Gsp_023053, Gsp_023053 (mRNA) Girardia sp.

Overview
NameGsp_023053
Unique NameGsp_023053
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length2469
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of Gsp_023053 vs. RefSeq Human
Match: gi|24430181|ref|NP_002531.3| (outer dense fiber protein 2 isoform 9 [Homo sapiens])

HSP 1 Score: 131.339 bits (329), Expect = 1.608e-30
Identity = 79/188 (42.02%), Postives = 124/188 (65.96%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGL-SCP----NPP 2240
            Q +KL    EK + S+K N+   +++++LERK+++   QN E    +  ++  +  ++ + EE  RE  +L RQLE+A+ D+RR  + ++E  + K+R  Q+++ D+ETQL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P S  L S P    +PP
Sbjct:  617 QGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 804          

HSP 2 Score: 107.071 bits (266), Expect = 6.657e-23
Identity = 119/438 (27.17%), Postives = 230/438 (52.51%), Query Frame = 3
Query:  156 VHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPW---VPPPGKTTKNHRSELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTR--------SNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHI 1436
            +HV VD++TPVHV+++K           +P + S     KR  K G  +   + +     RV++ +PP    + PP        SE +   M   D              ++++G  + +RY+++I+ L + +G L+ ++K++K   Q+  ++  ++ + E++EE+  E+   E EN +LR ++E  +           +L  E + L+  L+EAE+     A Q+  + D +   +K   ++T  D++ +  Q      +L  F+  N TLRDLL++   +E + +   E+    L ++  E +   ++L L L DKDK +++L +++ C+  +    +   +S+E+++GHLQ QL+ +  + +R+ +QI+ LE    + + + E ++E LK  K +G  D++ LKKA RAQK+RA K+EE  ++L   LA+K+ ++
Sbjct:   10 LHVHVDENTPVHVHIKK---------LPKPSATSSQKSHKRGMK-GDTVNVRRSV-----RVKTKNPPHCLEITPPS-------SEKLVSVMRLSDLST----------EDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTI-GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE-DSERLMEQQGALLKRL-AEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYV 410          
BLAST of Gsp_023053 vs. RefSeq Human
Match: gi|334278913|ref|NP_001229281.1| (outer dense fiber protein 2 isoform 11 [Homo sapiens])

HSP 1 Score: 130.954 bits (328), Expect = 2.040e-30
Identity = 79/188 (42.02%), Postives = 124/188 (65.96%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGL-SCP----NPP 2240
            Q +KL    EK + S+K N+   +++++LERK+++   QN E    +  ++  +  ++ + EE  RE  +L RQLE+A+ D+RR  + ++E  + K+R  Q+++ D+ETQL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P S  L S P    +PP
Sbjct:  636 QGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 823          

HSP 2 Score: 110.538 bits (275), Expect = 5.765e-24
Identity = 121/444 (27.25%), Postives = 231/444 (52.03%), Query Frame = 3
Query:  156 VHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSC--------LGSFWNE-EEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTR--------SNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHI 1436
            +HV VD++TPVHV+++K           +P + S     KR  K G  +   + +R   +       PW+PP   + +    +  N   C    E T  S         L     E +++G  + +RY+++I+ L + +G L+ ++K++K   Q+  ++  ++ + E++EE+  E+   E EN +LR ++E  +           +L  E + L+  L+EAE+     A Q+  + D +   +K   ++T  D++ +  Q      +L  F+  N TLRDLL++   +E + +   E+    L ++  E +   ++L L L DKDK +++L +++ C+  +    +   +S+E+++GHLQ QL+ +  + +R+ +QI+ LE    + + + E ++E LK  K +G  D++ LKKA RAQK+RA K+EE  ++L   LA+K+ ++
Sbjct:   10 LHVHVDENTPVHVHIKK---------LPKPSATSSQKSHKRGMK-GDTVNVRRSVRVKTK------VPWMPPGKSSARPVGCKWENPPHC---LEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTI-GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE-DSERLMEQQGALLKRL-AEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYV 429          
BLAST of Gsp_023053 vs. RefSeq Human
Match: gi|530391197|ref|XP_005252086.1| (PREDICTED: outer dense fiber protein 2 isoform X26 [Homo sapiens])

HSP 1 Score: 130.954 bits (328), Expect = 2.341e-30
Identity = 79/188 (42.02%), Postives = 124/188 (65.96%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGL-SCP----NPP 2240
            Q +KL    EK + S+K N+   +++++LERK+++   QN E    +  ++  +  ++ + EE  RE  +L RQLE+A+ D+RR  + ++E  + K+R  Q+++ D+ETQL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P S  L S P    +PP
Sbjct:  622 QGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 809          
BLAST of Gsp_023053 vs. RefSeq Human
Match: gi|310750408|ref|NP_702911.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 130.568 bits (327), Expect = 2.891e-30
Identity = 79/188 (42.02%), Postives = 124/188 (65.96%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGL-SCP----NPP 2240
            Q +KL    EK + S+K N+   +++++LERK+++   QN E    +  ++  +  ++ + EE  RE  +L RQLE+A+ D+RR  + ++E  + K+R  Q+++ D+ETQL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P S  L S P    +PP
Sbjct:  641 QGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          
BLAST of Gsp_023053 vs. RefSeq Human
Match: gi|334278916|ref|NP_001229282.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 130.568 bits (327), Expect = 2.891e-30
Identity = 79/188 (42.02%), Postives = 124/188 (65.96%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGL-SCP----NPP 2240
            Q +KL    EK + S+K N+   +++++LERK+++   QN E    +  ++  +  ++ + EE  RE  +L RQLE+A+ D+RR  + ++E  + K+R  Q+++ D+ETQL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P S  L S P    +PP
Sbjct:  641 QGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          
BLAST of Gsp_023053 vs. uniprot
Match: gi|82082176|sp|Q5ZKK5|ODFP2_CHICK (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 137.502 bits (345), Expect = 4.791e-32
Identity = 78/184 (42.39%), Postives = 120/184 (65.22%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPL--SNGLSCPNP 2237
            Q +K+    E+ +++++  +   ++ E+LERK+++   QN E    +  ++ ++   + + EE  RE +SL RQLE A+ D++R  + +RE+   ++R  QS+V D+ETQL++ + E N+ RRN E+ ER+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVF D  L  S G S  +P
Sbjct:  639 QGDKMEMTRERYQSAQEEKKQLTLKAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSALLGSPGRSRSSP 822          

HSP 2 Score: 127.872 bits (320), Expect = 5.822e-29
Identity = 129/445 (28.99%), Postives = 234/445 (52.58%), Query Frame = 3
Query:  156 VHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTT---KNHRSELVNRYMCKCDFENTGKSCLGSF----WNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQMLIEAELA----SERCAHQMQHVFDYLKSTIK----EGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSIS---KLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHI 1436
            +HV VD++TPVHV+++KG+        T P   ++  +  + K  G+ +   + ++   +       PW+ PPGKT+     ++ E     +     E+     +        +EE+A   + + YE++I+ L + +G L+ + K++K+ ++ + ++  ++ Q E++ E+ QE+   E EN LLR ++E  R   +L     K +Q   E  L+    +ER           LKSTI+    E H ++S D++ +  Q      +L  F+  N TLR+LL++  +RE + Q   EK    +    K L DS +   +L++ L DK+K I++L  Q+  + ++    +   +SLE+V+GHLQ QL+ +  + NR++ QIR LE   A+ + + E + + LK  + +   D+D LK+A RAQK+RA ++EE   +L   LAEK+ ++
Sbjct:   10 LHVHVDENTPVHVHIKKGQK-------TTP---AKCQQKHKQKMKGNTVNVRRAVQVKTK------APWM-PPGKTSVLDSTYKWEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQMTKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERLNVEKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERERDVQKILEKQGVLM----KMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLKELRQKADRDKDALKRALRAQKERAERSEECAGQLAVQLAEKDSYV 432          
BLAST of Gsp_023053 vs. uniprot
Match: gi|74736013|sp|Q5BJF6|ODFP2_HUMAN (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 130.568 bits (327), Expect = 7.660e-30
Identity = 79/188 (42.02%), Postives = 124/188 (65.96%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGL-SCP----NPP 2240
            Q +KL    EK + S+K N+   +++++LERK+++   QN E    +  ++  +  ++ + EE  RE  +L RQLE+A+ D+RR  + ++E  + K+R  Q+++ D+ETQL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P S  L S P    +PP
Sbjct:  641 QGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828          
BLAST of Gsp_023053 vs. uniprot
Match: gi|158513400|sp|A3KGV1|ODFP2_MOUSE (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 130.183 bits (326), Expect = 9.210e-30
Identity = 76/182 (41.76%), Postives = 118/182 (64.84%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNP 2237
            Q +KL    EK + S+K N+    ++++LERK+++   QN E    +  ++  +   + + EE  RE  SL RQLE+A+ D+RR  + ++E+ + K+R  QS++ D+ETQL++ + E  + RR  ++ +R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P ++     +P
Sbjct:  641 QGDKLEMAREKHQASQKENKQLSQKVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSP 822          

HSP 2 Score: 97.4413 bits (241), Expect = 1.577e-19
Identity = 106/384 (27.60%), Postives = 204/384 (53.12%), Query Frame = 3
Query:  357 PWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSC---------------LGSFWNEEE-AGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTR--------SNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHI 1436
            PW+PP GK++  H           C +EN                    L     E++ +G  + +RY+++I+ L + +G L+ ++K++K   Q+  ++  ++ + E++EE+  E+   E EN +LR ++E  +           +L  E + L+  L+EAE+     A Q+  + D +   +K   ++T  D++ +  Q      +L  F+  N TLRDLL++   +E + +   E+  T L ++  E +   ++L L L DKDK +++L +++ C+  +    +   +S+E+++GHLQ QL+ +  + +R+ +QI+ LE    + + + E ++E LK  K +G  D++ LKKA RAQK+RA K+EE  ++L   LA+K+ ++
Sbjct:   66 PWMPP-GKSSARH---------VGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTI-GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE-DSERLMEQQGTLLKRL-AEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYV 434          
BLAST of Gsp_023053 vs. uniprot
Match: gi|158564320|sp|Q6AYX5|ODFP2_RAT (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 130.183 bits (326), Expect = 1.076e-29
Identity = 76/182 (41.76%), Postives = 119/182 (65.38%), Query Frame = 3
Query: 1692 QVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNP 2237
            Q +KL    EK + S+K N+    ++++LERK+++   QN E    +  ++  +   + + EE  RE  SL RQLE+A+ D+RR  + ++E+ + K+R  QS++ D+ETQL++ + E  + RR  ++++R+  S+LQDLK +LEQSE TNRSMQ YVQFLK SYANVFGD P ++     +P
Sbjct:  636 QGDKLELAREKHQASQKENKQLSQKVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSP 817          

HSP 2 Score: 112.849 bits (281), Expect = 3.004e-24
Identity = 122/451 (27.05%), Postives = 232/451 (51.44%), Query Frame = 3
Query:  156 VHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSC---------------LGSFWNEEE-AGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTR--------SNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHI 1436
            +HV VD++TPVHV+++K           +P + S     KR  K G  +   + +R   +       PW+PP GK++  H           C +EN                    L     E++ +G  + +RY+++I+ L + +G L+ ++K++K   Q+  ++  ++ + E++EE+  E+   E EN +LR ++E  +           +L  E + L+  L+EAE+     A Q+  + D +   +K   ++T  D++ +  Q      +L  F+  N TLRDLL++   +E + +   E+    L ++  E +   ++L L L DKDK +++L +++ C+  +    +   +S+E+++GHLQ QL+ +  + +R+ +QI+ LE    + + + E ++E LK  K +G  D++ LKKA RAQK+RA K+EE  ++L   LA+K+ ++
Sbjct:   10 LHVHVDENTPVHVHIKK---------LPKPSAASSQKSHKRGMK-GDTVNVRRSVRVKTK------VPWMPP-GKSSARH---------VGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTI-GKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE-DSERLMEQQGALLKRL-AEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYV 429          
BLAST of Gsp_023053 vs. uniprot
Match: gi|82179654|sp|Q5PQ23|ODFP2_XENLA (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2 [Xenopus laevis])

HSP 1 Score: 113.62 bits (283), Expect = 9.721e-25
Identity = 128/444 (28.83%), Postives = 222/444 (50.00%), Query Frame = 3
Query:  156 VHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTK----------NHRSELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKER-------EQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLF--------PESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISK---LELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQEL 1403
            +HV VD+ TPVHV+++K            P    +  K+K  KK   N+  S  ++           PW+PP GK++            HR ++      +  F     S L +  +EEE   S+ + YE++I  L  E+G L+ +L+++K         EQ+  S+  ++ Q E++ E+ QE+   E EN  L+ SL+  +    L          E   L+  L+EAE      A Q+  + D ++  +K   ++TS D++ +  Q      +L  F+  N +LR LL++  ++E       E+ +  L    K+L D+ ++   L+L+L ++++ ++DL  QL  + D +   +   +S+E+ K HLQ QL+ R  + NR+SVQIR LE   A ++ +   L+E L   K +   +++ LKK+ RAQKQRA ++EET++ L
Sbjct:   10 LHVHVDESTPVHVHIKKSSRP--------PAKTQQGAKLK--KKGMGNLRRSATVKTK--------VPWIPP-GKSSLRDAGLKWEGLTHRLDITPPDTERM-FSALRMSDLST--DEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQR-LKHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLREQHRQETETYRLMEQKEMLL----KKLSDADTEKMHLQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLERNEAHQKEEIVKLMEQLTELKQKVDSEKEALKKSVRAQKQRAERSEETLEML 426          
BLAST of Gsp_023053 vs. Smed Unigenes AA
Match: SMU15001741 (Asxlregen_comp65555_c0_seq4|m.19436|m.7732)

HSP 1 Score: 1028.08 bits (2657), Expect = 0.000e+0
Identity = 534/714 (74.79%), Postives = 635/714 (88.94%), Query Frame = 3
Query:  105 MSHEFSKXXXXXXXXXXVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNS-RSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHIEHLIMNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPY 2243
            MS + SK+I RSRPSSPVH+FVDKDTPVHVYM KG+ D YNS+F  P+S+S +S KMKRP+KPGSN+PTS+LMR+ NERVRSMSPPWVPPPGKTTK+++S  V     KC + NT KS LGS+WNE+EA  SQ+DRY QQI  LQ+E+GELREQLK EK+ +Q+R+++D I  QDEK+EELKQEIDVMEKENHLLRDSLE TRSN+NL  +S++L+Q+LIE ELA ERCAHQMQHVFD L++ + EGHK++SRD+DRI+T FHDTESRLF+FKS++N+LRDLLK  Q REI+GQNS EK+  FLSK+R EL+D+ISKLELEL +K+K+IDDL+KQL  KNDE+INFASTHESLEN+KGHLQQQLKQ+SGD NR+SVQIRTLESELAKERLDKEHLIELLKNPKDR  DDR VLKKAARAQKQRA+KAEET+Q+LT+IL  KERHIE L++NS+EDQ+ LR +++I DENQHLH+Q+ +NDQE++I SLK+EN++LRSIADQCESRLRDVEREMK +RRTMAEENDD+++EQVNKL+KILEKLE SEKSNQ+SQIRIEDLERK+K+LE+QNFEMK  LQ KD + IDNKCK EEL RENASL RQLEAALTDS+RN+DN+R+K VG+DRQLQSR+H+IE+QLA Q+AE+NKW RN EE ERKCN+KLQD+K+QLEQSEITNRSMQTYVQFLKKSYANVFGD+PLSNGLSCPNP Y
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSY 714          
BLAST of Gsp_023053 vs. Smed Unigenes AA
Match: SMU15005576 (SmedAsxldir_c106665_g2_i15|m.77482|m.8142)

HSP 1 Score: 1014.6 bits (2622), Expect = 0.000e+0
Identity = 534/737 (72.46%), Postives = 635/737 (86.16%), Query Frame = 3
Query:  105 MSHEFSKXXXXXXXXXXVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNS-RSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHIEHLIM-----------------------NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPY 2243
            MS + SK+I RSRPSSPVH+FVDKDTPVHVYM KG+ D YNS+F  P+S+S +S KMKRP+KPGSN+PTS+LMR+ NERVRSMSPPWVPPPGKTTK+++S  V     KC + NT KS LGS+WNE+EA  SQ+DRY QQI  LQ+E+GELREQLK EK+ +Q+R+++D I  QDEK+EELKQEIDVMEKENHLLRDSLE TRSN+NL  +S++L+Q+LIE ELA ERCAHQMQHVFD L++ + EGHK++SRD+DRI+T FHDTESRLF+FKS++N+LRDLLK  Q REI+GQNS EK+  FLSK+R EL+D+ISKLELEL +K+K+IDDL+KQL  KNDE+INFASTHESLEN+KGHLQQQLKQ+SGD NR+SVQIRTLESELAKERLDKEHLIELLKNPKDR  DDR VLKKAARAQKQRA+KAEET+Q+LT+IL  KERHIE L++                       NS+EDQ+ LR +++I DENQHLH+Q+ +NDQE++I SLK+EN++LRSIADQCESRLRDVEREMK +RRTMAEENDD+++EQVNKL+KILEKLE SEKSNQ+SQIRIEDLERK+K+LE+QNFEMK  LQ KD + IDNKCK EEL RENASL RQLEAALTDS+RN+DN+R+K VG+DRQLQSR+H+IE+QLA Q+AE+NKW RN EE ERKCN+KLQD+K+QLEQSEITNRSMQTYVQFLKKSYANVFGD+PLSNGLSCPNP Y
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMLCQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSY 737          
BLAST of Gsp_023053 vs. Smed Unigenes AA
Match: SMU15005577 (SmedAsxldir_c106665_g2_i7|m.77472|m.45171)

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 520/778 (66.84%), Postives = 615/778 (79.05%), Query Frame = 3
Query:  105 MSHEFSKXXXXXXXXXXVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNS-RSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHIEHLIMNSREDQDNLRRM----DEIIDENQHLHR--------------------------------QIVSNDQED----------------------------LIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPY 2243
            MS + SK+I RSRPSSPVH+FVDKDTPVHVYM KG+ D YNS+F  P+S+S +S KMKRP+KPGSN+PTS+LMR+ NERVRSMSPPWVPPPGKTTK                  T KS LGS+WNE+EA  SQ+DRY QQI  LQ+E+GELREQLK EK+ +Q+R+++D I  QDEK+EELKQEIDVMEKENHLLRDSLE TRSN+NL  +S++L+Q+LIE ELA ERCAHQMQHVFD L++ + EGHK++SRD+DRI+T FHDTESRLF+FKS++N+LRDLLK  Q REI+GQNS EK+  FLSK+R EL+D+ISKLELEL +K+K+IDDL+KQL  KNDE+INFASTHESLEN+KGHLQQQLKQ+SGD NR+SVQIRTLESELAKERLDKEHLIELLKNPKDR  DDR VLKKAARAQKQRA+KAEET+Q+LT+IL  KERHIE L M+S+  +++   +    D   + N+H H+                                Q   N QED                            +I SLK+EN++LRSIADQCESRLRDVEREMK +RRTMAEENDD+++EQVNKL+KILEKLE SEKSNQ+SQIRIEDLERK+K+LE+QNFEMK  LQ KD + IDNKCK EEL RENASL RQLEAALTDS+RN+DN+R+K VG+DRQLQSR+H+IE+QLA Q+AE+NKW RN EE ERKCN+KLQD+K+QLEQSEITNRSMQTYVQFLKKSYANVFGD+PLSNGLSCPNP Y
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTK------------------TLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQL-MHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSY 759          
BLAST of Gsp_023053 vs. Smed Unigenes AA
Match: SMU15005578 (SmedAsxldir_c106665_g2_i9|m.77475|m.37289)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 329/478 (68.83%), Postives = 396/478 (82.85%), Query Frame = 3
Query:  105 MSHEFSKXXXXXXXXXXVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRSNS-RSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRSELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLXXXXXXXXXXXXXXEETIQELTAILAEKERHIEHLIMNSREDQDNLRRM----DEIIDENQHLHR 1523
            MS + SK+I RSRPSSPVH+FVDKDTPVHVYM KG+ D YNS+F  P+S+S +S KMKRP+KPGSN+PTS+LMR+ NERVRSMSPPWVPPPGKTTK                  T KS LGS+WNE+EA  SQ+DRY QQI  LQ+E+GELREQLK EK+ +Q+R+++D I  QDEK+EELKQEIDVMEKENHLLRDSLE TRSN+NL  +S++L+Q+LIE ELA ERCAHQMQHVFD L++ + EGHK++SRD+DRI+T FHDTESRLF+FKS++N+LRDLLK  Q REI+GQNS EK+  FLSK+R EL+D+ISKLELEL +K+K+IDDL+KQL  KNDE+INFASTHESLEN+KGHLQQQLKQ+SGD NR+SVQIRTLESELAKERLDKEHLIELLKNPKDR  DDR VLKKAARAQKQRA+KAEET+Q+LT+IL  KERHIE L M+S+  +++   +    D   + N+H H+
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTK------------------TLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQL-MHSKTTRNHASAVSNHCDHCPEANKHHHK 459          

HSP 2 Score: 427.943 bits (1099), Expect = 1.760e-136
Identity = 206/265 (77.74%), Postives = 244/265 (92.08%), Query Frame = 3
Query: 1449 MNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPY 2243
            +NS+EDQ+ LR +++I DENQHLH+Q+ +NDQE++I SLK+EN++LRSIADQCESRLRDVEREMK +RRTMAEENDD+++EQVNKL+KILEKLE SEKSNQ+SQIRIEDLERK+K+LE+QNFEMK  LQ KD + IDNKCK EEL RENASL RQLEAALTDS+RN+DN+R+K VG+DRQLQSR+H+IE+QLA Q+AE+NKW RN EE ERKCN+KLQD+K+QLEQSEITNRSMQTYVQFLKKSYANVFGD+PLSNGLSCPNP Y
Sbjct:  504 INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSY 768          
The following BLAST results are available for this feature:
BLAST of Gsp_023053 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|24430181|ref|NP_002531.3|1.608e-3042.02outer dense fiber protein 2 isoform 9 [Homo sapien... [more]
gi|334278913|ref|NP_001229281.1|2.040e-3042.02outer dense fiber protein 2 isoform 11 [Homo sapie... [more]
gi|530391197|ref|XP_005252086.1|2.341e-3042.02PREDICTED: outer dense fiber protein 2 isoform X26... [more]
gi|310750408|ref|NP_702911.1|2.891e-3042.02outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
gi|334278916|ref|NP_001229282.1|2.891e-3042.02outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
back to top
BLAST of Gsp_023053 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|82082176|sp|Q5ZKK5|ODFP2_CHICK4.791e-3242.39RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|74736013|sp|Q5BJF6|ODFP2_HUMAN7.660e-3042.02RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158513400|sp|A3KGV1|ODFP2_MOUSE9.210e-3041.76RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158564320|sp|Q6AYX5|ODFP2_RAT1.076e-2941.76RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82179654|sp|Q5PQ23|ODFP2_XENLA9.721e-2528.83RecName: Full=Outer dense fiber protein 2; AltName... [more]
back to top
BLAST of Gsp_023053 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gsp_023053 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150017410.000e+074.79Asxlregen_comp65555_c0_seq4|m.19436|m.7732[more]
SMU150055760.000e+072.46SmedAsxldir_c106665_g2_i15|m.77482|m.8142[more]
SMU150055770.000e+066.84SmedAsxldir_c106665_g2_i7|m.77472|m.45171[more]
SMU150055781.760e-13668.83SmedAsxldir_c106665_g2_i9|m.77475|m.37289[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_023053 ID=Gsp_023053|Name=Gsp_023053|organism=Girardia sp.|type=mRNA|length=2469bp
TTTTGTTTTGCATTTTCATTAGCAACTTCAGCTTCTTTAGTTACAATAGA
TTTTATTTATTGATTTTTTCTTTCAATAAACAAGATTGGATTTAATTTTA
TATGATGTCTCATGAATTTTCGAAACGAATACCAAGAAGTAGACCGTCAA
GTCCAGTTCATGTATTTGTTGATAAAGATACTCCAGTTCATGTGTATATG
AGAAAAGGTGAAAATGATCAATATAACTCGGAATTTACTCAACCTAGAAG
TAATAGTAGAAGTAATAAAATGAAAAGACCAAAGAAACCTGGATCTAATA
TACCTACATCTAAATTAATGCGTAATTCCAACGAAAGAGTGAGATCAATG
TCTCCTCCTTGGGTACCTCCACCTGGTAAAACCACAAAAAACCATAGGAG
CGAATTGGTGAATCGGTATATGTGTAAATGTGATTTTGAAAATACAGGTA
AATCGTGTTTGGGATCGTTTTGGAATGAAGAAGAAGCTGGATTCAGTCAA
CAAGATCGTTATGAACAACAAATCAATGAACTTCAAGATGAACTTGGTGA
ACTTCGAGAACAATTGAAAATTGAAAAGGAACGTGAACAGATTAGAAATA
GTGAAGATACTATTCAATATCAAGATGAAAAAATTGAAGAATTAAAACAA
GAAATTGATGTGATGGAAAAAGAAAATCATTTATTACGTGACAGTTTGGA
AAATACTCGGTCAAATATGAATTTATTTCCCGAATCAGACAAACTTATTC
AAATGTTAATTGAGGCTGAATTAGCAAGTGAACGATGCGCCCATCAAATG
CAACACGTATTTGATTATTTAAAGAGTACAATTAAAGAAGGTCATAAAAT
TACCAGTCGAGATGTCGATCGAATTAATACACAGTTCCATGATACTGAAT
CTAGATTATTTGAATTTAAATCTGTAAACAATACTCTCAGAGATCTGTTG
AAAGACGCTCAACAAAGAGAAATTAATGGCCAAAATTCATTTGAAAAGGA
TAAAACATTCTTATCAAAAGTACGAAAGGAACTGGAAGACAGTATTTCTA
AATTAGAATTAGAATTATTTGATAAAGACAAAGTGATTGATGATCTCCGA
AAGCAATTGGCATGTAAGAATGATGAAACCATTAATTTTGCCAGCACTCA
CGAATCATTGGAAAATGTTAAAGGCCATTTACAACAGCAATTGAAACAAA
GATCTGGAGATATTAATCGCATGTCTGTTCAAATTCGAACATTAGAGAGT
GAACTTGCCAAAGAAAGATTAGATAAAGAGCATCTTATCGAATTGTTAAA
AAATCCAAAAGATCGTGGATTAGATGATCGAGATGTATTAAAGAAAGCAG
CCAGAGCTCAAAAACAAAGAGCAATAAAAGCAGAGGAAACAATTCAAGAA
TTGACAGCTATTTTGGCAGAAAAAGAAAGGCATATTGAACACTTAATAAT
GAATAGTCGTGAAGATCAAGACAATCTGAGGCGCATGGATGAAATAATTG
ATGAGAATCAACATTTGCACAGACAAATCGTCAGCAACGATCAAGAAGAC
CTCATCATTTCATTAAAACGAGAAAATGATAGTCTTCGTTCTATTGCCGA
TCAATGTGAATCACGGTTGAGAGATGTTGAAAGAGAAATGAAAACTCTTC
GAAGAACAATGGCTGAAGAGAATGACGATCAAAATGATGAACAAGTGAAT
AAGTTAGCAAAAATATTGGAAAAACTTGAAACATCTGAAAAATCCAATCA
AACTAGTCAAATTAGAATTGAAGACTTGGAAAGAAAAATAAAAAGTTTAG
AAAATCAAAATTTTGAAATGAAAACTTCTCTACAATTAAAAGACGGCAAT
GTAATTGATAATAAATGCAAAACTGAAGAATTGATACGTGAGAATGCGTC
TCTGACGCGTCAATTAGAAGCAGCTTTAACGGATTCTAGGCGTAATGCTG
ATAATTCTAGAGAGAAAACTGTTGGTAAAGACCGTCAATTACAATCTCGA
GTTCATGATATTGAAACTCAATTAGCTCAACAACGAGCAGAAGCCAACAA
ATGGCGTCGTAATTCCGAAGAAATTGAGAGAAAATGTAATTCCAAATTAC
AAGATTTGAAATTACAACTTGAACAATCAGAAATTACTAATCGAAGCATG
CAAACTTATGTTCAGTTCTTGAAAAAATCTTATGCCAATGTTTTTGGTGA
TATTCCTTTATCTAATGGACTCAGTTGTCCAAATCCTCCGTATATAGGAC
AATCGTTAAGTTTTGGTGGATTTTAATAATTTTATTCATTAATAATTAAA
TGATATACTTTTGATAATATTTTTATTTTGTATGTTTTGAACATAGATTA
ATATCATTCTTGTTATTTGATAAGAAAATGCAAACTTTGGTTTGTAAAAA
ATAATATCTTTTTATATGTACGAAATAATATCAATATTTATACATTCAGT
TTCTGTCTTTTAAAAAAAA

Design Primers for Gsp_023053

back to top

protein sequence

>Gsp_023053-protein ID=Gsp_023053-protein|Name=Gsp_023053|organism=Girardia sp.|type=polypeptide|length=725bp
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIM
NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIAD
QCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQ
TSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENAS
LTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANK
WRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGD
IPLSNGLSCPNPPYIGQSLSFGGF*
back to top

coding sequence

>Gsp_023053.102.2276 ID=Gsp_023053.102.2276|Name=Gsp_023053.102.2276|organism=Girardia sp.|type=CDS|length=2175bp
ATGATGTCTCATGAATTTTCGAAACGAATACCAAGAAGTAGACCGTCAAG
TCCAGTTCATGTATTTGTTGATAAAGATACTCCAGTTCATGTGTATATGA
GAAAAGGTGAAAATGATCAATATAACTCGGAATTTACTCAACCTAGAAGT
AATAGTAGAAGTAATAAAATGAAAAGACCAAAGAAACCTGGATCTAATAT
ACCTACATCTAAATTAATGCGTAATTCCAACGAAAGAGTGAGATCAATGT
CTCCTCCTTGGGTACCTCCACCTGGTAAAACCACAAAAAACCATAGGAGC
GAATTGGTGAATCGGTATATGTGTAAATGTGATTTTGAAAATACAGGTAA
ATCGTGTTTGGGATCGTTTTGGAATGAAGAAGAAGCTGGATTCAGTCAAC
AAGATCGTTATGAACAACAAATCAATGAACTTCAAGATGAACTTGGTGAA
CTTCGAGAACAATTGAAAATTGAAAAGGAACGTGAACAGATTAGAAATAG
TGAAGATACTATTCAATATCAAGATGAAAAAATTGAAGAATTAAAACAAG
AAATTGATGTGATGGAAAAAGAAAATCATTTATTACGTGACAGTTTGGAA
AATACTCGGTCAAATATGAATTTATTTCCCGAATCAGACAAACTTATTCA
AATGTTAATTGAGGCTGAATTAGCAAGTGAACGATGCGCCCATCAAATGC
AACACGTATTTGATTATTTAAAGAGTACAATTAAAGAAGGTCATAAAATT
ACCAGTCGAGATGTCGATCGAATTAATACACAGTTCCATGATACTGAATC
TAGATTATTTGAATTTAAATCTGTAAACAATACTCTCAGAGATCTGTTGA
AAGACGCTCAACAAAGAGAAATTAATGGCCAAAATTCATTTGAAAAGGAT
AAAACATTCTTATCAAAAGTACGAAAGGAACTGGAAGACAGTATTTCTAA
ATTAGAATTAGAATTATTTGATAAAGACAAAGTGATTGATGATCTCCGAA
AGCAATTGGCATGTAAGAATGATGAAACCATTAATTTTGCCAGCACTCAC
GAATCATTGGAAAATGTTAAAGGCCATTTACAACAGCAATTGAAACAAAG
ATCTGGAGATATTAATCGCATGTCTGTTCAAATTCGAACATTAGAGAGTG
AACTTGCCAAAGAAAGATTAGATAAAGAGCATCTTATCGAATTGTTAAAA
AATCCAAAAGATCGTGGATTAGATGATCGAGATGTATTAAAGAAAGCAGC
CAGAGCTCAAAAACAAAGAGCAATAAAAGCAGAGGAAACAATTCAAGAAT
TGACAGCTATTTTGGCAGAAAAAGAAAGGCATATTGAACACTTAATAATG
AATAGTCGTGAAGATCAAGACAATCTGAGGCGCATGGATGAAATAATTGA
TGAGAATCAACATTTGCACAGACAAATCGTCAGCAACGATCAAGAAGACC
TCATCATTTCATTAAAACGAGAAAATGATAGTCTTCGTTCTATTGCCGAT
CAATGTGAATCACGGTTGAGAGATGTTGAAAGAGAAATGAAAACTCTTCG
AAGAACAATGGCTGAAGAGAATGACGATCAAAATGATGAACAAGTGAATA
AGTTAGCAAAAATATTGGAAAAACTTGAAACATCTGAAAAATCCAATCAA
ACTAGTCAAATTAGAATTGAAGACTTGGAAAGAAAAATAAAAAGTTTAGA
AAATCAAAATTTTGAAATGAAAACTTCTCTACAATTAAAAGACGGCAATG
TAATTGATAATAAATGCAAAACTGAAGAATTGATACGTGAGAATGCGTCT
CTGACGCGTCAATTAGAAGCAGCTTTAACGGATTCTAGGCGTAATGCTGA
TAATTCTAGAGAGAAAACTGTTGGTAAAGACCGTCAATTACAATCTCGAG
TTCATGATATTGAAACTCAATTAGCTCAACAACGAGCAGAAGCCAACAAA
TGGCGTCGTAATTCCGAAGAAATTGAGAGAAAATGTAATTCCAAATTACA
AGATTTGAAATTACAACTTGAACAATCAGAAATTACTAATCGAAGCATGC
AAACTTATGTTCAGTTCTTGAAAAAATCTTATGCCAATGTTTTTGGTGAT
ATTCCTTTATCTAATGGACTCAGTTGTCCAAATCCTCCGTATATAGGACA
ATCGTTAAGTTTTGGTGGATTTTAA
back to top
Gene Groups
Gsp_023053 is similar in sequence to the genes of this group: GG437
Gene NameGene ID
SMU15001741SMU15001741
SMU15005576SMU15005576
SMU15005577SMU15005577
SMU15005578SMU15005578
Ddo_003032Ddo_003032
Ddo_005045Ddo_005045
Ddo_009916Ddo_009916
Ddo_012914Ddo_012914
Gsp_000977Gsp_000977
Gsp_002888Gsp_002888
Gsp_019027Gsp_019027
Gsp_023053Gsp_023053
Pgr_024273Pgr_024273
Pmo_012872Pmo_012872
odf2Pmo_015154

Gene Group Protein Sequences

>SMU15001741

MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMI
NSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIAD
QCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQ
SSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENAS
LMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNK
WHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGD
MPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005576
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML
CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMA
NNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDK
SEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVL
QQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRD
RQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSE
ITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005577
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQED
QEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESR
LRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIR
IEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQL
EAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNC
EETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSN
GLSCPNPSYMGQSLSFNGF*
>SMU15005578
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSF
SNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLR
SIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSE
KSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELAR
ENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKA
ESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYAN
VFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>Ddo_003032 Ddo_003032
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLQSKSHADLEDGNDELLSKPLTELCDQCKLNSREYQQNLRHIDDIVE
ENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILR
KTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLE
GQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNAD
NVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQ
DLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQ
SSLNFGGF*
>Ddo_005045 Ddo_005045
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENL
RSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEAS
EKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLM
RENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQR
AETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYA
NVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Ddo_009916 Ddo_009916
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLLNSREYQQNLRHI
DDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKE
MKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKK
IRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDS
RRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKN
SSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNN
SFVPQSSLNFGGF*
>Ddo_012914 Ddo_012914
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGND
ELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEI
IIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINR
LSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSV
IDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRI
HDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQ
TYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Gsp_000977 Gsp_000977
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLIMNSREDQDNLRRMDEIIDE
NQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRR
TMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLEN
QNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADN
SREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQD
LKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQS
LSFGGF*
>Gsp_002888 Gsp_002888
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLISNQNQNETKSDSIPVIKSF
NNQYVQCEMNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRE
NDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEK
LETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKT
EELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQL
AQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLK
KSYANVFGDIPLSNGLSCPNPPYIGQSLSFGGF*
>Gsp_019027 Gsp_019027
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIS
NQNQNETKSDSIPVIKSFNNQYVQCEMNSREDQDNLRRMDEIIDENQHLH
RQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEE
NDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEM
KTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKT
VGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQL
EQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQSLSFGG
F*
>Gsp_023053 Gsp_023053
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIM
NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIAD
QCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQ
TSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENAS
LTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANK
WRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGD
IPLSNGLSCPNPPYIGQSLSFGGF*
>Pgr_024273 Pgr_024273
MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDG
LQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTR
GSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDEL
RRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLDESDHL
IQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDT
ESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLN
DTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLK
QKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSLKK
AARLQKQRAQKAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHC
AHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESV
IISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKL
SLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVI
DNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIH
DLEAQLAQQRAEAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHT
YVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF*
>Pmo_012872 Pmo_012872
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMSEFGVPNHISEPNRHCS
HCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHS
LKRENENLRSIADQCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQI
LQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNR
CKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDLE
AQLAQQRAEAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQ
FLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF*
>Pmo_015154 odf2
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMMESRENQEQLGQMNRIA
EENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESL
RHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCE
NQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNAD
NAREKINSKDRSLQSRIHDLEAQLAQQRAEAMKWRRSCEENDRKCSGKLQ
DIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGG
PICF*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.