECKKIHDHKPINPGGNALIFSQK----------PEFELFMIKYLMSLIVGITSGIWIWSGK 527          
BLAST of Pgr_015739 vs. Smed Unigenes AA
Match: SMU15040087 (dd_smedV4_7210_0_1|m.35691|m.13357)

HSP 1 Score: 291.197 bits (744), Expect = 1.476e-87
Identity = 182/518 (35.14%), Postives = 272/518 (52.51%), Query Frame = 3
Query:  342 PVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPI---AGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR--PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            P CQ++ Y  T MPNL+ + +Q EA  +++ +  LI  +CS  L  FLCS+Y P+CD  S     ++ PCQ LC  V+  CE  M+  + + WP  L+C + P+    G MC+             E   P++     +  Q++   GG     L I  I R+    KC+P               +C A+I F   DK  A +WL   + LC +SS+FTI+TF  NT+RF YPE+P++FL++CY   S  + +     R++  C   P + Q+  L   G + T C IIFL+ ++FSTAS +WWV+LTV W L+A   W  EAI   S  FHL  W   SL ++ +L+L  VD DEL GLC VG  ++ +LL FV++P I++L+ G  FL  G +++++VR+         D    ++LE LM +IG+FS+L++VP +  +                    Y+Y      A    W L    N      P+ E+ ML+IFM+ V+GITSG+W+W  K
Sbjct:   54 PECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNY---LIGPCQPLCEEVRDSCERIMR-PFNLPWPVTLNCSRFPVRNAEGSMCM-------------EGPGPSVKST--ENFQTMC--GGMKNPRLFIF-INRT---QKCVP---------------KCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQF-ILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHVKN-----DGIKTEKLEILMVRIGLFSVLFLVPSSTVLGCN----------------FYEY------ANRDHW-LKSGTN------PNIEVYMLKIFMSSVVGITSGVWVWSIK 496          
BLAST of Pgr_015739 vs. uniprot
Match: gi|17433077|sp|Q9PWH2|FZD10_CHICK (RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-10; Flags: Precursor [Gallus gallus])

HSP 1 Score: 358.992 bits (920), Expect = 5.950e-112
Identity = 195/523 (37.28%), Postives = 294/523 (56.21%), Query Frame = 3
Query:  318 NQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRC--DADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
             +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ ++ PL+   C  +LK FLCS+Y P+C  +  T  P    C+ +C   + +C P M +++   WPD LDC KLP        P    ++   +     P         L  + RP  R     D+ + + SLS T C        +  + SC   C    D+ ++  DK FA +W+  WS+LC  SS FT++TF  +  RF YPE+PI+FLS+CY   S G ++    G  +I C   + Q  +++  G E T C I+FL+LYYF  AS+LWWV+LT+TWFL+A + WG EAIE+ SS FHL  W  P++K+I IL++ +V  DELTGLC+VG+  + +L GFVL+P   YL+ G +F+  G++++  +R+            N  +LEKLM +IG+FS+LY VP TC IA Y  + L   ++++           C +             ++  ++P+ E+ M++IFM LV+GITSG+WIW +K
Sbjct:   36 GRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKND----PNYLCMEAPNNGSDEPP----RGSSMLPPMFRPQ-RPSTGHDLQQHKDSLSRTSCENPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQL-YVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVAS-----QQKCKMNN----QTKNLDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 530          
BLAST of Pgr_015739 vs. uniprot
Match: gi|17433096|sp|Q9W742|FZ10B_XENLA (RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=Xfz10-B; AltName: Full=Frizzled-9; Short=Fz-9; Short=Xfz9; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 355.525 bits (911), Expect = 9.706e-111
Identity = 198/527 (37.57%), Postives = 296/527 (56.17%), Query Frame = 3
Query:  318 NQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGK---MCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDA--DIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVN-LIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
             +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ ++ PL+   C  +LK FLCS+Y P+C  +  T  P    C+ +C   + +C P M +++   WPD LDC KLP       +C+   +   D+   + S  P I +  +      + P    G S              C  S     +  + SC   C +  D+ ++  DK FA +W+  WSLLC  SS FT++TF  +  RF YPE+PI+FLS+CY   S G ++    G  +I C   + Q  +++  G E T C I+FL+LYYF  AS+LWWV+LT+TWFL+A + WG EAIE+ SS FHL  W  P++K+I IL++ +V  DELTG+C+VG+  + +L GFVL+P   YL+ G +F+  G++++  +R+            N  +LEKLM +IG+FS+LY VP TC IA Y  + L +  F   L    K   D         S  K ++  +  ++P+ E+ M++IFM LV+GITSG+WIW +K
Sbjct:   32 GRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDEAPRSSSILPPIFRPQRPNSGHEMYPKDPKGRS-------------SCENSGKFHHVEKSASCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERL-NMDFWKILATQDKCKMD---------SQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 525          
BLAST of Pgr_015739 vs. uniprot
Match: gi|17433078|sp|Q9R216|FZD9_MOUSE (RecName: Full=Frizzled-9; Short=Fz-9; Short=mFz3; Short=mFz9; AltName: CD_antigen=CD349; Flags: Precursor)

HSP 1 Score: 355.14 bits (910), Expect = 2.065e-110
Identity = 204/541 (37.71%), Postives = 300/541 (55.45%), Query Frame = 3
Query:  324 CTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAG---KMCL-APESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIK--FNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYD---FLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNKKTFR--QCCCFFK 1913
            C  +  P+C+ I Y  TRMPNL+G  SQ EA+ ++ ++ PL+   C  +L+ FLCS+Y P+C  +  T  P  RP   +C   + RC P M +++   WPD LDC +LP       +C+ APE+         +      +     +      PG  +G + D  +  + + +++              SC  RC   ++  ++  DK FA VW+  WS LC  S+ FT+ TF    +RF YPE+PI+FLS+CY   S   L+ AV G +++ C    DQ     +++  G E T C ++FL+LYYF  AS+LWWVVLT+TWFL+A + WG EAIE+  S FH+  WG P+LK+I +L L KV  DELTGLC+V +    +L GFVLVP   YL+ G +FL  G++++  +RK            N ++LEKLM KIG+FSILY VP TC I  YV + L    + L      + +     A  +      C +L   ++P+  + ML+IFM+LV+GITSG+W+W + KTF+  Q  C+ K
Sbjct:   40 CQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRP---MCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYVEKSR--------------SCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC----DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRL------RATEQPCTAATVPGGRRDC-SLPGGSVPTVAVFMLKIFMSLVVGITSGVWVW-SSKTFQTWQSLCYRK 545          
BLAST of Pgr_015739 vs. uniprot
Match: gi|17433043|sp|Q9DEB5|FZ10A_XENLA (RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=Xfz10-A; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 353.984 bits (907), Expect = 5.232e-110
Identity = 196/527 (37.19%), Postives = 296/527 (56.17%), Query Frame = 3
Query:  318 NQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGK---MCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDA--DIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVN-LIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
             +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ ++ PL+   C  +LK FLCS+Y P+C  +  T  P    C+ +C   + +C P M +++   WPD LDC KLP       +C+   +   D+     S  P I +  +      + P             +   S + C  S     +  + SC   C +  D+ ++  DK FA +W+  WS+LC  SS FT++TF  +  RF YPE+PI+FLS+CY   S G ++    G  +I C   + Q  +++  G E T C I+FL+LYYF  AS+LWWV+LT+TWFL+A + WG EAIE+ SS FHL  W  P++K+I IL++ +V  DELTG+C+VG+  + +L GFVL+P   YL+ G +F+  G++++  +R+            N  +LEKLM +IG+FS+LY VP TC IA Y  + L +  F   L    K   D         S  K ++  +  ++P+ E+ M++IFM LV+GITSG+WIW +K
Sbjct:   38 GRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDETPRGSSMLPPIFRPQRPSSGHEIYP-------------KDPTSRSSCENSGKFHHVEKSASCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERL-NMDFWKILATQDKCKMD---------SQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 531          
BLAST of Pgr_015739 vs. uniprot
Match: gi|17433091|sp|Q9ULW2|FZD10_HUMAN (RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz10; AltName: Full=FzE7; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 352.829 bits (904), Expect = 1.292e-109
Identity = 200/553 (36.17%), Postives = 306/553 (55.33%), Query Frame = 3
Query:  300 TSMDVY----NQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGK---MCLAPESFVLDKETSTESTHPNIMKELQ---QQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYK-------YSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK--KTFRQCC 1901
            +SMD+      +C  I  P+C+DI Y  TRMPNL+G  +Q EA+ ++ ++ PL+   C  +L+ FLCS+Y P+C  +  T  P    C+ +C   + +C P M +++   WPD LDC KLP       +C+   +   D+ T      P + +  +    Q   L   G   G   +  K         C P             +     D+ ++  DK FA VWL  W++LC  SS FT++TF  +  RF YPE+PI+FLS+CY   S G L+    G  +I C   + Q  +++  G E T C ++FL+LYYF  AS+LWWVVLT+TWFL+A + WG EAIE+ SS FHL  W  P++K+I IL++ +V  DELTG+C+VG+  + +L GFVL+P   YL+ G +F+  G++++  +R+            N  +LEKLM +IG+FS+LY VP TC IA Y  + L   ++++ L   +K        + DC++A                ++P+ E+ M++IFM LV+GITSG+WIW +K  ++++Q C
Sbjct:   22 SSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPA---CRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAP-------------LCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQTKTLDCLMAA---------------SIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVC 535          
BLAST of Pgr_015739 vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 270.781 bits (691), Expect = 1.544e-79
Identity = 180/598 (30.10%), Postives = 297/598 (49.67%), Query Frame = 3
Query:  258 GTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAG--KMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR-PYND-------QYDFLVSNGN-EMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIAS--YVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNKKTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADG 2012
            G  L  ++   +DG  +  +N+C  I+  +C++I Y  T MPNLIG   Q EA   +  + PL+ + CS  L+LFLCS+Y P+C    +  PP    C+ LC   +  CE  MK  Y   WP+ L+C K P+ G   +C+A E+      T+   T  ++ K   ++ Q+ V    RN   +   +++  L     +  +L +G      C   C A + F   ++     W+  W+ +C+ S LFT++TF  +++RF YPE+ IVFL++CY    C  + G   G  ++ CR P+         Q    ++ G+ + T C ++F+ LY+   A+  WW  L   WFL+A   WG EAIE+ S +FHL+ W  P+L++I +L L KV+ D L+G+CFVG     SL  F+++P  +YL  G  FL  G+IS+ ++R          D     +LE+LM +IG FS L+I+P    +    Y       W  +    I   +S  C  AR      A+         P  ++ M++   ++++G+TS +W++ +K         ++NF     ++ ++ KE  ++      +   PA G
Sbjct:   33 GGGLMASSGTELDG--LPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERPIPP----CRSLCESARV-CEKLMKT-YNFNWPENLECSKFPVHGGEDLCVA-ENTTSSASTAATPTR-SVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLG----MGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGD-SVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-----TDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEAR---------PIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVS-----WRNF-----VERLQGKEPRTRAQAYVXYETGPAGG 590          
BLAST of Pgr_015739 vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 266.544 bits (680), Expect = 2.643e-78
Identity = 173/554 (31.23%), Postives = 281/554 (50.72%), Query Frame = 3
Query:  258 GTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAG--KMCLAPESFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSETKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR-PYND-------QYDFLVSNGN-EMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIAS--YVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            G  L  ++   +DG  +  +N+C  I+  +C++I Y  T MPNLIG   Q EA   +  + PL+ + CS  L+LFLCS+Y P+C    +  PP    C+ LC   +  CE  MK  Y   WP+ L+C K P+ G   +C+A E+      T+   T  ++ K   ++ Q+ V    RN   +   +++  L     +  +L +G      C   C A + F   ++     W+  W+ +C+ S LFT++TF  +++RF YPE+ IVFL++CY    C  + G   G  ++ CR P+         Q    ++ G+ + T C ++F+ LY+   A+  WW  L   WFL+A   WG EAIE+ S +FHL+ W  P+L++I +L L KV+ D L+G+CFVG     SL  F+++P  +YL  G  FL  G+IS+ ++R          D     +LE+LM +IG FS L+I+P    +    Y       W  +    I   +S  C  AR      A+         P  ++ M++   ++++G+TS +W++ +K
Sbjct:   33 GGGLMASSGTELDG--LPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERPIPP----CRSLCESARV-CEKLMKT-YNFNWPENLECSKFPVHGGEDLCVA-ENTTSSASTAATPTR-SVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLG----MGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGD-SVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-----TDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAPGSPEAR---------PIFQIFMVKYLCSMLVGVTSSVWLYSSK 556          
BLAST of Pgr_015739 vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 229.95 bits (585), Expect = 3.778e-64
Identity = 128/324 (39.51%), Postives = 176/324 (54.32%), Query Frame = 3
Query:  912 FNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPA-LPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            F+  +K FA +W+  WS LC  S+L T+ TF  +T RF YPE+PIVFLS CYF  + G L    L    I C         L  +      C ++FL+ Y+F  AS++WWV+L+ TWFL+A   WG EAI   S  FHL  W  P+++S+ +L+L  VD D + G+C+VGN +   L  FVL P  VYL+ G TFL  G++S+ ++R    +Q          +LEKLM +IGIFS+LY VP T  I  Y+ +A    +FE  +K L                   C  +  P   P   + ML+ FM L +GITSG+WIW  K
Sbjct:  309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAA---YFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGK 608          

HSP 2 Score: 92.8189 bits (229), Expect = 4.419e-19
Identity = 44/132 (33.33%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  321 QCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTES 716
            +C  I+ P+C+ I Y  T  PN +   +Q+EA   +  ++PL+ ++CS  LK FLCSMY PIC  +     PV   C+ +C   ++ C P M+ +Y   WP+ + C+ LP+ G     P++  +++ + TE+
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQ-QYSFEWPERMACEHLPLHGD----PDNLCMEQPSYTEA 186          
BLAST of Pgr_015739 vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 229.95 bits (585), Expect = 3.778e-64
Identity = 128/324 (39.51%), Postives = 176/324 (54.32%), Query Frame = 3
Query:  912 FNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPA-LPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            F+  +K FA +W+  WS LC  S+L T+ TF  +T RF YPE+PIVFLS CYF  + G L    L    I C         L  +      C ++FL+ Y+F  AS++WWV+L+ TWFL+A   WG EAI   S  FHL  W  P+++S+ +L+L  VD D + G+C+VGN +   L  FVL P  VYL+ G TFL  G++S+ ++R    +Q          +LEKLM +IGIFS+LY VP T  I  Y+ +A    +FE  +K L                   C  +  P   P   + ML+ FM L +GITSG+WIW  K
Sbjct:  309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAA---YFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGK 608          

HSP 2 Score: 92.8189 bits (229), Expect = 4.419e-19
Identity = 44/132 (33.33%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  321 QCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTES 716
            +C  I+ P+C+ I Y  T  PN +   +Q+EA   +  ++PL+ ++CS  LK FLCSMY PIC  +     PV   C+ +C   ++ C P M+ +Y   WP+ + C+ LP+ G     P++  +++ + TE+
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQ-QYSFEWPERMACEHLPLHGD----PDNLCMEQPSYTEA 186          
BLAST of Pgr_015739 vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 229.95 bits (585), Expect = 3.778e-64
Identity = 128/324 (39.51%), Postives = 176/324 (54.32%), Query Frame = 3
Query:  912 FNGGDKAFANVWLIGWSLLCLLSSLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICRPYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASRHWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNHLPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLKRLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPDCVIARGLSWSLAKCVNLIQPA-LPSAEMRMLRIFMNLVIGITSGIWIWGNK 1880
            F+  +K FA +W+  WS LC  S+L T+ TF  +T RF YPE+PIVFLS CYF  + G L    L    I C         L  +      C ++FL+ Y+F  AS++WWV+L+ TWFL+A   WG EAI   S  FHL  W  P+++S+ +L+L  VD D + G+C+VGN +   L  FVL P  VYL+ G TFL  G++S+ ++R    +Q          +LEKLM +IGIFS+LY VP T  I  Y+ +A    +FE  +K L                   C  +  P   P   + ML+ FM L +GITSG+WIW  K
Sbjct:  309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAA---YFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGK 608          

HSP 2 Score: 92.8189 bits (229), Expect = 4.419e-19
Identity = 44/132 (33.33%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  321 QCTVISEPVCQDIRYTHTRMPNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTSPPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPESFVLDKETSTES 716
            +C  I+ P+C+ I Y  T  PN +   +Q+EA   +  ++PL+ ++CS  LK FLCSMY PIC  +     PV   C+ +C   ++ C P M+ +Y   WP+ + C+ LP+ G     P++  +++ + TE+
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIMQ-QYSFEWPERMACEHLPLHGD----PDNLCMEQPSYTEA 186          
The following BLAST results are available for this feature:
BLAST of Pgr_015739 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|6005762|ref|NP_009128.1|4.877e-11036.17frizzled-10 precursor [Homo sapiens][more]
gi|4503835|ref|NP_003499.1|1.104e-10736.08frizzled-9 precursor [Homo sapiens][more]
gi|22547161|ref|NP_036325.2|1.584e-10635.09frizzled-4 precursor [Homo sapiens][more]
gi|4503825|ref|NP_003496.1|5.172e-10536.69frizzled-1 [Homo sapiens][more]
gi|4503827|ref|NP_001457.1|6.405e-10335.53frizzled-2 precursor [Homo sapiens][more]
back to top
BLAST of Pgr_015739 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150297110.000e+056.63SmedSxlregen_c141340_g1_i1|m.45153|m.4173[more]
SMU150053871.025e-11636.78SmedAsxldir_c106380_g2_i1|m.75515|m.16659[more]
SMU150145345.331e-9331.09SmedAsxldir_c94917_g1_i1|m.35515|m.3335[more]
SMU150055814.938e-8834.09SmedAsxldir_c106676_g1_i1|m.77561|m.15397[more]
SMU150400871.476e-8735.14dd_smedV4_7210_0_1|m.35691|m.13357[more]
back to top
BLAST of Pgr_015739 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17433077|sp|Q9PWH2|FZD10_CHICK5.950e-11237.28RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-... [more]
gi|17433096|sp|Q9W742|FZ10B_XENLA9.706e-11137.57RecName: Full=Frizzled-10-B; Short=Fz-10B; Short=X... [more]
gi|17433078|sp|Q9R216|FZD9_MOUSE2.065e-11037.71RecName: Full=Frizzled-9; Short=Fz-9; Short=mFz3; ... [more]
gi|17433043|sp|Q9DEB5|FZ10A_XENLA5.232e-11037.19RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=X... [more]
gi|17433091|sp|Q9ULW2|FZD10_HUMAN1.292e-10936.17RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz1... [more]
back to top
BLAST of Pgr_015739 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|442632294|ref|NP_001261836.1|1.544e-7930.10frizzled, isoform C [Drosophila melanogaster][more]
gi|17864440|ref|NP_524812.1|2.643e-7831.23frizzled, isoform A [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|3.778e-6439.51frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|3.778e-6439.51frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|3.778e-6439.51frizzled 2, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_015739 ID=Pgr_015739|Name=Pgr_015739|organism=Phagocata gracilis|type=mRNA|length=2317bp
TCGACTGCTACTTGATCATAAAACTGAGACTTCGAGAGAGAAAGAGAGGG
GTCCATTTGTGTGCTTGTCGGCACATTTAAAAGAAATGTAGATTGTTGTT
TATTTAATTGGTCTATATTAATTCATAAAAAGATCGGCCGACCAATGATA
AAGTGGTAATAAAATTAAGTGTATAGCATCTATAAAAAACGAGTAATTTT
GTTACATTCTTCGAAATTAGTGGGGTCAAAATGAAATACGCTTTTCTATT
GTGTTTTGGAACTTTCCTGTGGCAAACAACTGCGAGAAATGTAGACGGAA
CCTCTATGGACGTCTACAATCAATGTACTGTTATCTCTGAACCGGTATGT
CAGGACATTCGCTACACTCACACGAGGATGCCCAATCTGATCGGAATCAA
TTCACAGAATGAGGCCAGTAAACGTATCAGGGACTATTACCCGCTAATCA
ATTTACAATGCAGTCACTACTTGAAACTGTTCCTTTGCTCCATGTATTTT
CCGATATGCGACGCCGAGTCTCAGACGTCTCCACCCGTCGTGAGGCCCTG
CCAACGACTGTGTCTGCACGTCAAAGCCCGCTGTGAACCGTTTATGAAAG
ACAAATACCGGATTCTGTGGCCTGATGAGCTTGATTGCGACAAATTGCCC
ATCGCTGGGAAGATGTGTCTTGCGCCAGAGTCTTTCGTTTTGGACAAAGA
GACAAGCACAGAATCGACTCACCCGAATATCATGAAGGAACTCCAGCAAC
AGTTGCAATCACTGGTGAGGCCTGGCGGTAGAAATGGAGCAAGCTTAGAC
ATTGCAAAGATAGAAAGATCTTTATCAGAAACCAAATGCCTGCCATCACA
GCTCAATCTCGGGCTGCACACAAATCTCTCCTGCGTTCATCGATGTGACG
CCGACATCAAATTCAATGGTGGCGATAAAGCCTTTGCCAATGTGTGGCTT
ATTGGCTGGAGTCTGCTTTGTCTTCTGTCGTCACTGTTCACTATTGTTAC
ATTCTCCTGCAACACAAATCGCTTCTTGTATCCCGAGAAACCGATTGTCT
TCCTTTCTATCTGTTACTTCTTCCAGTCTTGTGGCAATCTCCTTGGAGCT
GTATTGGGCAGACGAAATATCATTTGCCGACCGTACAATGATCAGTACGA
CTTCCTCGTTAGCAACGGCAACGAGATGACCTGGTGCAAGATCATCTTCC
TGATGCTCTATTACTTTAGTACCGCCAGTGCCTTATGGTGGGTCGTCTTA
ACGGTCACGTGGTTCCTGTCTGCGTCACGACACTGGGGCTTCGAAGCCAT
AGAATCTCTCAGCAGTGTGTTCCATCTCATATGTTGGGGCACCCCATCCT
TGAAATCTATATGTATCCTAATTCTCCACAAAGTAGATCCCGACGAGCTG
ACGGGCCTTTGTTTTGTGGGCAACAACCACCTGCCATCTTTATTAGGCTT
TGTATTAGTGCCACAAATTGTCTACTTAATGGCCGGAATCACTTTCTTAA
GTCTTGGATACATTTCCATTTTGAAGGTGAGAAAATCGTTTCTCCGACAG
CCGAGCTGTATCGACACGAATAATTTAAAGCGACTGGAGAAACTGATGGC
TAAAATTGGGATATTCTCCATTCTTTACATCGTTCCGGTTACGTGTTCCA
TAGCCAGTTACGTGGTCGATGCTTTGAAGTCGTGGCATTTCGAATTGGCC
TTAAAAATCTTGTATAAATATTCCCCGGATTGCGTCATTGCGAGAGGTCT
CTCATGGTCGCTGGCCAAGTGTGTGAATCTTATACAACCAGCTCTGCCAT
CGGCCGAGATGAGAATGTTGAGGATTTTCATGAATCTGGTTATTGGCATA
ACATCGGGCATTTGGATTTGGGGCAACAAGAAAACCTTCAGACAATGTTG
TTGCTTTTTCAAGAACTTCAACAGTGGGAAAGGAATCCAGATGATTGAAA
TGAAAGAGACAGAGTCTCAGAAAGCCGGGAACAATACTTTTTACTTGAAG
CCAGCTGACGGAAATTTACAGAGCCAGAACTGGACGTATTGTCCTAGTGT
TTTGTCAGAGCCTACAGTGTGTGGCATCGTCAATGAACCCTGTGAAGGTA
TAGTAGCACCGAATAACTCTTCAAAGAGTGAGACGTCTAGTAGACATTAA
ATATCCTCTCTTAGTACGTACATACGTCGATTGTGTGGAGGGCACCTGTC
AGAGTGAACACTTAGTACTCTATTGTGATAATGATCTCTAATATTGCATT
GTGCCACAATCTCTATTACTAATATCAACGAATTCTTAGATTTAAACCGC
CTGTTGATAGACTTTTT

Design Primers for Pgr_015739

back to top

protein sequence

>Pgr_015739-protein ID=Pgr_015739-protein|Name=Pgr_015739|organism=Phagocata gracilis|type=polypeptide|length=640bp
MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRM
PNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTS
PPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPE
SFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSE
TKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLS
SLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR
PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASR
HWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNH
LPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLK
RLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPD
CVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK
KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQN
WTYCPSVLSEPTVCGIVNEPCEGIVAPNNSSKSETSSRH*
back to top

coding sequence

>Pgr_015739.231.2150 ID=Pgr_015739.231.2150|Name=Pgr_015739.231.2150|organism=Phagocata gracilis|type=CDS|length=1920bp
ATGAAATACGCTTTTCTATTGTGTTTTGGAACTTTCCTGTGGCAAACAAC
TGCGAGAAATGTAGACGGAACCTCTATGGACGTCTACAATCAATGTACTG
TTATCTCTGAACCGGTATGTCAGGACATTCGCTACACTCACACGAGGATG
CCCAATCTGATCGGAATCAATTCACAGAATGAGGCCAGTAAACGTATCAG
GGACTATTACCCGCTAATCAATTTACAATGCAGTCACTACTTGAAACTGT
TCCTTTGCTCCATGTATTTTCCGATATGCGACGCCGAGTCTCAGACGTCT
CCACCCGTCGTGAGGCCCTGCCAACGACTGTGTCTGCACGTCAAAGCCCG
CTGTGAACCGTTTATGAAAGACAAATACCGGATTCTGTGGCCTGATGAGC
TTGATTGCGACAAATTGCCCATCGCTGGGAAGATGTGTCTTGCGCCAGAG
TCTTTCGTTTTGGACAAAGAGACAAGCACAGAATCGACTCACCCGAATAT
CATGAAGGAACTCCAGCAACAGTTGCAATCACTGGTGAGGCCTGGCGGTA
GAAATGGAGCAAGCTTAGACATTGCAAAGATAGAAAGATCTTTATCAGAA
ACCAAATGCCTGCCATCACAGCTCAATCTCGGGCTGCACACAAATCTCTC
CTGCGTTCATCGATGTGACGCCGACATCAAATTCAATGGTGGCGATAAAG
CCTTTGCCAATGTGTGGCTTATTGGCTGGAGTCTGCTTTGTCTTCTGTCG
TCACTGTTCACTATTGTTACATTCTCCTGCAACACAAATCGCTTCTTGTA
TCCCGAGAAACCGATTGTCTTCCTTTCTATCTGTTACTTCTTCCAGTCTT
GTGGCAATCTCCTTGGAGCTGTATTGGGCAGACGAAATATCATTTGCCGA
CCGTACAATGATCAGTACGACTTCCTCGTTAGCAACGGCAACGAGATGAC
CTGGTGCAAGATCATCTTCCTGATGCTCTATTACTTTAGTACCGCCAGTG
CCTTATGGTGGGTCGTCTTAACGGTCACGTGGTTCCTGTCTGCGTCACGA
CACTGGGGCTTCGAAGCCATAGAATCTCTCAGCAGTGTGTTCCATCTCAT
ATGTTGGGGCACCCCATCCTTGAAATCTATATGTATCCTAATTCTCCACA
AAGTAGATCCCGACGAGCTGACGGGCCTTTGTTTTGTGGGCAACAACCAC
CTGCCATCTTTATTAGGCTTTGTATTAGTGCCACAAATTGTCTACTTAAT
GGCCGGAATCACTTTCTTAAGTCTTGGATACATTTCCATTTTGAAGGTGA
GAAAATCGTTTCTCCGACAGCCGAGCTGTATCGACACGAATAATTTAAAG
CGACTGGAGAAACTGATGGCTAAAATTGGGATATTCTCCATTCTTTACAT
CGTTCCGGTTACGTGTTCCATAGCCAGTTACGTGGTCGATGCTTTGAAGT
CGTGGCATTTCGAATTGGCCTTAAAAATCTTGTATAAATATTCCCCGGAT
TGCGTCATTGCGAGAGGTCTCTCATGGTCGCTGGCCAAGTGTGTGAATCT
TATACAACCAGCTCTGCCATCGGCCGAGATGAGAATGTTGAGGATTTTCA
TGAATCTGGTTATTGGCATAACATCGGGCATTTGGATTTGGGGCAACAAG
AAAACCTTCAGACAATGTTGTTGCTTTTTCAAGAACTTCAACAGTGGGAA
AGGAATCCAGATGATTGAAATGAAAGAGACAGAGTCTCAGAAAGCCGGGA
ACAATACTTTTTACTTGAAGCCAGCTGACGGAAATTTACAGAGCCAGAAC
TGGACGTATTGTCCTAGTGTTTTGTCAGAGCCTACAGTGTGTGGCATCGT
CAATGAACCCTGTGAAGGTATAGTAGCACCGAATAACTCTTCAAAGAGTG
AGACGTCTAGTAGACATTAA
back to top
Gene Groups
Pgr_015739 is similar in sequence to the genes of this group: GG4852
Gene NameGene ID
SMU15029711SMU15029711
frizzled-likeDdo_014376
frizzled-likeGsp_021429
Pgr_015739Pgr_015739
frizzled-likePgr_020264
frizzled-likePmo_014048

Gene Group Protein Sequences

>SMU15029711

MCINLYLYIYKTIIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQC
VPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLK
LFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSE
ELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGN
RIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHD
KVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFY
ASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSA
SALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILIL
HKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLK
VRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAY
KMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRI
FMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTI
QNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIVPPPNN
SSISDDSSRH*
>Ddo_014376 frizzled-like
GVLQTQKRFSVFIFTKYFFGYYFFAVTIIMKSIILIVIGINLLFGFVSAK
LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLI
NIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMK
ESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYN
QLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICS
ANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIV
FLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINF
LMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPA
LKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFL
SLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCT
VVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLP
SVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQ
INQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYPNIEFALPSISVPS
EVVFPPPNNSSISDASSKH*
>Gsp_021429 frizzled-like
MMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPN
SVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQ
IVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESF
SLDDLDQQNQSQGDDVQQLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQ
CLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCF
LTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSY
DDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHW
GYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQN
VLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRL
EKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCV
TKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKT
LKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY
NNWKLNSSYPANEFGLATVSVPSEIIPPPNNSSISDLSSKH*
>Pgr_015739 Pgr_015739
MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRM
PNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTS
PPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPE
SFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSE
TKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLS
SLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR
PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASR
HWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNH
LPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLK
RLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPD
CVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK
KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQN
WTYCPSVLSEPTVCGIVNEPCEGIVAPNNSSKSETSSRH*
>Pgr_020264 frizzled-like
KVGIKMRQMFFLWSGILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRY
THTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDA
EAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKM
CLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKA
GSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSL
LCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRR
NVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWF
LSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCF
VGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCID
PSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALY
EYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIW
IWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSPT
QGWNYAPVSESQSTRGVTSQTPIEGIVAPHNSSISEASSRH*
>Pmo_014048 frizzled-like
KLSVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTR
MPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAI
STPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTP
DSFSLDKEVEKEPSHVDTMKNLLQKLELSLKQSDKDKSRIDLLMKAGLYA
SAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANIWLISWSLLCLV
SSLLTIITFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVIC
RPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSAS
RHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNS
DKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNL
KRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSA
DCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGN
KKSFRYCGRNKKDIQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGWSYVP
TLASEHAVGGLSQTPVEGIMAPNNSSISEVSSKH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.