Pgr_014738, Pgr_014738 (mRNA) Phagocata gracilis

Overview
NamePgr_014738
Unique NamePgr_014738
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length1412
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_014738 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 500.36 bits (1287), Expect = 2.648e-174
Identity = 261/404 (64.60%), Postives = 321/404 (79.46%), Query Frame = 1
Query:  115 MENLLIYFSKFHVTTYVGVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRTANVS 1326
            ME  L  F+ F    YVG+ED ADKASFLFSV IL+V S+I+STK+YI   +SCYIP+ +SG   D YVKNYCWVHGTIP  +NETLP T  EWII D+ R+INYYQWVPFVLGLQG+LFYLPR+IW+ +IYNLSGNDLEGLV+SAKKA  ++G  RK+++ Q+A CLEDLF +RRVL   +  +LR K S+ CC RRTGVF  S+Y +IK+LYL NAI QI LMQ+FL+ G ++L+  FG TIL DI+SGK WNDNL+FPRV++C+I  ISTV   N +IAQCALP+NMLNEK+YIFLWFWTVGVL +T++SIP+W++RM+F RKR+DFIKRFLK +S Y K K + ++SQFV  FLRHDGIFIL IISLNAGD+I TDIV +LWEIY + Y + DFR   +S
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYIS 403          
BLAST of Pgr_014738 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 495.738 bits (1275), Expect = 1.601e-172
Identity = 257/404 (63.61%), Postives = 324/404 (80.20%), Query Frame = 1
Query:  115 MENLLIYFSKFHVTTYVGVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRTANVS 1326
            ME+L+  FS F+V  YVGVEDGADKASFLFSV IL+V ++I+STK+YI   ++CYIPI  +G+K + Y++NYCW HGTIP R NETLP    +W+  D +RR+NYYQWVPFVLGLQG+LFYLPR+IW+ +IYNLSGNDLEGLV+SAKKA  ++G  RK+++ Q+A CLEDLF +RRVL   +  +LR K S+ CC RRTGVF  S+Y +IK+LYL NAI QI LMQ+FL+ G ++L+  FG TIL DI+SGK WNDNL+FPRV++C+I  ISTV   N +IAQCALP+NMLNEK+YIFLWFWTVGVL +T++SIP+W++RM+F RKR+DFIKRFLK +S Y K K + ++SQFV  FLRHDGIFIL IISLNAGD+I TDIV +LWEIY + Y + DFR   +S
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYIS 403          
BLAST of Pgr_014738 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 365.925 bits (938), Expect = 1.209e-121
Identity = 196/406 (48.28%), Postives = 268/406 (66.01%), Query Frame = 1
Query:  115 MENLLIYFSKFHVTTYVGVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRL---LRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRTANV 1323
            +   + Y +K+    +VG+ED ADK SF  S +ILL+ +++I+ K Y+L S++CYIPI  SG  FD ++K+YCWVHGTIP++ N  LP     W  MD   RINYYQWVPFVL LQGILFYLPR+IWQ++ YNLSG DLEGLV  A  A  + G ++ ++V+QIA  LE+L F  R +  +   +   L    S  C  +R+G  L + Y  IK+LY++NA GQ++LMQ+FL  G     T FG  +L +I+ G+ WND ++FPRV YCY+  I  V   N Y+AQC LP+NMLNEK+YIFLWFWTV V+  T +S+  WI+R++    +  F+K+FL+ R  Y   +   +L  F   FLR DG+FILR+ S+NAGD+IT DIV  LW IYKE + E++F  + V
Sbjct:    3 LSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFG--HKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTD-EDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGV 403          
BLAST of Pgr_014738 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 362.073 bits (928), Expect = 7.759e-120
Identity = 194/403 (48.14%), Postives = 270/403 (67.00%), Query Frame = 1
Query:  118 ENLLIYFSKFHVTTYVGVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNK---TSMFCC-SRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT 1314
            E  L    +F ++TYVG+ED ADK SFLFSVT+L++S ++++ K Y+   ++CY   +  G  F+ Y++NYCWVHGTI     E +P    +W   D  RRINYYQWVPF+LGLQ I+FY+P++IWQ++ YN SG +LE +V  A  A     + RKD +E+IA  +ED+ F+ R  +      LR K   T  FC  S+  G +L   Y +IK LY LN IGQ+++M+ FL  G     + FG T+L ++ISGK W+   +FPRV YCY+  I  VG +N Y+AQCALPVNMLNEK+Y+FLWFW V V I+T +SIP+W +RM+F+ +R  FIKRFL     YE++  + +++ F+  FLRHDG+F++R++ +NAGDIIT DIV +L EIYKE+Y   DFR 
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSD-KPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRN 403          
BLAST of Pgr_014738 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 332.028 bits (850), Expect = 2.386e-108
Identity = 179/411 (43.55%), Postives = 264/411 (64.23%), Query Frame = 1
Query:  118 ENLLIYFSKFHVTTYVGVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFC--C--SRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRTANVSDKYV 1338
            +  L    +F +++Y G+ED AD+ +F+FSV IL +S +I++ K Y    +SCY+  + SG  FD Y++NYCWVHGTIP   NE +P    +W I D+++RI YYQWVPF+LGLQ ILFY+P+++W+++ YN  G +LE L+ +A  +       RK  +  I   +EDL ++ R  +  +    R +   +C  C  S+  G +L S YF IK LY +N IGQ+YLM+ FL   ++   + FG TIL DIISGK+W++   FPRV+YCY   I  +G  N Y+AQC LPVNMLNEK+YIFLWFW + V IIT+LSI  W+ R+ F+ KR  F K+ LK    Y+++++  + + F+  +LR+DG+F++R+I +N+GDI+  +I+  LWE YK  Y   DF   N  +K +
Sbjct:    4 QEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSM--SSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTV-NHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLI 411          
BLAST of Pgr_014738 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 180.259 bits (456), Expect = 6.879e-50
Identity = 124/403 (30.77%), Postives = 222/403 (55.09%), Query Frame = 1
Query:  115 MENLLIYFS------KFHVTTYVGVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLED-LFFERRVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEK 1302
            M  LL YF+      +FHV      +D  DK ++ ++  I+ V +I++S K+Y+   + C++P + + +  + Y +NYCWV  T  +  ++ +P    E       R+I YYQWVPFVL L+ +LFY+P ++W+L+ +  SG  ++ LV  A  +      SR  +++ IA  +E+ L  + +V+     +LL    ++  C+R +G  +  +Y  +KILY +N +GQI+L+  FL          +G+ +L D+++G+ W ++  FPRV  C    +  +G  + +  QC L +NM NEK+++FLWFW   +   T+ S+  WI+      ++ +F+ ++L     Y K    + L +FV  FLR DG+F+LR+++ +AG++   ++   LW  Y ++   K
Sbjct:    1 MSMLLYYFASAVKSIQFHVD-----DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGY-KMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGK 382          
BLAST of Pgr_014738 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 174.481 bits (441), Expect = 1.150e-46
Identity = 108/348 (31.03%), Postives = 188/348 (54.02%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGT--IPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFC-CSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXXXXXXXXXXXXXXSCYEKTKHRE--ILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWE 1275
            K+Y+   + C++P + + D  + Y +NYCWV  T  +PM+  E +P      I     R+I YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A       +  +V  +A  ++D      + +    R   +   +   C R  G ++  +Y  IK+LY  N + Q +L+ H L  G+   D  +G ++L D++    W    MFPRV  C    +  +G  + +  QC L +NM NEK+++FLWFW +   I+TV +   WI  M    +   F++++L+    +      +   L +F   FLR DG+F+LR+IS +AG++++++++  LW+
Sbjct:  164 KQYVGFPIQCWVPATFT-DAMEQYTENYCWVQNTYWVPMQ--EDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSN--DLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Pgr_014738 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 160.999 bits (406), Expect = 3.487e-42
Identity = 110/367 (29.97%), Postives = 179/367 (48.77%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAK-KAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRM-----SXXXXXXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRTANVSD 1329
            K++    + C  P    G  ++ Y +NYCW   T  +   + + +   E      +R+++YYQWVPF L LQ   F  P  +W+    N SG  +  +V  AK  A  E  +  K+ +    H    L F+  + +    ++  +KT  F   + +  F+  IY   K+LY LN   Q+YLM +FL  GT +    +G  ++ DI+ G+ W  +  FPR A C    +  V     Y  QC L +N+ NEK+++ LWFW V +L+ + +S+  W   +     S    ++      L+  +     +    +S+FVT +L  DG+F+LR++S +AG I  TD+V  L+E Y      KD + + VSD
Sbjct:   45 KQFGGRPIECMFPNKFPGS-WEQYAENYCWSQDTYFVEPTQDVSLLKKE-ERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKY-FSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERK---KVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFL--GTNR-HHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFE-VRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSD 401          
BLAST of Pgr_014738 vs. uniprot
Match: gi|10719983|sp|Q27295|EAT5_CAEEL (RecName: Full=Innexin eat-5; AltName: Full=Abnormal pharyngeal pumping eat-5)

HSP 1 Score: 151.754 bits (382), Expect = 2.875e-39
Identity = 97/360 (26.94%), Postives = 180/360 (50.00%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFRMSXXXX-------------XXXXXXXXXXXXSCYEKTKHREILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKE 1287
            ++Y+ + + C++P   +   ++ Y ++YC+V+ T  ++ N+ +P+T  E +     +++ YYQW PF++ ++   FYLP + W + +   SG ++  LV +A+KA       RK  ++ I   + +   +RR     E    +          + G ++ ++Y + K++Y+ N+  Q Y    FL     Q D  +GM IL DI+ G  W  +  FPR+A C    +  +G    Y  QC L +NM NEK+++FL+ W + V  +T+       + M    K             + +  ++  + R  Y K +H  +LS+F       D I +L++I+ + GDI+ T+IVG++W  + E
Sbjct:   42 RQYVGSPLQCWVPAQFTK-AWEQYAEDYCFVYNTYWVKPNDKVPLTVEERV----SQQLIYYQWAPFIMAIEAAFFYLPVIFWSM-LSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRR----NEEETTKMAKIQRIFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFL----GQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQ-VRVLGNLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLE 386          
BLAST of Pgr_014738 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 150.599 bits (379), Expect = 8.417e-39
Identity = 123/402 (30.60%), Postives = 199/402 (49.50%), Query Frame = 1
Query:  166 GVEDGADKAXXXXXXXXXXXXXXXXXXKEYILNSMSCYIPISISGDKFDTYVKNYCWVHGT--IPMRSNETLPMTATEWIIMDSERRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMS-RKDSVEQIAHCLEDLFFERRVLKSYEHRL------LRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVGVLIITVLSIPIWIFR--MSXXXXXXXXXXXXXXXXSCYEKTKHRE-----------------ILSQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKE 1287
            G +D  D+ ++ ++  IL V  ++IS K+Y    + C++    S +  + Y+++YCW+  T  IPM  N     TA E      E++I YYQWVPF+L  + ++F LP + W+L  +  SG +++ L+ +A  A   +  S R+ +VE I  C    F +   L+S   R+       R K S F     +G  +  +Y   K+LY +N + Q +++   L+         FG  +L DI +G+ W +   FPRV  C    +  +   N Y  QCAL +N++NEK++ FLW W + + IIT  S   WI    +   +         +   S Y+K +  E                 +L  FV+ FL+ DGI +LR+IS +AGD+I   +V  LW+ Y+E
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE------EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAIT-CN---FVDNLDLQSPNGRIRARGWIARIKFSRFL----SGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF---FGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRE 400          
BLAST of Pgr_014738 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 86.2705 bits (212), Expect = 3.711e-18
Identity = 73/275 (26.55%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPM------RSNETLPMTATEWIIMDSERR-------INYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFER-RVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLM---FPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFW 1020
            ++Y+ N + C     I  D  +TY    CW+H T  +      +    +P       + +S+ R         YYQWV F L  Q ILFY PR +W+    +  G  +  L++       +IG+  +   +Q    L D  +E  R    + +R                      Y++ ++L L+N IGQ++LM  F      +  T FG+ ++  + + +    + M   FPR+  C      + G    + A C LP+N++NEK+YIFLWFW
Sbjct:   33 RQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPG----VHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDL-----DIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYR----------------------YYVCELLALINVIGQMFLMNRFF---DGEFIT-FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264          
BLAST of Pgr_014738 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 86.2705 bits (212), Expect = 4.672e-18
Identity = 73/275 (26.55%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPM------RSNETLPMTATEWIIMDSERR-------INYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFER-RVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLM---FPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFW 1020
            ++Y+ N + C     I  D  +TY    CW+H T  +      +    +P       + +S+ R         YYQWV F L  Q ILFY PR +W+    +  G  +  L++       +IG+  +   +Q    L D  +E  R    + +R                      Y++ ++L L+N IGQ++LM  F      +  T FG+ ++  + + +    + M   FPR+  C      + G    + A C LP+N++NEK+YIFLWFW
Sbjct:   49 RQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPG----VHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMD-----LDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYR----------------------YYVCELLALINVIGQMFLMNRFF---DGEFIT-FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280          
BLAST of Pgr_014738 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 86.2705 bits (212), Expect = 4.672e-18
Identity = 73/275 (26.55%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPM------RSNETLPMTATEWIIMDSERR-------INYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFER-RVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLM---FPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFW 1020
            ++Y+ N + C     I  D  +TY    CW+H T  +      +    +P       + +S+ R         YYQWV F L  Q ILFY PR +W+    +  G  +  L++       +IG+  +   +Q    L D  +E  R    + +R                      Y++ ++L L+N IGQ++LM  F      +  T FG+ ++  + + +    + M   FPR+  C      + G    + A C LP+N++NEK+YIFLWFW
Sbjct:   49 RQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPG----VHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMD-----LDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYR----------------------YYVCELLALINVIGQMFLMNRFF---DGEFIT-FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280          
BLAST of Pgr_014738 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 86.2705 bits (212), Expect = 4.672e-18
Identity = 73/275 (26.55%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPM------RSNETLPMTATEWIIMDSERR-------INYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFER-RVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLM---FPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFW 1020
            ++Y+ N + C     I  D  +TY    CW+H T  +      +    +P       + +S+ R         YYQWV F L  Q ILFY PR +W+    +  G  +  L++       +IG+  +   +Q    L D  +E  R    + +R                      Y++ ++L L+N IGQ++LM  F      +  T FG+ ++  + + +    + M   FPR+  C      + G    + A C LP+N++NEK+YIFLWFW
Sbjct:   49 RQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPG----VHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMD-----LDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYR----------------------YYVCELLALINVIGQMFLMNRFF---DGEFIT-FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 280          
BLAST of Pgr_014738 vs. RefSeq Drosophila melanogaster
Match: gi|161077972|ref|NP_608410.2| (shaking B, isoform D [Drosophila melanogaster])

HSP 1 Score: 85.8853 bits (211), Expect = 1.527e-17
Identity = 79/306 (25.82%), Postives = 132/306 (43.14%), Query Frame = 1
Query:  247 KEYILNSMSCYIPISISGDKFDTYVKNYCWVHGTIPM------RSNETLPMTATEWIIMDSERR-------INYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAVTEIGMSRKDSVEQIAHCLEDLFFER-RVLKSYEHRLLRNKTSMFCCSRRTGVFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIISGKTWNDNLM---FPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLWFWTVG------------VLIITVLSIPIWIFRM 1077
            ++Y+ N + C     I  D  +TY    CW+H T  +      +    +P       + +S+ R         YYQWV F L  Q ILFY PR +W+    +  G  +  L++       +IG+  +   +Q    L D  +E  R    + +R                      Y++ ++L L+N IGQ++LM  F      +  T FG+ ++  + + +    + M   FPR+  C      + G    + A C LP+N++NEK+YIFLWFW +             V+II    + +++FRM
Sbjct:  204 RQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPG----VHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMD-----LDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYR----------------------YYVCELLALINVIGQMFLMNRFF---DGEFIT-FGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRM 466          
The following BLAST results are available for this feature:
BLAST of Pgr_014738 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pgr_014738 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150036482.648e-17464.60SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150036491.601e-17263.61SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150009181.209e-12148.28Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150008377.759e-12048.14Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006572.386e-10843.55Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Pgr_014738 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL6.879e-5030.77RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.150e-4631.03RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|10720052|sp|Q23157|INX11_CAEEL3.487e-4229.97RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
gi|10719983|sp|Q27295|EAT5_CAEEL2.875e-3926.94RecName: Full=Innexin eat-5; AltName: Full=Abnorma... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR8.417e-3930.60RecName: Full=Innexin-19[more]
back to top
BLAST of Pgr_014738 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24643566|ref|NP_523425.2|3.711e-1826.55shaking B, isoform C [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|4.672e-1826.55shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|4.672e-1826.55shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|4.672e-1826.55shaking B, isoform I [Drosophila melanogaster][more]
gi|161077972|ref|NP_608410.2|1.527e-1725.82shaking B, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_014738 ID=Pgr_014738|Name=Pgr_014738|organism=Phagocata gracilis|type=mRNA|length=1412bp
AAGACGCCACATAATTAGATATTCGTTTGTGAACTGCTATCGGAATTCAA
TTTAGTATTTCTGATTGATTATATCTTAAATCAATTTCTAAGAAAATCTA
ATTACACTTTTCGAATGGAAAACCTGTTGATATATTTTTCGAAGTTTCAT
GTGACCACCTATGTTGGAGTTGAAGACGGAGCGGACAAAGCGAGTTTTCT
ATTCAGTGTTACGATACTGTTGGTTTCATCGATAATCATTTCTACAAAGG
AATATATTCTAAATTCAATGTCTTGTTACATTCCGATATCGATTTCTGGT
GATAAATTCGATACATATGTGAAGAATTACTGTTGGGTTCACGGTACAAT
TCCTATGCGGAGTAATGAAACCTTGCCTATGACTGCCACTGAATGGATTA
TTATGGATTCAGAGAGGCGAATAAATTACTATCAGTGGGTACCGTTCGTG
CTTGGACTTCAAGGCATTCTATTTTACCTGCCTCGAATGATCTGGCAACT
GGTGATCTACAATTTAAGTGGCAACGACCTTGAAGGTCTTGTCATAAGTG
CCAAGAAAGCCGTCACTGAAATCGGAATGTCTCGAAAAGATTCCGTTGAA
CAAATTGCCCATTGTTTGGAGGATTTATTCTTCGAAAGACGAGTTTTGAA
GTCGTACGAACATCGATTGTTGAGAAATAAAACGTCAATGTTTTGCTGCA
GTAGAAGAACGGGAGTATTTCTATTCAGTATTTATTTCATTATTAAAATA
TTGTATTTACTAAATGCTATCGGACAAATTTATTTGATGCAACATTTTCT
TCGAATCGGAACCACTCAATTGGACACGGGATTCGGAATGACCATTCTAA
TGGATATAATCTCTGGGAAAACCTGGAATGATAATTTGATGTTTCCTCGG
GTAGCGTACTGTTACATTGGCGGAATATCGACTGTTGGTACCTCGAATCC
ATACATTGCCCAGTGTGCATTGCCAGTAAATATGCTCAATGAGAAGTTAT
ACATTTTCCTGTGGTTCTGGACTGTCGGAGTGCTGATTATAACTGTACTG
AGTATACCGATTTGGATTTTTCGAATGTCCTTTATCCGGAAAAGACGAGA
TTTTATTAAGAGATTTCTGAAACGTCGTTCTTGTTACGAAAAAACAAAGC
ATCGAGAGATTTTATCTCAATTTGTTACTTGCTTTCTAAGACACGACGGA
ATTTTCATTTTAAGAATTATTTCATTAAATGCTGGGGATATAATAACTAC
AGATATTGTGGGTAAATTATGGGAAATTTACAAGGAGTCCTACACTGAGA
AGGATTTCCGCACTGCCAATGTATCAGATAAGTATGTGTAAAATTTAAAA
TTTGAATCAATCTTTTATTTACATTTTATCTGTATTCACGTGATATAACT
GGTCTTTATAAA

Design Primers for Pgr_014738

back to top

protein sequence

>Pgr_014738-protein ID=Pgr_014738-protein|Name=Pgr_014738|organism=Phagocata gracilis|type=polypeptide|length=409bp
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
back to top

coding sequence

>Pgr_014738.115.1341 ID=Pgr_014738.115.1341|Name=Pgr_014738.115.1341|organism=Phagocata gracilis|type=CDS|length=1227bp
ATGGAAAACCTGTTGATATATTTTTCGAAGTTTCATGTGACCACCTATGT
TGGAGTTGAAGACGGAGCGGACAAAGCGAGTTTTCTATTCAGTGTTACGA
TACTGTTGGTTTCATCGATAATCATTTCTACAAAGGAATATATTCTAAAT
TCAATGTCTTGTTACATTCCGATATCGATTTCTGGTGATAAATTCGATAC
ATATGTGAAGAATTACTGTTGGGTTCACGGTACAATTCCTATGCGGAGTA
ATGAAACCTTGCCTATGACTGCCACTGAATGGATTATTATGGATTCAGAG
AGGCGAATAAATTACTATCAGTGGGTACCGTTCGTGCTTGGACTTCAAGG
CATTCTATTTTACCTGCCTCGAATGATCTGGCAACTGGTGATCTACAATT
TAAGTGGCAACGACCTTGAAGGTCTTGTCATAAGTGCCAAGAAAGCCGTC
ACTGAAATCGGAATGTCTCGAAAAGATTCCGTTGAACAAATTGCCCATTG
TTTGGAGGATTTATTCTTCGAAAGACGAGTTTTGAAGTCGTACGAACATC
GATTGTTGAGAAATAAAACGTCAATGTTTTGCTGCAGTAGAAGAACGGGA
GTATTTCTATTCAGTATTTATTTCATTATTAAAATATTGTATTTACTAAA
TGCTATCGGACAAATTTATTTGATGCAACATTTTCTTCGAATCGGAACCA
CTCAATTGGACACGGGATTCGGAATGACCATTCTAATGGATATAATCTCT
GGGAAAACCTGGAATGATAATTTGATGTTTCCTCGGGTAGCGTACTGTTA
CATTGGCGGAATATCGACTGTTGGTACCTCGAATCCATACATTGCCCAGT
GTGCATTGCCAGTAAATATGCTCAATGAGAAGTTATACATTTTCCTGTGG
TTCTGGACTGTCGGAGTGCTGATTATAACTGTACTGAGTATACCGATTTG
GATTTTTCGAATGTCCTTTATCCGGAAAAGACGAGATTTTATTAAGAGAT
TTCTGAAACGTCGTTCTTGTTACGAAAAAACAAAGCATCGAGAGATTTTA
TCTCAATTTGTTACTTGCTTTCTAAGACACGACGGAATTTTCATTTTAAG
AATTATTTCATTAAATGCTGGGGATATAATAACTACAGATATTGTGGGTA
AATTATGGGAAATTTACAAGGAGTCCTACACTGAGAAGGATTTCCGCACT
GCCAATGTATCAGATAAGTATGTGTAA
back to top
Gene Groups
Pgr_014738 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.