Gsp_022278, Gsp_022278 (mRNA) Girardia sp.

Overview
NameGsp_022278
Unique NameGsp_022278
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length5754
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of Gsp_022278 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = 1
Query:  484 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 2553
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = -1
Query: 3202 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 5271
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Gsp_022278 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = 1
Query:  484 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 2553
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = -1
Query: 3202 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 5271
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Gsp_022278 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = 1
Query:  484 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 2553
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = -1
Query: 3202 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 5271
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Gsp_022278 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = 1
Query:  484 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 2553
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = -1
Query: 3202 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 5271
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Gsp_022278 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = 1
Query:  484 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 2553
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 246.899 bits (629), Expect = 2.867e-66
Identity = 193/723 (26.69%), Postives = 339/723 (46.89%), Query Frame = -1
Query: 3202 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPG------ELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 5271
            P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+                           +     +PG      ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  203 PTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------------------RRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Gsp_022278 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 1328.92 bits (3438), Expect = 0.000e+0
Identity = 662/696 (95.11%), Postives = 675/696 (96.98%), Query Frame = 1
Query:  469 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            V+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE     EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL
Sbjct:  140 VSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPE--EKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 1328.92 bits (3438), Expect = 0.000e+0
Identity = 662/696 (95.11%), Postives = 675/696 (96.98%), Query Frame = -1
Query: 3202 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 5286
            V+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE     EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL
Sbjct:  140 VSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPE--EKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 3 Score: 207.994 bits (528), Expect = 1.324e-53
Identity = 108/135 (80.00%), Postives = 121/135 (89.63%), Query Frame = 3
Query:   57 MDDLP-KMAKLETNGSENXXXXXXXXXXXXX-XIVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 455
            M+++P K+AKLE NGSE RG+    G  R   RIVEPNLQPA+IT+KTGN+GRTVKLQSNFTKFSVLRSEKFMMYDSVF  VGLSPKVKLQFIVRVCQ+NKLPGAFCFDGRRLFTSEKWHGESDIQEF+++EKK+
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKM 135          

HSP 4 Score: 207.994 bits (528), Expect = 1.324e-53
Identity = 108/135 (80.00%), Postives = 121/135 (89.63%), Query Frame = -3
Query: 5300 MDDLP-KMAKLETNGSENXXXXXXXXXXXXX-RIVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 5698
            M+++P K+AKLE NGSE RG+    G  R   RIVEPNLQPA+IT+KTGN+GRTVKLQSNFTKFSVLRSEKFMMYDSVF  VGLSPKVKLQFIVRVCQ+NKLPGAFCFDGRRLFTSEKWHGESDIQEF+++EKK+
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKM 135          
BLAST of Gsp_022278 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 1108.98 bits (2867), Expect = 0.000e+0
Identity = 527/695 (75.83%), Postives = 604/695 (86.91%), Query Frame = 1
Query:  469 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            V+T L +TEEYYQMINVLLNNLQ++MGQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFK+RYNI LT   QPFVLTRVKK              +++   E EAP++ D+TLNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERLDDIP+FC+WI+ ++N+ GM NKW LKIDN PLEIEGRELP CDVISG  +INEKI DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSG AK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVS+KTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF N P+G+QEFH+TL  NF  AL +FK+ Y ILP RI+V+RDGVGD+QLQFTK FEVDAMKPL+ENIYK NG  VPQIIYVIVKKR+GTKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKG+ PA+INERIRNRLFYL
Sbjct:  133 VSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK---------IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 1108.98 bits (2867), Expect = 0.000e+0
Identity = 527/695 (75.83%), Postives = 604/695 (86.91%), Query Frame = -1
Query: 3202 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 5286
            V+T L +TEEYYQMINVLLNNLQ++MGQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFK+RYNI LT   QPFVLTRVKK              +++   E EAP++ D+TLNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERLDDIP+FC+WI+ ++N+ GM NKW LKIDN PLEIEGRELP CDVISG  +INEKI DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSG AK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVS+KTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF N P+G+QEFH+TL  NF  AL +FK+ Y ILP RI+V+RDGVGD+QLQFTK FEVDAMKPL+ENIYK NG  VPQIIYVIVKKR+GTKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKG+ PA+INERIRNRLFYL
Sbjct:  133 VSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK---------IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 3 Score: 147.132 bits (370), Expect = 2.684e-34
Identity = 64/104 (61.54%), Postives = 84/104 (80.77%), Query Frame = 3
Query:  150 IVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKIDF 461
            IVEP+LQP E  DK GN+G+ V+LQSNFTKFSV +SEK++MYD+ F  +GLSPK+KLQ +VR+C++  LPG+FC+DGRRLFTS+ W   SDI+EF  +EKK+  
Sbjct:   27 IVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSL 130          

HSP 4 Score: 147.132 bits (370), Expect = 2.684e-34
Identity = 64/104 (61.54%), Postives = 84/104 (80.77%), Query Frame = -3
Query: 5294 IVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKIDF 5605
            IVEP+LQP E  DK GN+G+ V+LQSNFTKFSV +SEK++MYD+ F  +GLSPK+KLQ +VR+C++  LPG+FC+DGRRLFTS+ W   SDI+EF  +EKK+  
Sbjct:   27 IVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSL 130          
BLAST of Gsp_022278 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 396/696 (56.90%), Postives = 523/696 (75.14%), Query Frame = 1
Query:  469 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            + T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL
Sbjct:  129 LTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 396/696 (56.90%), Postives = 523/696 (75.14%), Query Frame = -1
Query: 3202 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 5286
            + T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL
Sbjct:  129 LTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 3 Score: 86.6557 bits (213), Expect = 1.411e-15
Identity = 41/102 (40.20%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  150 IVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 455
            I+EP LQP  +TDK G  GR V L+SN+  F++     F MYD V ++  +  K++L       ++N  P  FCFDGRRLFT+ KWH + D +    ++ +I
Sbjct:   25 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEI 124          

HSP 4 Score: 86.6557 bits (213), Expect = 1.411e-15
Identity = 41/102 (40.20%), Postives = 60/102 (58.82%), Query Frame = -3
Query: 5300 IVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 5605
            I+EP LQP  +TDK G  GR V L+SN+  F++     F MYD V ++  +  K++L       ++N  P  FCFDGRRLFT+ KWH + D +    ++ +I
Sbjct:   25 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEI 124          
BLAST of Gsp_022278 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 259.996 bits (663), Expect = 4.454e-70
Identity = 206/707 (29.14%), Postives = 333/707 (47.10%), Query Frame = 1
Query:  484 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKIN-EKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNN 2508
            P +    Q  N+L   +  ++  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+                               + +P E C+L G +D+ +++ ++ K L S  +  P +R   I    + I  + +       W L  +NK L + GR LP   +I G           DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V+ K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S  V Q RG QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV    P I    K+ G    P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D            + P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:  201 PSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR-------------------LGPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRG-QEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEV----PQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN---------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          

HSP 2 Score: 259.996 bits (663), Expect = 4.454e-70
Identity = 206/707 (29.14%), Postives = 333/707 (47.10%), Query Frame = -1
Query: 3247 PETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKIN-EKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNN 5271
            P +    Q  N+L   +  ++  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+                               + +P E C+L G +D+ +++ ++ K L S  +  P +R   I    + I  + +       W L  +NK L + GR LP   +I G           DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V+ K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S  V Q RG QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV    P I    K+ G    P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D            + P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:  201 PSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR-------------------LGPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRG-QEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEV----PQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN---------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of Gsp_022278 vs. uniprot
Match: gi|519883174|sp|Q7PLK0|AGO3_DROME (RecName: Full=Protein argonaute-3)

HSP 1 Score: 248.825 bits (634), Expect = 1.710e-66
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  763 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 248.825 bits (634), Expect = 1.710e-66
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 3202 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 4992
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Gsp_022278 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 248.825 bits (634), Expect = 1.974e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  763 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 248.825 bits (634), Expect = 1.974e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 3202 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 4992
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Gsp_022278 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 248.825 bits (634), Expect = 1.974e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  763 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 248.825 bits (634), Expect = 1.974e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 3202 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 4992
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Gsp_022278 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 248.825 bits (634), Expect = 1.974e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  763 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 2553
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 248.825 bits (634), Expect = 1.974e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 3202 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 4992
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Gsp_022278 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 235.728 bits (600), Expect = 1.889e-63
Identity = 184/592 (31.08%), Postives = 284/592 (47.97%), Query Frame = 1
Query:  796 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD---DW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 2490
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI   + D   DW  +F R     K    +   V+   RN  + + F   V+  +R     A   K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  233 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIF--VCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEF---VQMCIRT----ASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          

HSP 2 Score: 235.728 bits (600), Expect = 1.889e-63
Identity = 184/592 (31.08%), Postives = 284/592 (47.97%), Query Frame = -1
Query: 3265 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD---DW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 4959
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI   + D   DW  +F R     K    +   V+   RN  + + F   V+  +R     A   K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  233 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIF--VCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEF---VQMCIRT----ASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          
BLAST of Gsp_022278 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 235.728 bits (600), Expect = 3.331e-63
Identity = 182/592 (30.74%), Postives = 283/592 (47.80%), Query Frame = 1
Query:  796 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD---DW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 2490
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI   + D   DW  +F R     K    +   V+   RN  + + F+    +   +M       K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  304 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIF--VCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSM-------KMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          

HSP 2 Score: 235.728 bits (600), Expect = 3.331e-63
Identity = 182/592 (30.74%), Postives = 283/592 (47.80%), Query Frame = -1
Query: 3265 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD---DW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 4959
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI   + D   DW  +F R     K    +   V+   RN  + + F+    +   +M       K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  304 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIF--VCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSM-------KMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          
BLAST of Gsp_022278 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 1333.93 bits (3451), Expect = 0.000e+0
Identity = 662/698 (94.84%), Postives = 677/698 (96.99%), Query Frame = 1
Query:  469 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEK--DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 2556
            V+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE+E    +  DMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL*
Sbjct:  140 VSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          

HSP 2 Score: 1333.93 bits (3451), Expect = 0.000e+0
Identity = 662/698 (94.84%), Postives = 677/698 (96.99%), Query Frame = -1
Query: 3199 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEK--DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 5286
            V+TILPETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE+E    +  DMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL*
Sbjct:  140 VSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          

HSP 3 Score: 208.379 bits (529), Expect = 8.560e-55
Identity = 108/135 (80.00%), Postives = 121/135 (89.63%), Query Frame = 3
Query:   57 MDDLP-KMAKLETNGSENXXXXXXXXXXXXX-XIVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 455
            M+++P K+AKLE NGSE RG+    G  R   RIVEPNLQPA+IT+KTGN+GRTVKLQSNFTKFSVLRSEKFMMYDSVF  VGLSPKVKLQFIVRVCQ+NKLPGAFCFDGRRLFTSEKWHGESDIQEF+++EKK+
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKM 135          

HSP 4 Score: 208.379 bits (529), Expect = 8.560e-55
Identity = 108/135 (80.00%), Postives = 121/135 (89.63%), Query Frame = -3
Query: 5300 MDDLP-KMAKLETNGSENXXXXXXXXXXXXX-RIVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 5698
            M+++P K+AKLE NGSE RG+    G  R   RIVEPNLQPA+IT+KTGN+GRTVKLQSNFTKFSVLRSEKFMMYDSVF  VGLSPKVKLQFIVRVCQ+NKLPGAFCFDGRRLFTSEKWHGESDIQEF+++EKK+
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKM 135          
BLAST of Gsp_022278 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 397/697 (56.96%), Postives = 524/697 (75.18%), Query Frame = 1
Query:  469 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 2556
            + T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL*
Sbjct:  172 LTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          

HSP 2 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 397/697 (56.96%), Postives = 524/697 (75.18%), Query Frame = -1
Query: 3199 VATILPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 5286
            + T L  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL*
Sbjct:  172 LTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          

HSP 3 Score: 86.2705 bits (212), Expect = 1.150e-16
Identity = 41/102 (40.20%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  150 IVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 455
            I+EP LQP  +TDK G  GR V L+SN+  F++     F MYD V ++  +  K++L       ++N  P  FCFDGRRLFT+ KWH + D +    ++ +I
Sbjct:   68 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEI 167          

HSP 4 Score: 86.2705 bits (212), Expect = 1.150e-16
Identity = 41/102 (40.20%), Postives = 60/102 (58.82%), Query Frame = -3
Query: 5300 IVEPNLQPAEITDKTGNLGRTVKLQSNFTKFSVLRSEKFMMYDSVFQSVGLSPKVKLQFIVRVCQDNKLPGAFCFDGRRLFTSEKWHGESDIQEFAYEEKKI 5605
            I+EP LQP  +TDK G  GR V L+SN+  F++     F MYD V ++  +  K++L       ++N  P  FCFDGRRLFT+ KWH + D +    ++ +I
Sbjct:   68 IIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEI 167          
BLAST of Gsp_022278 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 225.328 bits (573), Expect = 8.003e-60
Identity = 174/628 (27.71%), Postives = 303/628 (48.25%), Query Frame = 1
Query:  733 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD--MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNN-KINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND--VERCLNDAARSGSGSAKMA---LVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENI---YKSNGFPVPQIIYVIVKKRVGTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 2556
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK+ Y +++   +QP ++++               +    + +  +  +E D  +   IP ELC L G +D    +  L + L    +  P++R + +  F + I   + A  +   W + I+   + I   ++ P  +  GN   ++     ++K       +    + E  ++I  ++     N +       ++ R+    GK      N+   E  L +  R+ +   ++    L  V +DR Y  +K F      +   V          K   V  N   +QI AK G + W V+I ++  M+VG+D +H+ K   +S+ A V S N+  T++ S  +     +E    L       L+ + +  + LP+ I ++RDGV D QL + +  E++    + E+    YK      P ++Y +V+KR+ T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TPT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+    N  A  +  + +RLFYL*
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK--------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVN-IALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQ----NLKAEPSNLLCDRLFYL* 975          

HSP 2 Score: 225.328 bits (573), Expect = 8.003e-60
Identity = 174/628 (27.71%), Postives = 303/628 (48.25%), Query Frame = -1
Query: 3199 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD--MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNN-KINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND--VERCLNDAARSGSGSAKMA---LVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENI---YKSNGFPVPQIIYVIVKKRVGTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 5022
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK+ Y +++   +QP ++++               +    + +  +  +E D  +   IP ELC L G +D    +  L + L    +  P++R + +  F + I   + A  +   W + I+   + I   ++ P  +  GN   ++     ++K       +    + E  ++I  ++     N +       ++ R+    GK      N+   E  L +  R+ +   ++    L  V +DR Y  +K F      +   V          K   V  N   +QI AK G + W V+I ++  M+VG+D +H+ K   +S+ A V S N+  T++ S  +     +E    L       L+ + +  + LP+ I ++RDGV D QL + +  E++    + E+    YK      P ++Y +V+KR+ T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TPT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+    N  A  +  + +RLFYL*
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK--------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVN-IALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQ----NLKAEPSNLLCDRLFYL* 975          
BLAST of Gsp_022278 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 125.946 bits (315), Expect = 8.066e-29
Identity = 141/558 (25.27%), Postives = 234/558 (41.94%), Query Frame = 1
Query:  892 GRTL--SYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSD-NANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDAR---VGKVNTC----GPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPT------MIVGMDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 2475
            G+T+  +  +YF+DRY ++L     P +                            +  QE+  T  +P E+C +       K   D+Q S  +++K   R   D      N +R S+ NA+     + + ++ +  +I+GR +P   +  G     +  P    W     QF    + K         +   + ++ +    Q+L+ +  DA    VG+   C    G + VE        S +G   + +V      VYA+VK    +  GL TQCV  +N    N    + +SN   ++I  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ +RDGV + Q     N E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  370 GQTIECTVTKYFQDRYGMKLQHPHLPCL----------------------------QVGQEQKHTY-LPLEVCNIVSGQRCIKKLTDMQTS--TMIKATARSAPDREKEINNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVR-EDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN---VNKPSPQTLSN-LCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          

HSP 2 Score: 125.946 bits (315), Expect = 8.066e-29
Identity = 141/558 (25.27%), Postives = 234/558 (41.94%), Query Frame = -1
Query: 3280 GRTL--SYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSD-NANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDAR---VGKVNTC----GPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPT------MIVGMDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 4863
            G+T+  +  +YF+DRY ++L     P +                            +  QE+  T  +P E+C +       K   D+Q S  +++K   R   D      N +R S+ NA+     + + ++ +  +I+GR +P   +  G     +  P    W     QF    + K         +   + ++ +    Q+L+ +  DA    VG+   C    G + VE        S +G   + +V      VYA+VK    +  GL TQCV  +N    N    + +SN   ++I  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ +RDGV + Q     N E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  370 GQTIECTVTKYFQDRYGMKLQHPHLPCL----------------------------QVGQEQKHTY-LPLEVCNIVSGQRCIKKLTDMQTS--TMIKATARSAPDREKEINNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVR-EDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN---VNKPSPQTLSN-LCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Gsp_022278 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 114.005 bits (284), Expect = 4.044e-25
Identity = 147/636 (23.11%), Postives = 259/636 (40.72%), Query Frame = 1
Query:  706 LTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDR--KHEIDVVIVDRNDFQYKNFMNDVEQELRNMR--IDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMA--LVFVP-DDRVYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGMDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNQPRGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG 2502
            LT  L   R+      N+  KAY+R+          I  ++NK+ R  +I E N           L+  +YF+  YNI+L   + P V T   KP                                +P EL  +       +S+  + + +         +RL  + +  + ++  +  +     ++++ID K + ++ R L   + I G  +        W     +F    D+     +  V  +R+  +    + D+E +L      +  R+G     +     ++E+   D  R+     K    LVFV  +D  Y +VK F  +  G++TQC+      NR     + + N  ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + + Q   ++E        E     +NL +  +K    + P+R++ +RDGV + Q       E+ A++   + + K      P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P +Y+VL D          +    +ELQ  TY L H+Y     ++  P P +YAH LA   G+   G
Sbjct:  407 LTRKLKTLRVQANHLKNADGKAYSRKYT--------IFGFSNKSAREEKIVEKN-----------LTIEQYFQKEYNIKLKYPNLPMVKTSPNKPTF------------------------------VPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYAT-LNRQKFLDQYLGN-IMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          

HSP 2 Score: 114.005 bits (284), Expect = 4.044e-25
Identity = 147/636 (23.11%), Postives = 259/636 (40.72%), Query Frame = -1
Query: 3253 LTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDR--KHEIDVVIVDRNDFQYKNFMNDVEQELRNMR--IDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMA--LVFVP-DDRVYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGMDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNQPRGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG 5049
            LT  L   R+      N+  KAY+R+          I  ++NK+ R  +I E N           L+  +YF+  YNI+L   + P V T   KP                                +P EL  +       +S+  + + +         +RL  + +  + ++  +  +     ++++ID K + ++ R L   + I G  +        W     +F    D+     +  V  +R+  +    + D+E +L      +  R+G     +     ++E+   D  R+     K    LVFV  +D  Y +VK F  +  G++TQC+      NR     + + N  ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + + Q   ++E        E     +NL +  +K    + P+R++ +RDGV + Q       E+ A++   + + K      P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P +Y+VL D          +    +ELQ  TY L H+Y     ++  P P +YAH LA   G+   G
Sbjct:  407 LTRKLKTLRVQANHLKNADGKAYSRKYT--------IFGFSNKSAREEKIVEKN-----------LTIEQYFQKEYNIKLKYPNLPMVKTSPNKPTF------------------------------VPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYAT-LNRQKFLDQYLGN-IMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          
The following BLAST results are available for this feature:
BLAST of Gsp_022278 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|2.867e-6626.69piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|2.867e-6626.69PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|2.867e-6626.69PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|2.867e-6626.69PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|2.867e-6626.69PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Gsp_022278 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD1.324e-5395.11RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA2.684e-3475.83RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD1.411e-1556.90RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE4.454e-7029.14RecName: Full=Piwi-like protein 1[more]
gi|519883174|sp|Q7PLK0|AGO3_DROME1.710e-6628.24RecName: Full=Protein argonaute-3[more]
back to top
BLAST of Gsp_022278 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221513719|ref|NP_001036627.2|1.974e-6728.24argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|1.974e-6728.24argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|1.974e-6728.24argonaute 3, isoform F [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|1.889e-6331.08aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|3.331e-6330.74aubergine, isoform A [Drosophila melanogaster][more]
back to top
BLAST of Gsp_022278 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159478.560e-5594.84SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261771.150e-1656.96SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001118.003e-6027.71Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389368.066e-2925.27dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329884.044e-2523.11SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_022278 ID=Gsp_022278|Name=Gsp_022278|organism=Girardia sp.|type=mRNA|length=5754bp
CTTAATTTTCATTTCTAATAATTTGTTTAAATTATATACATTAAAACTTG
AAAAAAATGGATGATCTTCCAAAAATGGCAAAGTTAGAAACGAATGGTAG
TGAAAATAGAGGAAGAGGAACTCGTGGTGGACTACGTAGAACTTTTAGAA
TAGTGGAACCTAATCTTCAACCCGCAGAGATAACTGATAAAACTGGTAAC
CTTGGCAGAACCGTAAAACTTCAATCCAACTTTACCAAATTTTCTGTTTT
ACGATCTGAAAAATTCATGATGTATGATTCAGTTTTTCAATCTGTTGGAT
TGTCTCCAAAGGTTAAACTCCAATTTATTGTAAGAGTTTGTCAAGATAAT
AAGTTACCGGGAGCATTCTGTTTTGATGGCCGAAGATTATTTACTAGTGA
AAAGTGGCACGGTGAATCAGATATACAAGAATTTGCTTATGAGGAGAAAA
AAATTGACTTTACGACTAGTAGCCACAATTCTTCCAGAAACTGAAGAGTA
CTACCAAATGATTAATGTGTTATTGAACAATCTACAGGTAATGATGGGTC
AAGAACGCATTGGAAAGGGATATTTTTTGAGTCCAAATATAACTAAGGAC
GAAGTTCCTCGAAACAGTGGTCCGACATTCTTTGAAACAAATAGTTTTAA
AGTATTAGGAGGGTTTGGAACAACATTACAAAGAGGTACCAAGCCAACTG
GAGAACTAACAACATTATTGTATATTGAGAGAATAAACAGAGTTTTGAAC
GACAATTCAGTAATGAAAGCTTACAATAGACGAAGTATTGACCAGTTGAT
TGGCCGGGATATTATTACGAAGTATAATAACAAAACTTATAGAATATCCG
AGATAAAAGAAATGAATGTTGATGAGAAATTTGAAATGGGTGGACGTACT
TTATCGTACGCAGAATATTTCAAAGATCGATATAACATACGCTTGACACA
AGGCGATCAGCCTTTTGTCTTAACTAGAGTTAAGAAGCCTATGCGCCGAG
AAAGAAGAAAACCTGGAGAAGAAGATAAAGAAAAAGAAAGGGAAAAGGAA
AAGGAAGCACCTCAAGAAAAAGATATGACATTGAATATTCCAGGTGAACT
ATGCTTCCTATGTGGATTTTCAGATCAAGAAAAATCGAACATGGACCTTC
AAAAAAGCCTGGGTAGTGTTTTAAAAAGAGAACCACGCGAAAGACTTGAT
GATATTCCAGCCTTTTGTAATTGGATTAGAGGCAGTGACAATGCAAACGG
AATGTGTAATAAGTGGCAATTAAAGATTGATAATAAACCATTGGAAATAG
AAGGTCGTGAATTGCCACCATGTGATGTTATAAGTGGTAATAATAAAATT
AACGAGAAAATTCCAGATGATTGGAAATTTGGAAGAGTGCAGTTTGATAT
TAAAAGAGACCGTAAACACGAAATTGATGTTGTAATTGTTGATAGAAATG
ATTTCCAATATAAAAATTTCATGAATGACGTAGAACAGGAATTAAGAAAT
ATGAGAATAGATGCCAGAGTTGGTAAAGTTAATACATGCGGGCCAAATGA
CGTTGAGAGATGCTTGAATGATGCCGCAAGAAGCGGCAGTGGCTCTGCAA
AAATGGCCTTGGTTTTTGTCCCGGATGATCGAGTTTATGCAAAGGTTAAA
TCATTTACCATGAGCACCGGACTTTTAACACAGTGTGTTACCACGAGGAA
TGGAACAAACAGAAATGATAAACGCAGGAAAGTTGTTTCGAATAAAACGG
TTATGCAAATATTTGCCAAATTTGGTTACGATCCATGGACTGTTGAAATT
AAATTGCGGCCTACGATGATTGTTGGTATGGATACATATCACAATAAATC
AAGTAAGAAGTCTATTCAAGCATCTGTATTCTCAATCAATAGTACATTTA
CTCAATATATGAGTTTTGTTAATCAACCACGTGGTAGACAAGAATTTCAC
GAAACACTTGGTAAAAATTTCAATCTCGCATTGGAAGATTTCAAAAAACG
ATATGACATCTTACCACAGAGAATCCTGGTTTTCAGAGATGGTGTTGGAG
ATAATCAGTTGCAATTTACAAAGAATTTTGAAGTTGATGCTATGAAACCA
TTAATAGAAAATATATATAAAAGCAACGGTTTCCCAGTTCCACAAATAAT
TTATGTGATTGTTAAAAAAAGAGTGGGAACTAAATTATTCAATCGTGGAA
ATAATCCAAATCCTGGAACTGTTGTGGATAAAGAAATTGTAAAACCAAAT
TTCTATGAATTTTTCTTAGTGTCTCAAAGAACTACAAAGGGTACTGCAAC
GCCAACAAATTACAATGTCTTGGAAGATACTCGATTGTTGACTAAGAAAG
GAACAATGGACCCAATGGCTCCAAATGAACTTCAGAAAATTACATACGCG
TTGACCCATCTTTATTTCAATTGGATGGGTACTATTCGAGTACCAGTCCC
TGTGCATTATGCTCATCGGTTGGCGGAATTGGTTGGCAAAGTTCATAAAG
GCAATAATCCTGCTGTAATCAATGAAAGAATCAGGAACAGGCTCTTCTAT
TTATAAAATATAGTTCGGAGTATTATAAAATTTATACATTTTATGTTTAT
TATTATTCCGTACATGGATTTTATTAATTGTTTCTATTTCTGATGTAATC
CCAAAAGTTGTGTTTTGTAGAACTATTATTAAATGTTTGTTAAAGTTTGT
ATTAAAAACATCAAGGTGATTGAATGTTATTTAGTTGTTATTAAATGATA
ATAATATTAGTTGTAAAAATTGTTAGTGTTTAGAATAATCAATTAATACA
GTCTTTTATTATGTTTATTTGTGTTATTTAATAAAAAATAACCTGATAAA
TTGAGTTATTTCGGAGTTATTATTTCGCGAAATAATAACTCCGAAATAAC
TCAATTTATCAGGTTATTTTTTATTAAATAACACAAATAAACATAATAAA
AGACTGTATTAATTGATTATTCTAAACACTAACAATTTTTACAACTAATA
TTATTATCATTTAATAACAACTAAATAACATTCAATCACCTTGATGTTTT
TAATACAAACTTTAACAAACATTTAATAATAGTTCTACAAAACACAACTT
TTGGGATTACATCAGAAATAGAAACAATTAATAAAATCCATGTACGGAAT
AATAATAAACATAAAATGTATAAATTTTATAATACTCCGAACTATATTTT
ATAAATAGAAGAGCCTGTTCCTGATTCTTTCATTGATTACAGCAGGATTA
TTGCCTTTATGAACTTTGCCAACCAATTCCGCCAACCGATGAGCATAATG
CACAGGGACTGGTACTCGAATAGTACCCATCCAATTGAAATAAAGATGGG
TCAACGCGTATGTAATTTTCTGAAGTTCATTTGGAGCCATTGGGTCCATT
GTTCCTTTCTTAGTCAACAATCGAGTATCTTCCAAGACATTGTAATTTGT
TGGCGTTGCAGTACCCTTTGTAGTTCTTTGAGACACTAAGAAAAATTCAT
AGAAATTTGGTTTTACAATTTCTTTATCCACAACAGTTCCAGGATTTGGA
TTATTTCCACGATTGAATAATTTAGTTCCCACTCTTTTTTTAACAATCAC
ATAAATTATTTGTGGAACTGGGAAACCGTTGCTTTTATATATATTTTCTA
TTAATGGTTTCATAGCATCAACTTCAAAATTCTTTGTAAATTGCAACTGA
TTATCTCCAACACCATCTCTGAAAACCAGGATTCTCTGTGGTAAGATGTC
ATATCGTTTTTTGAAATCTTCCAATGCGAGATTGAAATTTTTACCAAGTG
TTTCGTGAAATTCTTGTCTACCACGTGGTTGATTAACAAAACTCATATAT
TGAGTAAATGTACTATTGATTGAGAATACAGATGCTTGAATAGACTTCTT
ACTTGATTTATTGTGATATGTATCCATACCAACAATCATCGTAGGCCGCA
ATTTAATTTCAACAGTCCATGGATCGTAACCAAATTTGGCAAATATTTGC
ATAACCGTTTTATTCGAAACAACTTTCCTGCGTTTATCATTTCTGTTTGT
TCCATTCCTCGTGGTAACACACTGTGTTAAAAGTCCGGTGCTCATGGTAA
ATGATTTAACCTTTGCATAAACTCGATCATCCGGGACAAAAACCAAGGCC
ATTTTTGCAGAGCCACTGCCGCTTCTTGCGGCATCATTCAAGCATCTCTC
AACGTCATTTGGCCCGCATGTATTAACTTTACCAACTCTGGCATCTATTC
TCATATTTCTTAATTCCTGTTCTACGTCATTCATGAAATTTTTATATTGG
AAATCATTTCTATCAACAATTACAACATCAATTTCGTGTTTACGGTCTCT
TTTAATATCAAACTGCACTCTTCCAAATTTCCAATCATCTGGAATTTTCT
CGTTAATTTTATTATTACCACTTATAACATCACATGGTGGCAATTCACGA
CCTTCTATTTCCAATGGTTTATTATCAATCTTTAATTGCCACTTATTACA
CATTCCGTTTGCATTGTCACTGCCTCTAATCCAATTACAAAAGGCTGGAA
TATCATCAAGTCTTTCGCGTGGTTCTCTTTTTAAAACACTACCCAGGCTT
TTTTGAAGGTCCATGTTCGATTTTTCTTGATCTGAAAATCCACATAGGAA
GCATAGTTCACCTGGAATATTCAATGTCATATCTTTTTCTTGAGGTGCTT
CCTTTTCCTTTTCCCTTTCTTTTTCTTTATCTTCTTCTCCAGGTTTTCTT
CTTTCTCGGCGCATAGGCTTCTTAACTCTAGTTAAGACAAAAGGCTGATC
GCCTTGTGTCAAGCGTATGTTATATCGATCTTTGAAATATTCTGCGTACG
ATAAAGTACGTCCACCCATTTCAAATTTCTCATCAACATTCATTTCTTTT
ATCTCGGATATTCTATAAGTTTTGTTATTATACTTCGTAATAATATCCCG
GCCAATCAACTGGTCAATACTTCGTCTATTGTAAGCTTTCATTACTGAAT
TGTCGTTCAAAACTCTGTTTATTCTCTCAATATACAATAATGTTGTTAGT
TCTCCAGTTGGCTTGGTACCTCTTTGTAATGTTGTTCCAAACCCTCCTAA
TACTTTAAAACTATTTGTTTCAAAGAATGTCGGACCACTGTTTCGAGGAA
CTTCGTCCTTAGTTATATTTGGACTCAAAAAATATCCCTTTCCAATGCGT
TCTTGACCCATCATTACCTGTAGATTGTTCAATAACACATTAATCATTTG
GTAGTACTCTTCAGTTTCTGGAAGAATTGTGGCTACTAGTCGTAAAGTCA
ATTTTTTTCTCCTCATAAGCAAATTCTTGTATATCTGATTCACCGTGCCA
CTTTTCACTAGTAAATAATCTTCGGCCATCAAAACAGAATGCTCCCGGTA
ACTTATTATCTTGACAAACTCTTACAATAAATTGGAGTTTAACCTTTGGA
GACAATCCAACAGATTGAAAAACTGAATCATACATCATGAATTTTTCAGA
TCGTAAAACAGAAAATTTGGTAAAGTTGGATTGAAGTTTTACGGTTCTGC
CAAGGTTACCAGTTTTATCAGTTATCTCTGCGGGTTGAAGATTAGGTTCC
ACTATTCTAAAAGTTCTACGTAGTCCACCACGAGTTCCTCTTCCTCTATT
TTCACTACCATTCGTTTCTAACTTTGCCATTTTTGGAAGATCATCCATTT
TTTTCAAGTTTTAATGTATATAATTTAAACAAATTATTAGAAATGAAAAT
TAAG

Design Primers for Gsp_022278

back to top

protein sequence

>Gsp_022278-protein ID=Gsp_022278-protein|Name=Gsp_022278|organism=Girardia sp.|type=polypeptide|length=727bp
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
back to top

coding sequence

>Gsp_022278.376.2556 ID=Gsp_022278.376.2556|Name=Gsp_022278.376.2556|organism=Girardia sp.|type=CDS|length=2181bp
ATGGCCGAAGATTATTTACTAGTGAAAAGTGGCACGGTGAATCAGATATA
CAAGAATTTGCTTATGAGGAGAAAAAAATTGACTTTACGACTAGTAGCCA
CAATTCTTCCAGAAACTGAAGAGTACTACCAAATGATTAATGTGTTATTG
AACAATCTACAGGTAATGATGGGTCAAGAACGCATTGGAAAGGGATATTT
TTTGAGTCCAAATATAACTAAGGACGAAGTTCCTCGAAACAGTGGTCCGA
CATTCTTTGAAACAAATAGTTTTAAAGTATTAGGAGGGTTTGGAACAACA
TTACAAAGAGGTACCAAGCCAACTGGAGAACTAACAACATTATTGTATAT
TGAGAGAATAAACAGAGTTTTGAACGACAATTCAGTAATGAAAGCTTACA
ATAGACGAAGTATTGACCAGTTGATTGGCCGGGATATTATTACGAAGTAT
AATAACAAAACTTATAGAATATCCGAGATAAAAGAAATGAATGTTGATGA
GAAATTTGAAATGGGTGGACGTACTTTATCGTACGCAGAATATTTCAAAG
ATCGATATAACATACGCTTGACACAAGGCGATCAGCCTTTTGTCTTAACT
AGAGTTAAGAAGCCTATGCGCCGAGAAAGAAGAAAACCTGGAGAAGAAGA
TAAAGAAAAAGAAAGGGAAAAGGAAAAGGAAGCACCTCAAGAAAAAGATA
TGACATTGAATATTCCAGGTGAACTATGCTTCCTATGTGGATTTTCAGAT
CAAGAAAAATCGAACATGGACCTTCAAAAAAGCCTGGGTAGTGTTTTAAA
AAGAGAACCACGCGAAAGACTTGATGATATTCCAGCCTTTTGTAATTGGA
TTAGAGGCAGTGACAATGCAAACGGAATGTGTAATAAGTGGCAATTAAAG
ATTGATAATAAACCATTGGAAATAGAAGGTCGTGAATTGCCACCATGTGA
TGTTATAAGTGGTAATAATAAAATTAACGAGAAAATTCCAGATGATTGGA
AATTTGGAAGAGTGCAGTTTGATATTAAAAGAGACCGTAAACACGAAATT
GATGTTGTAATTGTTGATAGAAATGATTTCCAATATAAAAATTTCATGAA
TGACGTAGAACAGGAATTAAGAAATATGAGAATAGATGCCAGAGTTGGTA
AAGTTAATACATGCGGGCCAAATGACGTTGAGAGATGCTTGAATGATGCC
GCAAGAAGCGGCAGTGGCTCTGCAAAAATGGCCTTGGTTTTTGTCCCGGA
TGATCGAGTTTATGCAAAGGTTAAATCATTTACCATGAGCACCGGACTTT
TAACACAGTGTGTTACCACGAGGAATGGAACAAACAGAAATGATAAACGC
AGGAAAGTTGTTTCGAATAAAACGGTTATGCAAATATTTGCCAAATTTGG
TTACGATCCATGGACTGTTGAAATTAAATTGCGGCCTACGATGATTGTTG
GTATGGATACATATCACAATAAATCAAGTAAGAAGTCTATTCAAGCATCT
GTATTCTCAATCAATAGTACATTTACTCAATATATGAGTTTTGTTAATCA
ACCACGTGGTAGACAAGAATTTCACGAAACACTTGGTAAAAATTTCAATC
TCGCATTGGAAGATTTCAAAAAACGATATGACATCTTACCACAGAGAATC
CTGGTTTTCAGAGATGGTGTTGGAGATAATCAGTTGCAATTTACAAAGAA
TTTTGAAGTTGATGCTATGAAACCATTAATAGAAAATATATATAAAAGCA
ACGGTTTCCCAGTTCCACAAATAATTTATGTGATTGTTAAAAAAAGAGTG
GGAACTAAATTATTCAATCGTGGAAATAATCCAAATCCTGGAACTGTTGT
GGATAAAGAAATTGTAAAACCAAATTTCTATGAATTTTTCTTAGTGTCTC
AAAGAACTACAAAGGGTACTGCAACGCCAACAAATTACAATGTCTTGGAA
GATACTCGATTGTTGACTAAGAAAGGAACAATGGACCCAATGGCTCCAAA
TGAACTTCAGAAAATTACATACGCGTTGACCCATCTTTATTTCAATTGGA
TGGGTACTATTCGAGTACCAGTCCCTGTGCATTATGCTCATCGGTTGGCG
GAATTGGTTGGCAAAGTTCATAAAGGCAATAATCCTGCTGTAATCAATGA
AAGAATCAGGAACAGGCTCTTCTATTTATAA
back to top
Gene Groups
Gsp_022278 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.