Pgr_015079, Pgr_015079 (mRNA) Phagocata gracilis

Overview
NamePgr_015079
Unique NamePgr_015079
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length3136
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_015079 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 518.464 bits (1334), Expect = 1.399e-173
Identity = 236/399 (59.15%), Postives = 309/399 (77.44%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 1393
            ME L+ +FS+ NV  YVGVED ADKASFLFSV ILVVCT+I++ K+YI   ++CYIPI+ TG   E Y++NYCW HGTIP R NET+PQ    W+Q D +RRLNYYQWVPFVLGLQGVLFYLPR+IW+T++YNLSGNDLEGLV SAKKA +Q+ + R+E I Q+++CLED+  QRRVL  +K P+L+Q+ S+ CC RRTGVF  SLY +IK+LYL NA  QI LMQ+FL+ GV+ L+  FG TIL+DI+SG+ WNDNL+FPRV++C+I  ISTV  KNHH+AQCALP+NMLNEK+YIFLWFWTV V   T+ S+  W++R+        F+K+FL+++  Y K+    +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y    F K
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          

HSP 2 Score: 518.464 bits (1334), Expect = 1.399e-173
Identity = 236/399 (59.15%), Postives = 309/399 (77.44%), Query Frame = -2
Query: 1744 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 2940
            ME L+ +FS+ NV  YVGVED ADKASFLFSV ILVVCT+I++ K+YI   ++CYIPI+ TG   E Y++NYCW HGTIP R NET+PQ    W+Q D +RRLNYYQWVPFVLGLQGVLFYLPR+IW+T++YNLSGNDLEGLV SAKKA +Q+ + R+E I Q+++CLED+  QRRVL  +K P+L+Q+ S+ CC RRTGVF  SLY +IK+LYL NA  QI LMQ+FL+ GV+ L+  FG TIL+DI+SG+ WNDNL+FPRV++C+I  ISTV  KNHH+AQCALP+NMLNEK+YIFLWFWTV V   T+ S+  W++R+        F+K+FL+++  Y K+    +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y    F K
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Pgr_015079 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 513.842 bits (1322), Expect = 8.442e-172
Identity = 232/399 (58.15%), Postives = 313/399 (78.45%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 1393
            ME  L+QF++     YVG+EDAADKASFLFSV ILVVC++I++ K+YI   +SCYIP++++G + + YVKNYCWVHGTIP  +NET+PQT+D+W+  D  R++NYYQWVPFVLGLQGVLFYLPR+IW+T++YNLSGNDLEGLV SAKKA +Q+ + R+E I Q+++CLED+  QRRVL  +K P+L+Q+ S+ CC RRTGVF  SLY +IK+LYL NA  QI LMQ+FL+ GV+ L+  FG TIL+DI+SG+ WNDNL+FPRV++C+I  ISTV  KNHH+AQCALP+NMLNEK+YIFLWFWTV V   T+ S+  W++R+        F+K+FL+++  Y K+    +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y    F K
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          

HSP 2 Score: 513.842 bits (1322), Expect = 8.442e-172
Identity = 232/399 (58.15%), Postives = 313/399 (78.45%), Query Frame = -2
Query: 1744 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGK 2940
            ME  L+QF++     YVG+EDAADKASFLFSV ILVVC++I++ K+YI   +SCYIP++++G + + YVKNYCWVHGTIP  +NET+PQT+D+W+  D  R++NYYQWVPFVLGLQGVLFYLPR+IW+T++YNLSGNDLEGLV SAKKA +Q+ + R+E I Q+++CLED+  QRRVL  +K P+L+Q+ S+ CC RRTGVF  SLY +IK+LYL NA  QI LMQ+FL+ GV+ L+  FG TIL+DI+SG+ WNDNL+FPRV++C+I  ISTV  KNHH+AQCALP+NMLNEK+YIFLWFWTV V   T+ S+  W++R+        F+K+FL+++  Y K+    +++F E FLR DG+FI+ ++S+NAGDL+ ++IV++LW+IY K Y    F K
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Pgr_015079 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 422.165 bits (1084), Expect = 1.615e-136
Identity = 215/413 (52.06%), Postives = 295/413 (71.43%), Query Frame = 2
Query:  236 ATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRA---SMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIIDNN--SDSSTMPM*DQYL* 1459
            A +VG+ED ADK SF  S +IL++ T++IT K Y+L S++CYIPI  +G +F+ ++K+YCWVHGTIP++ N  +P   + W +MD   R+NYYQWVPFVL LQG+LFYLPR+IWQ + YNLSG DLEGLV  A  A +Q  K + E ++QI+  LE++LF  R ++    P++ + +   S  C  +R+G  L + Y  IK+LY+INAFGQ++LMQ+FL  G  H    FG  +L++I+ GR WND ++FPRV YCY+  I  V  KN+++AQC LP+NMLNEK+YIFLWFWTVIV  FT  S+ QWI+R+  ++++V FLKKFLR+REQY  ED   L  F  GFLRKDGVFI+RM S+NAGDL+T++IVT LW+IYK+K+   +F K     D    SD+ST+P+ D ++*
Sbjct:   16 ADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFG--HKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI* 424          

HSP 2 Score: 422.165 bits (1084), Expect = 1.615e-136
Identity = 215/413 (52.06%), Postives = 295/413 (71.43%), Query Frame = -2
Query: 1678 ATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRA---SMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIIDNN--SDSSTMPM*DQYL* 2901
            A +VG+ED ADK SF  S +IL++ T++IT K Y+L S++CYIPI  +G +F+ ++K+YCWVHGTIP++ N  +P   + W +MD   R+NYYQWVPFVL LQG+LFYLPR+IWQ + YNLSG DLEGLV  A  A +Q  K + E ++QI+  LE++LF  R ++    P++ + +   S  C  +R+G  L + Y  IK+LY+INAFGQ++LMQ+FL  G  H    FG  +L++I+ GR WND ++FPRV YCY+  I  V  KN+++AQC LP+NMLNEK+YIFLWFWTVIV  FT  S+ QWI+R+  ++++V FLKKFLR+REQY  ED   L  F  GFLRKDGVFI+RM S+NAGDL+T++IVT LW+IYK+K+   +F K     D    SD+ST+P+ D ++*
Sbjct:   16 ADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFG--HKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI* 424          
BLAST of Pgr_015079 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 379.793 bits (974), Expect = 3.122e-120
Identity = 184/415 (44.34%), Postives = 268/415 (64.58%), Query Frame = 2
Query:  200 EQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFC--C--SRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYST---RHFGKLEEIIDNNSD 1423
            E+ L       ++TYVG+ED ADK SFLFSV +L++  +++T K Y+   ++CY      G NFE Y++NYCWVHGTI     E IPQ +  W + D  RR+NYYQWVPF+LGLQ ++FY+P++IWQ + YN SG +LE +V  A  A +    +R++ IE+I+R +EDMLFQ R         L+++    C  C  S+  G +L   Y LIK LY +N  GQ+++M+ FL  G  + +  FG T+L ++ISG+ W+   +FPRV YCY+  I  VG  N +VAQCALPVNMLNEK+Y+FLWFW V+V + T  S+  W +R+A  +    F+K+FL + + Y++ D P +N F E FLR DGVF++RML +NAGD++T++IV +L +IYK+ Y     R++    + +D + D
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGD 416          

HSP 2 Score: 379.793 bits (974), Expect = 3.122e-120
Identity = 184/415 (44.34%), Postives = 268/415 (64.58%), Query Frame = -2
Query: 1714 EQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFC--C--SRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYST---RHFGKLEEIIDNNSD 2937
            E+ L       ++TYVG+ED ADK SFLFSV +L++  +++T K Y+   ++CY      G NFE Y++NYCWVHGTI     E IPQ +  W + D  RR+NYYQWVPF+LGLQ ++FY+P++IWQ + YN SG +LE +V  A  A +    +R++ IE+I+R +EDMLFQ R         L+++    C  C  S+  G +L   Y LIK LY +N  GQ+++M+ FL  G  + +  FG T+L ++ISG+ W+   +FPRV YCY+  I  VG  N +VAQCALPVNMLNEK+Y+FLWFW V+V + T  S+  W +R+A  +    F+K+FL + + Y++ D P +N F E FLR DGVF++RML +NAGD++T++IV +L +IYK+ Y     R++    + +D + D
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGD 416          
BLAST of Pgr_015079 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 364.77 bits (935), Expect = 1.217e-114
Identity = 177/418 (42.34%), Postives = 262/418 (62.68%), Query Frame = 2
Query:  200 EQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFC--C--SRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF---GKLEEIIDNNSDSST 1432
            ++ L+      +++Y G+ED AD+ +F+FSV IL +  +I+TAK Y    +SCY+    +G NF+ Y++NYCWVHGTIP   NE IP   + W   D ++R+ YYQWVPF+LGLQ +LFY+P+++W+ + YN  G +LE L+T+A  +      +R+  +  I R +ED+L+Q R     K    ++R   +C  C  S+  G +L S YF IK LY IN  GQ+YLM+ FL  G       FG TIL DIISG++W++   FPRV+YCY   I  +G  N +VAQC LPVNMLNEK+YIFLWFW ++V + T+ S++QW+ RI   +    F KK L++ + YQ+ +  ++N F + +LR DG+F+IRM+ +N+GD+V + I+  LW+ YK KY    F      E++I    D  +
Sbjct:    4 QEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFL--GFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKS 419          

HSP 2 Score: 364.77 bits (935), Expect = 1.217e-114
Identity = 177/418 (42.34%), Postives = 262/418 (62.68%), Query Frame = -2
Query: 1705 EQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFC--C--SRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF---GKLEEIIDNNSDSST 2937
            ++ L+      +++Y G+ED AD+ +F+FSV IL +  +I+TAK Y    +SCY+    +G NF+ Y++NYCWVHGTIP   NE IP   + W   D ++R+ YYQWVPF+LGLQ +LFY+P+++W+ + YN  G +LE L+T+A  +      +R+  +  I R +ED+L+Q R     K    ++R   +C  C  S+  G +L S YF IK LY IN  GQ+YLM+ FL  G       FG TIL DIISG++W++   FPRV+YCY   I  +G  N +VAQC LPVNMLNEK+YIFLWFW ++V + T+ S++QW+ RI   +    F KK L++ + YQ+ +  ++N F + +LR DG+F+IRM+ +N+GD+V + I+  LW+ YK KY    F      E++I    D  +
Sbjct:    4 QEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFL--GFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKS 419          
BLAST of Pgr_015079 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 224.942 bits (572), Expect = 2.290e-63
Identity = 135/405 (33.33%), Postives = 228/405 (56.30%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVED-AADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLF-QRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEI 1405
            M  LL  F+SA  +    V+D   DK ++ ++ AI+ V  I+++AK+Y+   + C++P   T    E Y +NYCWV  T  L  ++ IP    +       R++ YYQWVPFVL L+ +LFY+P ++W+ + +  SG  ++ LV  A  +     + R  A++ I+  +E+ L  + +V+  ++  LL    ++  C+R +G  +  LY  +KILY +N  GQI+L+  FL     + S  +G+ +L D+++GR W ++  FPRV  C    +  +G  + H  QC L +NM NEK+++FLWFW  ++A  T+ S+  WI+   + + ++ F+ K+L   E Y+  D  SL RF   FLR+DGVF++RM++ +AG+L    +   LW+     Y     GK+ ++
Sbjct:    1 MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWN----NYCDNKEGKMHDV 386          

HSP 2 Score: 224.942 bits (572), Expect = 2.290e-63
Identity = 135/405 (33.33%), Postives = 228/405 (56.30%), Query Frame = -2
Query: 1732 MEQLLAQFSSANVATYVGVED-AADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLF-QRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEI 2940
            M  LL  F+SA  +    V+D   DK ++ ++ AI+ V  I+++AK+Y+   + C++P   T    E Y +NYCWV  T  L  ++ IP    +       R++ YYQWVPFVL L+ +LFY+P ++W+ + +  SG  ++ LV  A  +     + R  A++ I+  +E+ L  + +V+  ++  LL    ++  C+R +G  +  LY  +KILY +N  GQI+L+  FL     + S  +G+ +L D+++GR W ++  FPRV  C    +  +G  + H  QC L +NM NEK+++FLWFW  ++A  T+ S+  WI+   + + ++ F+ K+L   E Y+  D  SL RF   FLR+DGVF++RM++ +AG+L    +   LW+     Y     GK+ ++
Sbjct:    1 MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWN----NYCDNKEGKMHDV 386          
BLAST of Pgr_015079 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 210.305 bits (534), Expect = 7.819e-57
Identity = 128/391 (32.74%), Postives = 216/391 (55.24%), Query Frame = 2
Query:  206 LLAQFSSANVATYVGVEDA-ADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPL-----LKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKE---DLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLW 1351
            +L   +SA  A Y  ++D   DK ++ ++  IL    ++++AK+Y+   + C++P   T    E Y +NYCWV  T  +   E IP+     +     R++ YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     + +   +  ++R ++D + Q   +D   H       L+  A+   C R  G ++  LY  IK+LY  N   Q +L+ H L  G   L+ GF  ++L+D++    W    MFPRV  C    +  +G  + H  QC L +NM NEK+++FLWFW +   + TV + + WI  + + +  + F++K+LRV   +  +   D  +L +F   FLRKDGVF++RM+S +AG+L++S ++  LW
Sbjct:  122 ILYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTD-AMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEV-QLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGF--SLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498          

HSP 2 Score: 210.305 bits (534), Expect = 7.819e-57
Identity = 128/391 (32.74%), Postives = 216/391 (55.24%), Query Frame = -2
Query: 1786 LLAQFSSANVATYVGVEDA-ADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPL-----LKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKE---DLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLW 2931
            +L   +SA  A Y  ++D   DK ++ ++  IL    ++++AK+Y+   + C++P   T    E Y +NYCWV  T  +   E IP+     +     R++ YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     + +   +  ++R ++D + Q   +D   H       L+  A+   C R  G ++  LY  IK+LY  N   Q +L+ H L  G   L+ GF  ++L+D++    W    MFPRV  C    +  +G  + H  QC L +NM NEK+++FLWFW +   + TV + + WI  + + +  + F++K+LRV   +  +   D  +L +F   FLRKDGVF++RM+S +AG+L++S ++  LW
Sbjct:  122 ILYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTD-AMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEV-QLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGF--SLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498          
BLAST of Pgr_015079 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 178.333 bits (451), Expect = 1.769e-46
Identity = 121/416 (29.09%), Postives = 213/416 (51.20%), Query Frame = 2
Query:  248 GVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQID-KDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFS-----LYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 1411
            G +DA D+ ++ ++  IL VC ++I+AK+Y    + C++    +  + E Y+++YCW+  T  IP+  N     T  +      E+++ YYQWVPF+L  + ++F LP + W+   +  SG +++ L+ +A  A + +D  DRQ+A+E I+    D L         + P  + RA  +    +   FL       +Y   K+LY +N   Q +++   L+         FG  +L DI +GR W +   FPRV  C    +  +   N +  QCAL +N++NEKV+ FLW W +I+A+ T  S + WI    + + +V ++ KF+++ E  + + L                      L+ F   FL+ DG+ ++RM+S +AGD++   +V  LW  Y+++ + R F + EE+ D
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVN-PHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNL-------DLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF---FGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER-NWREFEEHEEMKD 414          

HSP 2 Score: 178.333 bits (451), Expect = 1.769e-46
Identity = 121/416 (29.09%), Postives = 213/416 (51.20%), Query Frame = -2
Query: 1726 GVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQID-KDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFS-----LYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 2889
            G +DA D+ ++ ++  IL VC ++I+AK+Y    + C++    +  + E Y+++YCW+  T  IP+  N     T  +      E+++ YYQWVPF+L  + ++F LP + W+   +  SG +++ L+ +A  A + +D  DRQ+A+E I+    D L         + P  + RA  +    +   FL       +Y   K+LY +N   Q +++   L+         FG  +L DI +GR W +   FPRV  C    +  +   N +  QCAL +N++NEKV+ FLW W +I+A+ T  S + WI    + + +V ++ KF+++ E  + + L                      L+ F   FL+ DG+ ++RM+S +AGD++   +V  LW  Y+++ + R F + EE+ D
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVN-PHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNL-------DLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF---FGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER-NWREFEEHEEMKD 414          
BLAST of Pgr_015079 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 174.096 bits (440), Expect = 5.623e-45
Identity = 121/422 (28.67%), Postives = 213/422 (50.47%), Query Frame = 2
Query:  230 NVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQID-KDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFS-----LYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 1411
            N  +  G +DA D+ ++ ++  IL VC ++I+AK+Y    + C++    +  + E Y+++YCW+  T  IP+  N     T  +      E+++ YYQWVPF+L  + ++F LP + W+   +  SG +++ L+ +A    + +D  DRQ+A+E I+    D L         + P  + RA  +    +   FL       L+   K+LY +N   Q  ++   L+         FG  +L DI +GR W +   FPRV  C    +  +   N +  QCAL +N++NEKV+ FLW W +I+A+ T  S + WI    + + +V ++ KF+++ E  + + L                      L+ F   FL+ DGV ++RM+S +AGD++   +V  LW  ++++ + R F + EE+ D
Sbjct:   29 NALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVN-PHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNL-------DLQSPNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLF---FGFQVLNDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER-NWREFEEHEEMKD 430          

HSP 2 Score: 174.096 bits (440), Expect = 5.623e-45
Identity = 121/422 (28.67%), Postives = 213/422 (50.47%), Query Frame = -2
Query: 1726 NVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGT--IPLRSNETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQID-KDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFS-----LYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPS--------------------LNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIID 2907
            N  +  G +DA D+ ++ ++  IL VC ++I+AK+Y    + C++    +  + E Y+++YCW+  T  IP+  N     T  +      E+++ YYQWVPF+L  + ++F LP + W+   +  SG +++ L+ +A    + +D  DRQ+A+E I+    D L         + P  + RA  +    +   FL       L+   K+LY +N   Q  ++   L+         FG  +L DI +GR W +   FPRV  C    +  +   N +  QCAL +N++NEKV+ FLW W +I+A+ T  S + WI    + + +V ++ KF+++ E  + + L                      L+ F   FL+ DGV ++RM+S +AGD++   +V  LW  ++++ + R F + EE+ D
Sbjct:   29 NALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVN-PHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNL-------DLQSPNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLF---FGFQVLNDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER-NWREFEEHEEMKD 430          
BLAST of Pgr_015079 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 171.4 bits (433), Expect = 6.703e-44
Identity = 121/426 (28.40%), Postives = 211/426 (49.53%), Query Frame = 2
Query:  254 EDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIP--QTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXXQWIFRIALTNNEVGFLKKFLRV-------REQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIIDNNSDSSTMPM*DQYL*TLDIGYDRVTYDRDT 1504
            +D +D+ ++L +  IL+  +++I+ K++    + C  P    G ++E Y +NYCW   T  +   + +   + E+++     +R+L+YYQWVPF L LQ   F  P  +W+    N SG  +  +V  AK + +  ++ R++ I  + R L   L  R   +  +  +   +   F   + +  F+  +Y   K+LY +N F Q+YLM +FL     H  G FGV  ++DI+ G  W  +  FPR A C    +  V     +  QC L +N+ NEK+++ LWFW VI+ + +  S+VQW   +        F+K+ L +       +   ++ED   +++F   +L KDGVF++RM+S +AG +  +++V  L++ Y             +  D N D    P+ D  L T+  G +     R T
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTP---DRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSAL--RFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYG-FGV--VQDIVQGEPWERSGYFPRAAVCDFE-VRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRRED-SDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY-------------DFQDKNKDVQGSPVSDD-LQTISTGAESSIRQRKT 419          

HSP 2 Score: 171.4 bits (433), Expect = 6.703e-44
Identity = 121/426 (28.40%), Postives = 211/426 (49.53%), Query Frame = -2
Query: 1633 EDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIP--QTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFWXXXXXXXXXXXXVQWIFRIALTNNEVGFLKKFLRV-------REQYQKEDLPSLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKLEEIIDNNSDSSTMPM*DQYL*TLDIGYDRVTYDRDT 2883
            +D +D+ ++L +  IL+  +++I+ K++    + C  P    G ++E Y +NYCW   T  +   + +   + E+++     +R+L+YYQWVPF L LQ   F  P  +W+    N SG  +  +V  AK + +  ++ R++ I  + R L   L  R   +  +  +   +   F   + +  F+  +Y   K+LY +N F Q+YLM +FL     H  G FGV  ++DI+ G  W  +  FPR A C    +  V     +  QC L +N+ NEK+++ LWFW VI+ + +  S+VQW   +        F+K+ L +       +   ++ED   +++F   +L KDGVF++RM+S +AG +  +++V  L++ Y             +  D N D    P+ D  L T+  G +     R T
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTP---DRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSAL--RFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYG-FGV--VQDIVQGEPWERSGYFPRAAVCDFE-VRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRRED-SDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY-------------DFQDKNKDVQGSPVSDD-LQTISTGAESSIRQRKT 419          
BLAST of Pgr_015079 vs. RefSeq Drosophila melanogaster
Match: gi|17864458|ref|NP_524824.1| (optic ganglion reduced, isoform A [Drosophila melanogaster])

HSP 1 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          

HSP 2 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = -2
Query: 2035 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 2940
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_015079 vs. RefSeq Drosophila melanogaster
Match: gi|24640272|ref|NP_727147.1| (optic ganglion reduced, isoform B [Drosophila melanogaster])

HSP 1 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          

HSP 2 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = -2
Query: 2035 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 2940
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_015079 vs. RefSeq Drosophila melanogaster
Match: gi|386763961|ref|NP_001245557.1| (optic ganglion reduced, isoform C [Drosophila melanogaster])

HSP 1 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          

HSP 2 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = -2
Query: 2035 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 2940
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_015079 vs. RefSeq Drosophila melanogaster
Match: gi|386763963|ref|NP_001245558.1| (optic ganglion reduced, isoform D [Drosophila melanogaster])

HSP 1 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          

HSP 2 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = -2
Query: 2035 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 2940
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Pgr_015079 vs. RefSeq Drosophila melanogaster
Match: gi|442615362|ref|NP_001259299.1| (optic ganglion reduced, isoform E [Drosophila melanogaster])

HSP 1 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  197 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 1102
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          

HSP 2 Score: 96.6709 bits (239), Expect = 6.007e-21
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = -2
Query: 2035 MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILDSMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRS--------NETIPQTEDQWLQMDLERRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKACSQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTGVFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIISGRTWNDNL-MFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLWFW 2940
            M +LL    S      +  ++A  +    F+  +L+ C++IITA +Y+   +SC    ++ G    V V  +CW+H T  +              P   + +   D ++   YYQWV FVL  Q +  Y P+ +W      L    + GL  +    C++ +K+ +           D L    +    +H L   R                 Y+  + L  IN   Q+YLM  F       LS G  +  L D+   +  +  + +FPRV  C        G+   H + C LP+N++NEK Y+F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISC----IVNGVPPHV-VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI---CTREEKEAKR----------DALLDYLIKHVKRHKLYAIR-----------------YWACEFLCCINIIVQMYLMNRFF--DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
The following BLAST results are available for this feature:
BLAST of Pgr_015079 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pgr_015079 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150036491.399e-17359.15SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150036488.442e-17258.15SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150009181.615e-13652.06Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150008373.122e-12044.34Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006571.217e-11442.34Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Pgr_015079 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL2.290e-6333.33RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL7.819e-5732.74RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.769e-4629.09RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL5.623e-4528.67RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|10720052|sp|Q23157|INX11_CAEEL6.703e-4428.40RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
back to top
BLAST of Pgr_015079 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17864458|ref|NP_524824.1|6.007e-2125.40optic ganglion reduced, isoform A [Drosophila mela... [more]
gi|24640272|ref|NP_727147.1|6.007e-2125.40optic ganglion reduced, isoform B [Drosophila mela... [more]
gi|386763961|ref|NP_001245557.1|6.007e-2125.40optic ganglion reduced, isoform C [Drosophila mela... [more]
gi|386763963|ref|NP_001245558.1|6.007e-2125.40optic ganglion reduced, isoform D [Drosophila mela... [more]
gi|442615362|ref|NP_001259299.1|6.007e-2125.40optic ganglion reduced, isoform E [Drosophila mela... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_015079 ID=Pgr_015079|Name=Pgr_015079|organism=Phagocata gracilis|type=mRNA|length=3136bp
CTCAAATCCAACAACTGAAAATTGTTTACAATTGAATCGTCTTTATCGCA
TATCAATAATCGGTAAGGCGAGCAAATAAAATTAACATTTACATCGCTTA
AAGGACGGTTGTTAGACACGAATCTATGTGATGACATTTACCACTAACCA
TTTCTACCATTTCATTTCATACATTGGAATCTAAATTAATTGGAAAATGG
AGCAATTACTTGCACAGTTTTCCAGTGCCAATGTGGCCACTTATGTCGGA
GTTGAGGATGCCGCCGACAAGGCGAGTTTTCTGTTCAGTGTCGCCATCTT
GGTGGTGTGCACGATAATAATCACTGCCAAGGAATACATACTCGATTCGA
TGTCGTGTTATATTCCTATTATGATGACGGGACACAATTTCGAGGTATAT
GTGAAGAATTACTGTTGGGTACATGGAACGATTCCACTTAGAAGTAATGA
AACTATTCCACAAACGGAAGATCAGTGGCTACAAATGGATTTGGAAAGAA
GACTAAATTACTATCAATGGGTACCATTCGTTCTTGGTCTTCAAGGAGTT
CTCTTCTATCTTCCACGGATGATTTGGCAAACTGTTGTCTACAATTTAAG
TGGTAACGATCTCGAAGGCTTAGTAACCAGTGCAAAAAAAGCCTGCAGTC
AAATCGACAAAGACCGACAAGAGGCAATCGAACAAATTTCTCGCTGCTTG
GAGGACATGCTCTTCCAGCGACGGGTTCTGGACACATCAAAGCATCCGTT
GTTGAAACAGAGAGCATCGATGTTCTGTTGCAGTCGACGAACCGGGGTGT
TTTTGTTCAGTTTATATTTTCTAATAAAAATACTATATTTAATCAATGCT
TTTGGTCAAATCTATTTGATGCAACATTTTCTGCGTATCGGTGTCACTCA
TCTAAGTGGAGGATTCGGGGTGACAATATTGCGAGACATAATTTCTGGGC
GAACGTGGAATGATAATCTGATGTTCCCGCGAGTGGCCTACTGCTACATT
GGTGGCATATCAACTGTGGGCACTAAAAACCACCACGTGGCTCAGTGTGC
TCTGCCGGTGAATATGCTCAACGAGAAGGTGTACATCTTTCTTTGGTTCT
GGACTGTGATAGTCGCGGTGTTCACTGTCACCAGTGTTGTGCAATGGATC
TTCCGGATTGCGTTGACAAACAATGAAGTGGGCTTCTTGAAGAAATTCTT
ACGGGTTCGAGAACAGTACCAAAAAGAGGATTTGCCGAGTTTAAATCGCT
TCTGTGAGGGATTTCTACGCAAAGATGGAGTCTTCATAATACGGATGTTG
TCGATGAATGCCGGCGACTTGGTGACGAGTAACATTGTGACGAAATTGTG
GGACATTTATAAGAAAAAATATTCGACCAGGCATTTCGGGAAATTGGAGG
AAATCATTGACAATAATAGCGACAGCTCCACTATGCCGATGTAGGATCAA
TACCTGTGAACCTTGGATATTGGATATGATCGAGTAACTTATGATAGAGA
CACGGTGAGATAGACCATACAATTATGTATATTTATCGATTATATCCTCC
ATTTATTCTCAATACCAGCTGGTATTGAGAATAAATGGAGGATATAATCG
ATAAATATACATAATTGTATGGTCTATCTCACCGTGTCTCTATCATAAGT
TACTCGATCATATCCAATATCCAAGGTTCACAGGTATTGATCCTACATCG
GCATAGTGGAGCTGTCGCTATTATTGTCAATGATTTCCTCCAATTTCCCG
AAATGCCTGGTCGAATATTTTTTCTTATAAATGTCCCACAATTTCGTCAC
AATGTTACTCGTCACCAAGTCGCCGGCATTCATCGACAACATCCGTATTA
TGAAGACTCCATCTTTGCGTAGAAATCCCTCACAGAAGCGATTTAAACTC
GGCAAATCCTCTTTTTGGTACTGTTCTCGAACCCGTAAGAATTTCTTCAA
GAAGCCCACTTCATTGTTTGTCAACGCAATCCGGAAGATCCATTGCACAA
CACTGGTGACAGTGAACACCGCGACTATCACAGTCCAGAACCAAAGAAAG
ATGTACACCTTCTCGTTGAGCATATTCACCGGCAGAGCACACTGAGCCAC
GTGGTGGTTTTTAGTGCCCACAGTTGATATGCCACCAATGTAGCAGTAGG
CCACTCGCGGGAACATCAGATTATCATTCCACGTTCGCCCAGAAATTATG
TCTCGCAATATTGTCACCCCGAATCCTCCACTTAGATGAGTGACACCGAT
ACGCAGAAAATGTTGCATCAAATAGATTTGACCAAAAGCATTGATTAAAT
ATAGTATTTTTATTAGAAAATATAAACTGAACAAAAACACCCCGGTTCGT
CGACTGCAACAGAACATCGATGCTCTCTGTTTCAACAACGGATGCTTTGA
TGTGTCCAGAACCCGTCGCTGGAAGAGCATGTCCTCCAAGCAGCGAGAAA
TTTGTTCGATTGCCTCTTGTCGGTCTTTGTCGATTTGACTGCAGGCTTTT
TTTGCACTGGTTACTAAGCCTTCGAGATCGTTACCACTTAAATTGTAGAC
AACAGTTTGCCAAATCATCCGTGGAAGATAGAAGAGAACTCCTTGAAGAC
CAAGAACGAATGGTACCCATTGATAGTAATTTAGTCTTCTTTCCAAATCC
ATTTGTAGCCACTGATCTTCCGTTTGTGGAATAGTTTCATTACTTCTAAG
TGGAATCGTTCCATGTACCCAACAGTAATTCTTCACATATACCTCGAAAT
TGTGTCCCGTCATCATAATAGGAATATAACACGACATCGAATCGAGTATG
TATTCCTTGGCAGTGATTATTATCGTGCACACCACCAAGATGGCGACACT
GAACAGAAAACTCGCCTTGTCGGCGGCATCCTCAACTCCGACATAAGTGG
CCACATTGGCACTGGAAAACTGTGCAAGTAATTGCTCCATTTTCCAATTA
ATTTAGATTCCAATGTATGAAATGAAATGGTAGAAATGGTTAGTGGTAAA
TGTCATCACATAGATTCGTGTCTAACAACCGTCCTTTAAGCGATGTAAAT
GTTAATTTTATTTGCTCGCCTTACCGATTATTGATATGCGATAAAGACGA
TTCAATTGTAAACAATTTTCAGTTGTTGGATTTGAG

Design Primers for Pgr_015079

back to top

protein sequence

>Pgr_015079-protein ID=Pgr_015079-protein|Name=Pgr_015079|organism=Phagocata gracilis|type=polypeptide|length=416bp
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
back to top

coding sequence

>Pgr_015079.197.1444 ID=Pgr_015079.197.1444|Name=Pgr_015079.197.1444|organism=Phagocata gracilis|type=CDS|length=1248bp
ATGGAGCAATTACTTGCACAGTTTTCCAGTGCCAATGTGGCCACTTATGT
CGGAGTTGAGGATGCCGCCGACAAGGCGAGTTTTCTGTTCAGTGTCGCCA
TCTTGGTGGTGTGCACGATAATAATCACTGCCAAGGAATACATACTCGAT
TCGATGTCGTGTTATATTCCTATTATGATGACGGGACACAATTTCGAGGT
ATATGTGAAGAATTACTGTTGGGTACATGGAACGATTCCACTTAGAAGTA
ATGAAACTATTCCACAAACGGAAGATCAGTGGCTACAAATGGATTTGGAA
AGAAGACTAAATTACTATCAATGGGTACCATTCGTTCTTGGTCTTCAAGG
AGTTCTCTTCTATCTTCCACGGATGATTTGGCAAACTGTTGTCTACAATT
TAAGTGGTAACGATCTCGAAGGCTTAGTAACCAGTGCAAAAAAAGCCTGC
AGTCAAATCGACAAAGACCGACAAGAGGCAATCGAACAAATTTCTCGCTG
CTTGGAGGACATGCTCTTCCAGCGACGGGTTCTGGACACATCAAAGCATC
CGTTGTTGAAACAGAGAGCATCGATGTTCTGTTGCAGTCGACGAACCGGG
GTGTTTTTGTTCAGTTTATATTTTCTAATAAAAATACTATATTTAATCAA
TGCTTTTGGTCAAATCTATTTGATGCAACATTTTCTGCGTATCGGTGTCA
CTCATCTAAGTGGAGGATTCGGGGTGACAATATTGCGAGACATAATTTCT
GGGCGAACGTGGAATGATAATCTGATGTTCCCGCGAGTGGCCTACTGCTA
CATTGGTGGCATATCAACTGTGGGCACTAAAAACCACCACGTGGCTCAGT
GTGCTCTGCCGGTGAATATGCTCAACGAGAAGGTGTACATCTTTCTTTGG
TTCTGGACTGTGATAGTCGCGGTGTTCACTGTCACCAGTGTTGTGCAATG
GATCTTCCGGATTGCGTTGACAAACAATGAAGTGGGCTTCTTGAAGAAAT
TCTTACGGGTTCGAGAACAGTACCAAAAAGAGGATTTGCCGAGTTTAAAT
CGCTTCTGTGAGGGATTTCTACGCAAAGATGGAGTCTTCATAATACGGAT
GTTGTCGATGAATGCCGGCGACTTGGTGACGAGTAACATTGTGACGAAAT
TGTGGGACATTTATAAGAAAAAATATTCGACCAGGCATTTCGGGAAATTG
GAGGAAATCATTGACAATAATAGCGACAGCTCCACTATGCCGATGTAG
back to top
Gene Groups
Pgr_015079 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.