Pgr_002280, Pgr_002280 (mRNA) Phagocata gracilis

Overview
NamePgr_002280
Unique NamePgr_002280
TypemRNA
OrganismPhagocata gracilis (P. gracilis)
Sequence length980
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata gracilis Transcriptome2016-04-28
Phagocata gracilis BLASTX Human2016-03-08
Phagocata gracilis BLASTX Schmidtea mediterranea2016-03-08
Phagocata gracilis BLASTX Swissprot Uniprot2016-03-08
Phagocata gracilis BLASTX Drosophila melanogaster2016-03-09
Phagocata gracilis CDS2016-05-06
Homology
BLAST of Pgr_002280 vs. RefSeq Human
Match: gi|767975980|ref|XP_011537308.1| (PREDICTED: piwi-like protein 1 isoform X1 [Homo sapiens])

HSP 1 Score: 209.149 bits (531), Expect = 9.601e-62
Identity = 122/304 (40.13%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  101 TQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  203 SQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 481          
BLAST of Pgr_002280 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 206.838 bits (525), Expect = 5.117e-59
Identity = 122/304 (40.13%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  101 TQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  583 SQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pgr_002280 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 206.838 bits (525), Expect = 5.117e-59
Identity = 122/304 (40.13%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  101 TQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  583 SQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pgr_002280 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 206.838 bits (525), Expect = 5.117e-59
Identity = 122/304 (40.13%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  101 TQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  583 SQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pgr_002280 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 206.838 bits (525), Expect = 5.117e-59
Identity = 122/304 (40.13%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  101 TQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  583 SQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pgr_002280 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 244/321 (76.01%), Postives = 288/321 (89.72%), Query Frame = 2
Query:   17 AVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 979
              KMALVFV DD++YA+VK+FT++TGLLTQCVT RN TNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ KKSIQASV+SINSTFTQY+SF+N+PKGRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL*
Sbjct:  517 CAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          
BLAST of Pgr_002280 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 477.248 bits (1227), Expect = 8.798e-162
Identity = 223/328 (67.99%), Postives = 277/328 (84.45%), Query Frame = 2
Query:    2 DGIR-NAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 979
            D IR + V MALVF+ DDK+YA+VKNFT++TGLLTQCVTQRN +NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+HSKTGK+S+QASV+SI++ F+QY+SF+N+ KG+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  P  INDRIR+RLFYL*
Sbjct:  527 DFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          
BLAST of Pgr_002280 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 177.178 bits (448), Expect = 5.732e-49
Identity = 106/282 (37.59%), Postives = 160/282 (56.74%), Query Frame = 2
Query:  158 VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFF----KN-GQ--NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL* 979
            VA    +QI +K G + W V+I ++  M+VGLD +H   G+ +S+ A V S N+  T++ S  +  +  +E   VL     + L+ +  +    P+ I +YRDGV D Q+ + ++ E +    + E    D     P ++Y VV+KRI+T+ +    KN GQ  NP PGTIVD  V + N Y+FFLVSQ   +GT +PT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVPAP  YAH+LA ++G+  K    A  ++ + DRLFYL*
Sbjct:  710 VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK---PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLK----AEPSNLLCDRLFYL* 975          
BLAST of Pgr_002280 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 113.235 bits (282), Expect = 4.539e-27
Identity = 92/313 (29.39%), Postives = 143/313 (45.69%), Query Frame = 2
Query:   26 MALVFVSDDKMYARVKNF-TLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPT------MIVGLDTYHSKTGKK---SIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFF---------KNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLA 898
            + +V      +YA VK    +  GL TQCV  +N    ++K      S   ++I  K G     +   +RP       + +G D  H   G K   SI A V S+++  ++Y + ++    RQE  + L       L QF+      P RI+ YRDGV + Q       E  A++    KL   YQ      P I +VVV+KR  T+ F         ++G  P  GT VD+ +  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +PAP +YAH +A
Sbjct:  587 IVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQ------PGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPA-GTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Pgr_002280 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 109.383 bits (272), Expect = 7.168e-26
Identity = 96/337 (28.49%), Postives = 157/337 (46.59%), Query Frame = 2
Query:    2 DGIRNAVKMA-----LVFVS-DDKMYARVKNF-TLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVE-IKLR-------PTMIVGLDTYHSKTGK----KSIQASVYSINSTFTQYLSFINNPKGRQE------FHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQ--------NPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK 913
            D IRN+ K       LVFV  +D+ Y  VK F  +  G++TQC+  + AT    K         ++++  K G   W +  I+ R         M+ G+D  H  + +    KS+ A V S+++  T Y + I     ++E        E+    +   +  + +  ++ P+R++ YRDGV + Q     + E  A++   +KL +D     P I Y+VV+KR   +FF   +        N   GT+VDK++     ++F+L S    +GT+ P +Y+VL D               +ELQ  TY L H+Y     ++  PAPT+YAH LA   G+
Sbjct:  653 DTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGR 974          
BLAST of Pgr_002280 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 243/321 (75.70%), Postives = 287/321 (89.41%), Query Frame = 2
Query:   17 AVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFI-NNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 976
              KMALVFV DD++YA+VK+FT++TGLLTQCVT RN TNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ KKSIQASV+SINSTFTQY+SF+ N+PKGRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL
Sbjct:  513 CAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of Pgr_002280 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 509.22 bits (1310), Expect = 2.131e-173
Identity = 229/320 (71.56%), Postives = 276/320 (86.25%), Query Frame = 2
Query:   17 AVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 976
              K+ALVFV DD++YA+VK+FT++TGLLTQCVT RN TNR DKRRQVV+SK+VMQIFSKFGYDPW ++IK+RPTMIVG+DT+H+K  KKSI ASV+SINSTF+QY+SF N+PKG+QEFH+ L  NF AAL +F   Y+I P RIM+YRDGVGDSQ+ FTKQFE DA+KP++E +Y++ G  +PQIIYV+VKKRI TK F  G N  PGTIVDKE+VKPNF+EFFLVSQR T+GTASPTNYNVLEDT+   K G++E + PNELQ+ITYTLTHLYFNWMGTIRVP P HYAH+LAELIGK+HKG+ PA+IN+RIR+RLFYL
Sbjct:  499 CAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of Pgr_002280 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 477.248 bits (1227), Expect = 3.488e-161
Identity = 222/327 (67.89%), Postives = 276/327 (84.40%), Query Frame = 2
Query:    2 DGIR-NAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL 976
            D IR + V MALVF+ DDK+YA+VKNFT++TGLLTQCVTQRN +NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+HSKTGK+S+QASV+SI++ F+QY+SF+N+ KG+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  P  INDRIR+RLFYL
Sbjct:  484 DFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of Pgr_002280 vs. uniprot
Match: gi|74716803|sp|Q96J94|PIWL1_HUMAN (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 206.838 bits (525), Expect = 1.356e-58
Identity = 122/304 (40.13%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  101 TQCVTQRNATNRMDKRRQV--VASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKT-GKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEA----DALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            +QCV  R     + K++ V  +A+K  +Q+  K G + W V+I L+  MIVG+D YH  T G++SI   V SIN   T++ S        QE  + L     AAL+ ++S  E  P RI++YRDGVGD Q+     +E     D LK I       +G+  P++  +VVKKR++T+FF       QNP PGT++D EV +P +Y+FF+VSQ    G+ SPT+YNV+ D   L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N ++ N     RL+YL
Sbjct:  583 SQCVVART----LGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSI------GRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDNSGL---------KPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSN-----RLYYL 861          
BLAST of Pgr_002280 vs. uniprot
Match: gi|226701015|sp|A6N7Y9|PIWL1_CHICK (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 204.912 bits (520), Expect = 6.832e-58
Identity = 120/327 (36.70%), Postives = 176/327 (53.82%), Query Frame = 2
Query:   14 NAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSK-TGKKSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            N V   L     DK  A  K       + +QCV  R  +    +    + +K  +Q+  K G + W+VEI L+  MIVG+D YH   +GK+SI   V S+N   T++ S        QE  + L      AL+++    +  P RI++YRDGVGD Q+     +E       ++ + +D     P++  +VVKKR+ST+FF       +NP PGT+VD EV +P +Y+FF+VSQ    G  +PT+YNV+ DT  L          P+ +Q++TY L H+Y+NW G IRVPAP  YAH+LA L+G+ IH+  N       + DRL+YL
Sbjct:  560 NIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVARTLSK--PQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN---PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDTSKL---------KPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPNLL-----LSDRLYYL 867          
BLAST of Pgr_002280 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 182.956 bits (463), Expect = 3.930e-51
Identity = 111/316 (35.13%), Postives = 170/316 (53.80%), Query Frame = 2
Query:   50 DKMYARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            D  YA +K    +   + +Q +  +   N +  R   V  K V+Q+  K G   W V+I  +  MI G+D+YH  + +  S+ A V SINS+++Q+ S       R+E    L  +F  AL+ +  +    P  I+IYRDG+GD Q++    +E     P  E +  ++     +I Y+VV+KRI+T+ F       +NP PGT+VD+ + K N Y+FFLVSQ   +GT +PT+Y VL D              P+ +QK++Y L  LY+NW GT+R+PA   YAH+LA LIG+ I +    A     + ++LFYL
Sbjct:  576 DDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRS--VVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEA-----LSEKLFYL 867          
BLAST of Pgr_002280 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 182.956 bits (463), Expect = 3.930e-51
Identity = 111/316 (35.13%), Postives = 170/316 (53.80%), Query Frame = 2
Query:   50 DKMYARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            D  YA +K    +   + +Q +  +   N +  R   V  K V+Q+  K G   W V+I  +  MI G+D+YH  + +  S+ A V SINS+++Q+ S       R+E    L  +F  AL+ +  +    P  I+IYRDG+GD Q++    +E     P  E +  ++     +I Y+VV+KRI+T+ F       +NP PGT+VD+ + K N Y+FFLVSQ   +GT +PT+Y VL D              P+ +QK++Y L  LY+NW GT+R+PA   YAH+LA LIG+ I +    A     + ++LFYL
Sbjct:  576 DDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRS--VVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEA-----LSEKLFYL 867          
BLAST of Pgr_002280 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 182.956 bits (463), Expect = 3.930e-51
Identity = 111/316 (35.13%), Postives = 170/316 (53.80%), Query Frame = 2
Query:   50 DKMYARVKNFTLT-TGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK-KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNG----QNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGK-IHKGTNPAVINDRIRDRLFYL 976
            D  YA +K    +   + +Q +  +   N +  R   V  K V+Q+  K G   W V+I  +  MI G+D+YH  + +  S+ A V SINS+++Q+ S       R+E    L  +F  AL+ +  +    P  I+IYRDG+GD Q++    +E     P  E +  ++     +I Y+VV+KRI+T+ F       +NP PGT+VD+ + K N Y+FFLVSQ   +GT +PT+Y VL D              P+ +QK++Y L  LY+NW GT+R+PA   YAH+LA LIG+ I +    A     + ++LFYL
Sbjct:  576 DDRYAAIKKICCSEIPIPSQVINAKTLQNDLKIRS--VVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEI----PQFEMVCGNR----IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVAEA-----LSEKLFYL 867          
BLAST of Pgr_002280 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 182.185 bits (461), Expect = 7.053e-51
Identity = 115/314 (36.62%), Postives = 168/314 (53.50%), Query Frame = 2
Query:    2 DGIRNAVKMALVFVSDD--KMYARVKNFT-LTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHS-KTGKKSIQASVYSI----NSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIG 910
            D +R+  K+ L  V +D  + Y+ +K    +   + TQ VT +   NR       +A+K  +Q+  K GY PW +E+ L   M +G D   S +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +    +FE   +K I+EKL   Y       PQ+ Y+VV + ++T+FF NGQNP PGTIVD  +  P  Y+F+LVSQ+  +GT SPT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVPA   YA +LA L+G
Sbjct:  530 DCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNR---SLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of Pgr_002280 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 182.185 bits (461), Expect = 7.053e-51
Identity = 115/314 (36.62%), Postives = 168/314 (53.50%), Query Frame = 2
Query:    2 DGIRNAVKMALVFVSDD--KMYARVKNFT-LTTGLLTQCVTQRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHS-KTGKKSIQASVYSI----NSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKL---YQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIG 910
            D +R+  K+ L  V +D  + Y+ +K    +   + TQ VT +   NR       +A+K  +Q+  K GY PW +E+ L   M +G D   S +  K++  A + S+    NST   Y S +            L    A AL+Q+  ++   P RI+ YRDGV    +    +FE   +K I+EKL   Y       PQ+ Y+VV + ++T+FF NGQNP PGTIVD  +  P  Y+F+LVSQ+  +GT SPT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVPA   YA +LA L+G
Sbjct:  530 DCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNR---SLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
The following BLAST results are available for this feature:
BLAST of Pgr_002280 vs. RefSeq Human
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767975980|ref|XP_011537308.1|9.601e-6240.13PREDICTED: piwi-like protein 1 isoform X1 [Homo sa... [more]
gi|66346725|ref|NP_004755.2|5.117e-5940.13piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|5.117e-5940.13PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|5.117e-5940.13PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|5.117e-5940.13PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Pgr_002280 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+076.01SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261778.798e-16267.99SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001115.732e-4937.59Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389364.539e-2729.39dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329887.168e-2628.49SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
BLAST of Pgr_002280 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata gracilis BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+075.70RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA2.131e-17371.56RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD3.488e-16167.89RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|74716803|sp|Q96J94|PIWL1_HUMAN1.356e-5840.13RecName: Full=Piwi-like protein 1[more]
gi|226701015|sp|A6N7Y9|PIWL1_CHICK6.832e-5836.70RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Pgr_002280 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata gracilis BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221513719|ref|NP_001036627.2|3.930e-5135.13argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|3.930e-5135.13argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|3.930e-5135.13argonaute 3, isoform F [Drosophila melanogaster][more]
gi|17136736|ref|NP_476875.1|7.053e-5136.62piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|7.053e-5136.62piwi, isoform B [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pgr_002280 ID=Pgr_002280|Name=Pgr_002280|organism=Phagocata gracilis|type=mRNA|length=980bp
AGACGGCATCCGAAATGCCGTTAAAATGGCATTGGTCTTTGTCTCTGATG
ATAAAATGTACGCTCGTGTTAAAAATTTTACGTTAACTACAGGTCTTTTG
ACACAATGTGTAACTCAGAGAAACGCAACAAATCGTATGGATAAACGTCG
CCAGGTAGTTGCAAGTAAGTCTGTAATGCAAATATTCAGCAAGTTTGGAT
ACGATCCTTGGAATGTTGAAATTAAGCTTAGGCCTACTATGATTGTCGGA
CTCGATACTTATCATAGTAAAACAGGAAAGAAATCAATTCAAGCTTCGGT
CTATTCAATAAATAGCACGTTTACTCAATATTTAAGTTTCATTAATAACC
CTAAGGGTCGTCAGGAGTTCCATGAAGTTCTCGGCAGAAACTTTGCAGCT
GCATTGCAACAGTTTCATTCAAAGTATGAAATTTACCCCCAGAGGATAAT
GATATATCGAGATGGTGTTGGTGATTCGCAAATGTTTTTTACCAAACAAT
TTGAAGCGGACGCATTGAAGCCTATTATGGAGAAGCTCTATCAAGACAAA
GGTTTTCCAATTCCGCAGATCATTTACGTTGTCGTCAAGAAGCGGATCAG
TACCAAGTTCTTTAAAAATGGACAGAACCCTGAGCCTGGTACGATAGTTG
ACAAAGAGGTTGTAAAGCCCAATTTCTATGAATTCTTTCTTGTTTCGCAA
AGAACTACGAAAGGTACGGCTAGTCCTACTAATTATAATGTACTCGAGGA
TACAAAACTGTTAACAAAGAAGGGCGTTATGGAACCGATGGCTCCAAATG
AGCTTCAAAAAATAACGTATACGCTTACTCATCTTTATTTCAATTGGATG
GGTACAATTAGAGTTCCAGCACCTACTCATTACGCACATCGTTTGGCAGA
GCTCATTGGTAAAATTCACAAGGGCACTAATCCTGCGGTAATTAATGACC
GCATTCGAGATCGATTGTTCTATCTCTGAG

Design Primers for Pgr_002280

back to top

protein sequence

>Pgr_002280-protein ID=Pgr_002280-protein|Name=Pgr_002280|organism=Phagocata gracilis|type=polypeptide|length=326bp
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
back to top

coding sequence

>Pgr_002280.2.979 ID=Pgr_002280.2.979|Name=Pgr_002280.2.979|organism=Phagocata gracilis|type=CDS|length=978bp
GACGGCATCCGAAATGCCGTTAAAATGGCATTGGTCTTTGTCTCTGATGA
TAAAATGTACGCTCGTGTTAAAAATTTTACGTTAACTACAGGTCTTTTGA
CACAATGTGTAACTCAGAGAAACGCAACAAATCGTATGGATAAACGTCGC
CAGGTAGTTGCAAGTAAGTCTGTAATGCAAATATTCAGCAAGTTTGGATA
CGATCCTTGGAATGTTGAAATTAAGCTTAGGCCTACTATGATTGTCGGAC
TCGATACTTATCATAGTAAAACAGGAAAGAAATCAATTCAAGCTTCGGTC
TATTCAATAAATAGCACGTTTACTCAATATTTAAGTTTCATTAATAACCC
TAAGGGTCGTCAGGAGTTCCATGAAGTTCTCGGCAGAAACTTTGCAGCTG
CATTGCAACAGTTTCATTCAAAGTATGAAATTTACCCCCAGAGGATAATG
ATATATCGAGATGGTGTTGGTGATTCGCAAATGTTTTTTACCAAACAATT
TGAAGCGGACGCATTGAAGCCTATTATGGAGAAGCTCTATCAAGACAAAG
GTTTTCCAATTCCGCAGATCATTTACGTTGTCGTCAAGAAGCGGATCAGT
ACCAAGTTCTTTAAAAATGGACAGAACCCTGAGCCTGGTACGATAGTTGA
CAAAGAGGTTGTAAAGCCCAATTTCTATGAATTCTTTCTTGTTTCGCAAA
GAACTACGAAAGGTACGGCTAGTCCTACTAATTATAATGTACTCGAGGAT
ACAAAACTGTTAACAAAGAAGGGCGTTATGGAACCGATGGCTCCAAATGA
GCTTCAAAAAATAACGTATACGCTTACTCATCTTTATTTCAATTGGATGG
GTACAATTAGAGTTCCAGCACCTACTCATTACGCACATCGTTTGGCAGAG
CTCATTGGTAAAATTCACAAGGGCACTAATCCTGCGGTAATTAATGACCG
CATTCGAGATCGATTGTTCTATCTCTGA
back to top
Gene Groups
Pgr_002280 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.