Pgr_007521, Pgr_007521 (mRNA) Phagocata gracilis

Overview
NamePgr_007521
Unique NamePgr_007521
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length2778
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_007521 vs. RefSeq Human
Match: gi|221316711|ref|NP_689644.2| (piwi-like protein 4 [Homo sapiens])

HSP 1 Score: 90.1225 bits (222), Expect = 1.770e-17
Identity = 82/365 (22.47%), Postives = 156/365 (42.74%), Query Frame = 2
Query: 1700 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTC--GPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 2770
            +  + +    QLIG  ++T+YNN+TY I +I   +     F+   G  ++Y +Y+K +Y+I ++  +QP +++ +KK                          E  +   IP ELCFL G +DQ  S+  L K++    +  P  R   +    + I+ + NA      W L   ++ + + GR +P   ++  ++        DW K  R    +     +   ++  DR ++  ++F+N + +   +M  +    K+      P    R +           ++ +  +P ++   Y  +K +  S   + +QCV  R  T         ++ K  MQ+  K G + W VEI L+  M+VG+D
Sbjct:  286 LSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDN--------------------SEAQLAHLIP-ELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQ-ISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV---DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLAR--TLNKQGMMMSIATKIAMQMTCKLGGELWAVEIPLKSLMVVGID 623          

HSP 2 Score: 90.1225 bits (222), Expect = 1.770e-17
Identity = 82/365 (22.47%), Postives = 156/365 (42.74%), Query Frame = -2
Query:    9 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTC--GPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 1079
            +  + +    QLIG  ++T+YNN+TY I +I   +     F+   G  ++Y +Y+K +Y+I ++  +QP +++ +KK                          E  +   IP ELCFL G +DQ  S+  L K++    +  P  R   +    + I+ + NA      W L   ++ + + GR +P   ++  ++        DW K  R    +     +   ++  DR ++  ++F+N + +   +M  +    K+      P    R +           ++ +  +P ++   Y  +K +  S   + +QCV  R  T         ++ K  MQ+  K G + W VEI L+  M+VG+D
Sbjct:  286 LSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDN--------------------SEAQLAHLIP-ELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQ-ISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV---DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLAR--TLNKQGMMMSIATKIAMQMTCKLGGELWAVEIPLKSLMVVGID 623          
BLAST of Pgr_007521 vs. RefSeq Human
Match: gi|300244501|ref|NP_001177900.1| (piwi-like protein 1 isoform 2 [Homo sapiens])

HSP 1 Score: 88.9669 bits (219), Expect = 3.129e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          

HSP 2 Score: 88.9669 bits (219), Expect = 3.129e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          
BLAST of Pgr_007521 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 89.3521 bits (220), Expect = 3.170e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          

HSP 2 Score: 89.3521 bits (220), Expect = 3.170e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          
BLAST of Pgr_007521 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 89.3521 bits (220), Expect = 3.170e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          

HSP 2 Score: 89.3521 bits (220), Expect = 3.170e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          
BLAST of Pgr_007521 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 89.3521 bits (220), Expect = 3.170e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          

HSP 2 Score: 89.3521 bits (220), Expect = 3.170e-17
Identity = 103/481 (21.41%), Postives = 198/481 (41.16%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKI--NEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +T+ L   + P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G      N +  D  K  R    I         ++   RN     + + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D Y
Sbjct:  193 ITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCY 634          
BLAST of Pgr_007521 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 432/464 (93.10%), Postives = 449/464 (96.77%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPM--XXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +TLRLV+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPM   R+++     +KEKE+E+EKEAP+EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
Sbjct:  135 MTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 598          

HSP 2 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 432/464 (93.10%), Postives = 449/464 (96.77%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPM--XXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +TLRLV+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPM   R+++     +KEKE+E+EKEAP+EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
Sbjct:  135 MTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 598          
BLAST of Pgr_007521 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 515.768 bits (1327), Expect = 4.740e-168
Identity = 248/469 (52.88%), Postives = 340/469 (72.49%), Query Frame = 2
Query: 1373 LVVKSI-LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            LV+K + +++RL+ T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M            +++ E E E P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+
Sbjct:  160 LVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSM---------VRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR--VSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTF 614          

HSP 2 Score: 515.768 bits (1327), Expect = 4.740e-168
Identity = 248/469 (52.88%), Postives = 340/469 (72.49%), Query Frame = -2
Query:    3 LVVKSI-LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1406
            LV+K + +++RL+ T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M            +++ E E E P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+
Sbjct:  160 LVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSM---------VRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR--VSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTF 614          
BLAST of Pgr_007521 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 82.0333 bits (201), Expect = 9.957e-16
Identity = 83/378 (21.96%), Postives = 169/378 (44.71%), Query Frame = 2
Query: 1670 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD--MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNN-KINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND--VERCLNDAARSGSGSAKMA---LVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK+ Y +++   +QP ++++               +    + +  +  +E D  +   IP ELC L G +D    +  L + L    +  P++R + +  F + I   + A  +   W + I+   + I   ++ P  +  GN   ++     ++K       +    + E  ++I  ++     N +       ++ R+    GK      N+   E  L +  R+ +   ++    L  V +DR  A  K   +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VG+D +
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK--------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVW 744          

HSP 2 Score: 82.0333 bits (201), Expect = 9.957e-16
Identity = 83/378 (21.96%), Postives = 169/378 (44.71%), Query Frame = -2
Query:    3 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD--MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNN-KINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND--VERCLNDAARSGSGSAKMA---LVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1109
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK+ Y +++   +QP ++++               +    + +  +  +E D  +   IP ELC L G +D    +  L + L    +  P++R + +  F + I   + A  +   W + I+   + I   ++ P  +  GN   ++     ++K       +    + E  ++I  ++     N +       ++ R+    GK      N+   E  L +  R+ +   ++    L  V +DR  A  K   +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VG+D +
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK--------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVW 744          
BLAST of Pgr_007521 vs. Smed Unigenes AA
Match: SMU15015027 (SmedAsxldir_c97534_g1_i3|m.40524|m.26292)

HSP 1 Score: 53.9138 bits (128), Expect = 2.119e-8
Identity = 32/90 (35.56%), Postives = 53/90 (58.89%), Query Frame = 2
Query: 1799 MNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQE 2068
            M+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ +           ++++ E E E P E D +L+I GEL +     +Q+
Sbjct:    1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSV---------VRQKEKIENEPEGPTETDQSLSISGELGYGLELVNQK 81          

HSP 2 Score: 53.9138 bits (128), Expect = 2.119e-8
Identity = 32/90 (35.56%), Postives = 53/90 (58.89%), Query Frame = -2
Query:  711 MNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQE 980
            M+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ +           ++++ E E E P E D +L+I GEL +     +Q+
Sbjct:    1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSV---------VRQKEKIENEPEGPTETDQSLSISGELGYGLELVNQK 81          
BLAST of Pgr_007521 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 434/462 (93.94%), Postives = 446/462 (96.54%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +TLRLV+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE     EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
Sbjct:  135 MTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPE--EKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 594          

HSP 2 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 434/462 (93.94%), Postives = 446/462 (96.54%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +TLRLV+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE     EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
Sbjct:  135 MTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPE--EKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 594          
BLAST of Pgr_007521 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 343/462 (74.24%), Postives = 398/462 (86.15%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            ++LRLV+T L +TEEYYQMINVLLNNLQ++MGQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFK+RYNI LT   QPFVLTRVKK              +++   E EAP++ D+TLNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERLDDIP+FC+WI+ ++N+ GM NKW LKIDN PLEIEGRELP CDVISG  +INEKI DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSG AK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVS+KTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+
Sbjct:  128 VSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK---------IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTF 580          

HSP 2 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 343/462 (74.24%), Postives = 398/462 (86.15%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            ++LRLV+T L +TEEYYQMINVLLNNLQ++MGQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFK+RYNI LT   QPFVLTRVKK              +++   E EAP++ D+TLNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERLDDIP+FC+WI+ ++N+ GM NKW LKIDN PLEIEGRELP CDVISG  +INEKI DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSG AK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVS+KTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+
Sbjct:  128 VSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK---------IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTF 580          
BLAST of Pgr_007521 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 516.538 bits (1329), Expect = 1.164e-167
Identity = 248/469 (52.88%), Postives = 340/469 (72.49%), Query Frame = 2
Query: 1373 LVVKSI-LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            LV+K + +++RL+ T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M            +++ E E E P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+
Sbjct:  117 LVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSM---------VRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR--VSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTF 571          

HSP 2 Score: 516.538 bits (1329), Expect = 1.164e-167
Identity = 248/469 (52.88%), Postives = 340/469 (72.49%), Query Frame = -2
Query:    3 LVVKSI-LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1406
            LV+K + +++RL+ T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M            +++ E E E P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+
Sbjct:  117 LVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSM---------VRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR--VSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTF 571          
BLAST of Pgr_007521 vs. uniprot
Match: gi|33112431|sp|Q9VKM1|PIWI_DROME (RecName: Full=Protein piwi)

HSP 1 Score: 109.383 bits (272), Expect = 4.467e-23
Identity = 112/506 (22.13%), Postives = 217/506 (42.89%), Query Frame = 2
Query: 1340 STLQFLEELWLLVVKSIL------TLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 2770
            +T +F +E+ +L  KS L      +++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +                        ++ + IP ELC + G + + +SN  L +++ S  +  P++R D + AF + ++ +  +  +   W +++D    E++GR +   +++  N K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S   K  +Q+  K GY PW +E+ L   M +G D
Sbjct:  155 TTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKT--------------------NASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRS---DPKLILCLVPNDNAERYSSIK----KRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFD 614          

HSP 2 Score: 109.383 bits (272), Expect = 4.467e-23
Identity = 112/506 (22.13%), Postives = 217/506 (42.89%), Query Frame = -2
Query:    9 STLQFLEELWLLVVKSIL------TLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 1439
            +T +F +E+ +L  KS L      +++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +                        ++ + IP ELC + G + + +SN  L +++ S  +  P++R D + AF + ++ +  +  +   W +++D    E++GR +   +++  N K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S   K  +Q+  K GY PW +E+ L   M +G D
Sbjct:  155 TTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKT--------------------NASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRS---DPKLILCLVPNDNAERYSSIK----KRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFD 614          
BLAST of Pgr_007521 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 105.531 bits (262), Expect = 7.749e-22
Identity = 115/486 (23.66%), Postives = 201/486 (41.36%), Query Frame = 2
Query: 1391 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKIN-EKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            +T+ L   + P +    Q  N+L   +  ++  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+                               + +P E C+L G +D+ +++ ++ K L S  +  P +R   I    + I  + +       W L  +NK L + GR LP   +I G           DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V+ K  +Q+  K G + W+VEI LR  MIVG+D Y
Sbjct:  191 ITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR-------------------LGPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCY 631          

HSP 2 Score: 105.531 bits (262), Expect = 7.749e-22
Identity = 115/486 (23.66%), Postives = 201/486 (41.36%), Query Frame = -2
Query:    3 LTLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKIN-EKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDR--VYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1388
            +T+ L   + P +    Q  N+L   +  ++  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+                               + +P E C+L G +D+ +++ ++ K L S  +  P +R   I    + I  + +       W L  +NK L + GR LP   +I G           DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V+ K  +Q+  K G + W+VEI LR  MIVG+D Y
Sbjct:  191 ITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR-------------------LGPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCY 631          
BLAST of Pgr_007521 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 109.383 bits (272), Expect = 5.156e-24
Identity = 112/506 (22.13%), Postives = 217/506 (42.89%), Query Frame = 2
Query: 1340 STLQFLEELWLLVVKSIL------TLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 2770
            +T +F +E+ +L  KS L      +++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +                        ++ + IP ELC + G + + +SN  L +++ S  +  P++R D + AF + ++ +  +  +   W +++D    E++GR +   +++  N K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S   K  +Q+  K GY PW +E+ L   M +G D
Sbjct:  155 TTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKT--------------------NASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRS---DPKLILCLVPNDNAERYSSIK----KRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFD 614          

HSP 2 Score: 109.383 bits (272), Expect = 5.156e-24
Identity = 112/506 (22.13%), Postives = 217/506 (42.89%), Query Frame = -2
Query:    9 STLQFLEELWLLVVKSIL------TLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 1439
            +T +F +E+ +L  KS L      +++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +                        ++ + IP ELC + G + + +SN  L +++ S  +  P++R D + AF + ++ +  +  +   W +++D    E++GR +   +++  N K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S   K  +Q+  K GY PW +E+ L   M +G D
Sbjct:  155 TTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKT--------------------NASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRS---DPKLILCLVPNDNAERYSSIK----KRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFD 614          
BLAST of Pgr_007521 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 109.383 bits (272), Expect = 5.156e-24
Identity = 112/506 (22.13%), Postives = 217/506 (42.89%), Query Frame = 2
Query: 1340 STLQFLEELWLLVVKSIL------TLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 2770
            +T +F +E+ +L  KS L      +++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +                        ++ + IP ELC + G + + +SN  L +++ S  +  P++R D + AF + ++ +  +  +   W +++D    E++GR +   +++  N K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S   K  +Q+  K GY PW +E+ L   M +G D
Sbjct:  155 TTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKT--------------------NASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRS---DPKLILCLVPNDNAERYSSIK----KRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFD 614          

HSP 2 Score: 109.383 bits (272), Expect = 5.156e-24
Identity = 112/506 (22.13%), Postives = 217/506 (42.89%), Query Frame = -2
Query:    9 STLQFLEELWLLVVKSIL------TLRLVATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMD 1439
            +T +F +E+ +L  KS L      +++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +                        ++ + IP ELC + G + + +SN  L +++ S  +  P++R D + AF + ++ +  +  +   W +++D    E++GR +   +++  N K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S   K  +Q+  K GY PW +E+ L   M +G D
Sbjct:  155 TTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKT--------------------NASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRS---DPKLILCLVPNDNAERYSSIK----KRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFD 614          
BLAST of Pgr_007521 vs. RefSeq Drosophila melanogaster
Match: gi|281366635|ref|NP_001163498.1| (argonaute 3, isoform G [Drosophila melanogaster])

HSP 1 Score: 91.2781 bits (225), Expect = 2.328e-18
Identity = 80/366 (21.86%), Postives = 168/366 (45.90%), Query Frame = 2
Query: 1700 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+Y
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSY 645          

HSP 2 Score: 91.2781 bits (225), Expect = 2.328e-18
Identity = 80/366 (21.86%), Postives = 168/366 (45.90%), Query Frame = -2
Query:    3 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1079
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+Y
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSY 645          
BLAST of Pgr_007521 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 90.8929 bits (224), Expect = 2.605e-18
Identity = 80/366 (21.86%), Postives = 168/366 (45.90%), Query Frame = 2
Query: 1700 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+Y
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSY 645          

HSP 2 Score: 90.8929 bits (224), Expect = 2.605e-18
Identity = 80/366 (21.86%), Postives = 168/366 (45.90%), Query Frame = -2
Query:    3 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1079
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+Y
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSY 645          
BLAST of Pgr_007521 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 90.8929 bits (224), Expect = 2.605e-18
Identity = 80/366 (21.86%), Postives = 168/366 (45.90%), Query Frame = 2
Query: 1700 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 2776
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+Y
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSY 645          

HSP 2 Score: 90.8929 bits (224), Expect = 2.605e-18
Identity = 80/366 (21.86%), Postives = 168/366 (45.90%), Query Frame = -2
Query:    3 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY 1079
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+Y
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSY 645          
The following BLAST results are available for this feature:
BLAST of Pgr_007521 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221316711|ref|NP_689644.2|1.770e-1722.47piwi-like protein 4 [Homo sapiens][more]
gi|300244501|ref|NP_001177900.1|3.129e-1721.41piwi-like protein 1 isoform 2 [Homo sapiens][more]
gi|66346725|ref|NP_004755.2|3.170e-1721.41piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|3.170e-1721.41PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|3.170e-1721.41PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Pgr_007521 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150159470.000e+093.10SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261774.740e-16852.88SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001119.957e-1621.96Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150150272.119e-835.56SmedAsxldir_c97534_g1_i3|m.40524|m.26292[more]
back to top
BLAST of Pgr_007521 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+093.94RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+074.24RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD1.164e-16752.88RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|33112431|sp|Q9VKM1|PIWI_DROME4.467e-2322.13RecName: Full=Protein piwi[more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE7.749e-2223.66RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Pgr_007521 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|5.156e-2422.13piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|5.156e-2422.13piwi, isoform B [Drosophila melanogaster][more]
gi|281366635|ref|NP_001163498.1|2.328e-1821.86argonaute 3, isoform G [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|2.605e-1821.86argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|2.605e-1821.86argonaute 3, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_007521 ID=Pgr_007521|Name=Pgr_007521|organism=Phagocata gracilis|type=mRNA|length=2778bp
TGATATGTATCCATACCAACAATCATCGTAGGCCGCAATTTAATTTCAAC
AGTCCATGGATCGTAACCAAATTTGGCAAATATTTGCATAACCGTTTTAT
TCGAAACAACTTTCCTGCGTTTATCATTTCTGTTTGTTCCATTCCTCGTG
GTAACACACTGTGTTAAAAGTCCGGTGCTCATGGTAAATGATTTAACCTT
TGCATAAACTCGATCATCCGGGACAAAAACCAAGGCCATTTTTGCAGAGC
CACTGCCGCTTCTTGCGGCATCATTCAAGCATCTCTCAACGTCATTTGGC
CCGCATGTATTAACTTTACCAACTCTGGCATCTATTCTCATATTTCTTAA
TTCCTGTTCTACGTCATTCATGAAATTTTTATATTGGAAATCATTTCTAT
CAACAATTACAACATCAATTTCGTGTTTACGGTCTCTTTTAATATCAAAC
TGCACTCTTCCAAATTTCCAATCATCTGGAATTTTCTCGTTAATTTTATT
ATTACCACTTATAACATCACATGGTGGCAATTCACGACCTTCTATTTCCA
ATGGTTTATTATCAATCTTTAATTGCCACTTATTACACATTCCGTTTGCA
TTGTCACTGCCTCTAATCCAATTACAAAAGGCTGGAATATCATCAAGTCT
TTCGCGTGGTTCTCTTTTTAAAACACTACCCAGGCTTTTTTGAAGGTCCA
TGTTCGATTTTTCTTGATCTGAAAATCCACATAGGAAGCATAGTTCACCT
GGAATATTCAATGTCATATCTTTTTCTTGAGGTGCTTCCTTTTCCTTTTC
CCTTTCTTTTTCTTTATCTTCTTCTCCAGGTTTTCTTCTTTCTCGGCGCA
TAGGCTTCTTAACTCTAGTTAAGACAAAAGGCTGATCGCCTTGTGTCAAG
CGTATGTTATATCGATCTTTGAAATATTCTGCGTACGATAAAGTACGTCC
ACCCATTTCAAATTTCTCATCAACATTCATTTCTTTTATCTCGGATATTC
TATAAGTTTTGTTATTATACTTCGTAATAATATCCCGGCCAATCAACTGG
TCAATACTTCGTCTATTGTAAGCTTTCATTACTGAATTGTCGTTCAAAAC
TCTGTTTATTCTCTCAATATACAATAATGTTGTTAGTTCTCCAGTTGGCT
TGGTACCTCTTTGTAATGTTGTTCCAAACCCTCCTAATACTTTAAAACTA
TTTGTTTCAAAGAATGTCGGACCACTGTTTCGAGGAACTTCGTCCTTAGT
TATATTTGGACTCAAAAAATATCCCTTTCCAATGCGTTCTTGACCCATCA
TTACCTGTAGATTGTTCAATAACACATTAATCATTTGGTAGTACTCTTCA
GTTTCTGGAAGAATTGTGGCTACTAGTCGTAAAGTCAATATTGACTTTAC
GACTAGTAGCCACAATTCTTCCAGAAACTGAAGAGTACTACCAAATGATT
AATGTGTTATTGAACAATCTACAGGTAATGATGGGTCAAGAACGCATTGG
AAAGGGATATTTTTTGAGTCCAAATATAACTAAGGACGAAGTTCCTCGAA
ACAGTGGTCCGACATTCTTTGAAACAAATAGTTTTAAAGTATTAGGAGGG
TTTGGAACAACATTACAAAGAGGTACCAAGCCAACTGGAGAACTAACAAC
ATTATTGTATATTGAGAGAATAAACAGAGTTTTGAACGACAATTCAGTAA
TGAAAGCTTACAATAGACGAAGTATTGACCAGTTGATTGGCCGGGATATT
ATTACGAAGTATAATAACAAAACTTATAGAATATCCGAGATAAAAGAAAT
GAATGTTGATGAGAAATTTGAAATGGGTGGACGTACTTTATCGTACGCAG
AATATTTCAAAGATCGATATAACATACGCTTGACACAAGGCGATCAGCCT
TTTGTCTTAACTAGAGTTAAGAAGCCTATGCGCCGAGAAAGAAGAAAACC
TGGAGAAGAAGATAAAGAAAAAGAAAGGGAAAAGGAAAAGGAAGCACCTC
AAGAAAAAGATATGACATTGAATATTCCAGGTGAACTATGCTTCCTATGT
GGATTTTCAGATCAAGAAAAATCGAACATGGACCTTCAAAAAAGCCTGGG
TAGTGTTTTAAAAAGAGAACCACGCGAAAGACTTGATGATATTCCAGCCT
TTTGTAATTGGATTAGAGGCAGTGACAATGCAAACGGAATGTGTAATAAG
TGGCAATTAAAGATTGATAATAAACCATTGGAAATAGAAGGTCGTGAATT
GCCACCATGTGATGTTATAAGTGGTAATAATAAAATTAACGAGAAAATTC
CAGATGATTGGAAATTTGGAAGAGTGCAGTTTGATATTAAAAGAGACCGT
AAACACGAAATTGATGTTGTAATTGTTGATAGAAATGATTTCCAATATAA
AAATTTCATGAATGACGTAGAACAGGAATTAAGAAATATGAGAATAGATG
CCAGAGTTGGTAAAGTTAATACATGCGGGCCAAATGACGTTGAGAGATGC
TTGAATGATGCCGCAAGAAGCGGCAGTGGCTCTGCAAAAATGGCCTTGGT
TTTTGTCCCGGATGATCGAGTTTATGCAAAGGTTAAATCATTTACCATGA
GCACCGGACTTTTAACACAGTGTGTTACCACGAGGAATGGAACAAACAGA
AATGATAAACGCAGGAAAGTTGTTTCGAATAAAACGGTTATGCAAATATT
TGCCAAATTTGGTTACGATCCATGGACTGTTGAAATTAAATTGCGGCCTA
CGATGATTGTTGGTATGGATACATATCA

Design Primers for Pgr_007521

back to top

protein sequence

>Pgr_007521-protein ID=Pgr_007521-protein|Name=Pgr_007521|organism=Phagocata gracilis|type=polypeptide|length=444bp
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
back to top

coding sequence

>Pgr_007521.1445.2776 ID=Pgr_007521.1445.2776|Name=Pgr_007521.1445.2776|organism=Phagocata gracilis|type=CDS|length=1332bp
ATGATTAATGTGTTATTGAACAATCTACAGGTAATGATGGGTCAAGAACG
CATTGGAAAGGGATATTTTTTGAGTCCAAATATAACTAAGGACGAAGTTC
CTCGAAACAGTGGTCCGACATTCTTTGAAACAAATAGTTTTAAAGTATTA
GGAGGGTTTGGAACAACATTACAAAGAGGTACCAAGCCAACTGGAGAACT
AACAACATTATTGTATATTGAGAGAATAAACAGAGTTTTGAACGACAATT
CAGTAATGAAAGCTTACAATAGACGAAGTATTGACCAGTTGATTGGCCGG
GATATTATTACGAAGTATAATAACAAAACTTATAGAATATCCGAGATAAA
AGAAATGAATGTTGATGAGAAATTTGAAATGGGTGGACGTACTTTATCGT
ACGCAGAATATTTCAAAGATCGATATAACATACGCTTGACACAAGGCGAT
CAGCCTTTTGTCTTAACTAGAGTTAAGAAGCCTATGCGCCGAGAAAGAAG
AAAACCTGGAGAAGAAGATAAAGAAAAAGAAAGGGAAAAGGAAAAGGAAG
CACCTCAAGAAAAAGATATGACATTGAATATTCCAGGTGAACTATGCTTC
CTATGTGGATTTTCAGATCAAGAAAAATCGAACATGGACCTTCAAAAAAG
CCTGGGTAGTGTTTTAAAAAGAGAACCACGCGAAAGACTTGATGATATTC
CAGCCTTTTGTAATTGGATTAGAGGCAGTGACAATGCAAACGGAATGTGT
AATAAGTGGCAATTAAAGATTGATAATAAACCATTGGAAATAGAAGGTCG
TGAATTGCCACCATGTGATGTTATAAGTGGTAATAATAAAATTAACGAGA
AAATTCCAGATGATTGGAAATTTGGAAGAGTGCAGTTTGATATTAAAAGA
GACCGTAAACACGAAATTGATGTTGTAATTGTTGATAGAAATGATTTCCA
ATATAAAAATTTCATGAATGACGTAGAACAGGAATTAAGAAATATGAGAA
TAGATGCCAGAGTTGGTAAAGTTAATACATGCGGGCCAAATGACGTTGAG
AGATGCTTGAATGATGCCGCAAGAAGCGGCAGTGGCTCTGCAAAAATGGC
CTTGGTTTTTGTCCCGGATGATCGAGTTTATGCAAAGGTTAAATCATTTA
CCATGAGCACCGGACTTTTAACACAGTGTGTTACCACGAGGAATGGAACA
AACAGAAATGATAAACGCAGGAAAGTTGTTTCGAATAAAACGGTTATGCA
AATATTTGCCAAATTTGGTTACGATCCATGGACTGTTGAAATTAAATTGC
GGCCTACGATGATTGTTGGTATGGATACATAT
back to top
Gene Groups
Pgr_007521 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.