Gsp_020345, Gsp_020345 (mRNA) Girardia sp.

Overview
NameGsp_020345
Unique NameGsp_020345
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1594
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of Gsp_020345 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 230.72 bits (587), Expect = 3.685e-68
Identity = 125/374 (33.42%), Postives = 209/374 (55.88%), Query Frame = 3
Query:  207 EDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKEN 1328
            +D  DKLN+ ++  I+ +  ++V+ K Y   P+ C++  T +    + Y ENYCWV  T  +   + IP   ++     +N++I YYQWVPF+L L+ ++FYVP ++W+L+ +   G +++SL   A  +       R   ++ I   +E+ L        G       N  K+ N  + ++  G  +   YI +K +Y +N++GQ+FL+  FLG  S    +G  +L+++ +G+EW ++G FPRVT C   E+K LG  +++  QC L INM NEKI++FLWFW F++   T  S+  W +   + SR+  F+ K+L   + Y   D Q +  F+  FLR DGVFL+RM+  +AG++   ++   LW  Y +N
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSG-------NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKW--YGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Gsp_020345 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 220.705 bits (561), Expect = 5.487e-63
Identity = 128/372 (34.41%), Postives = 208/372 (55.91%), Query Frame = 3
Query:  207 EDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMM---HQSYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWE 1313
            +DF DKLN+ ++  IL    ++V+ K Y   P+ C++  T + +  + Y ENYCWV  T  +   E+IP+         +N++I YYQWVPFIL ++ ++FYVP ++W+ + Y   G NL+ L   A  A       +   +  + R ++D +      RQG       NL    N C   +H G ++ + YI +K +Y  NV+ Q FL+   LG N    ++G+++L ++    EW QTG+FPRVT C   E++ LG  +++  QC L INM NEKI++FLWFW    GI+T  +   W   + I S+   F++K+L +   H +   +D   +  F   FLR DGVF++RMI  +AG++++++++  LW+
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Gsp_020345 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 201.83 bits (512), Expect = 9.439e-57
Identity = 132/408 (32.35%), Postives = 220/408 (53.92%), Query Frame = 3
Query:  201 GVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDA-DAASHSPPAERKDKIERIVRTIEDML-FQHRDYR---QGKMADIRRNLFKMCNFCVFSKHM-GTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQS--YNRSDK------------------QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKE-NYKHMD 1343
            G +D  D+LN+ ++ +IL +  +V++ K Y   P+ C++    S  + + Y+E+YCW+  T  I   EN+P   +      + K+I YYQWVPFIL  + +MF +P + W+L C  + G N+++L   A DA +    ++R+  +E I     D L  Q  + R   +G +A I+           FS+ + G  + + Y   K +Y +NV+ Q F++   L  +S    FG+ +LS+I  G+ W +TG FPRVT C   E+++L   N+Y  QCAL IN++NEK++ FLW W  I+ IIT  S   W     I S +  ++ KF+ + +S  Y +  K                   L++SF+ +FL+ DG+ ++RMI  +AGD++   +V  LW+ Y+E N++  +
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHT----AREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFE 407          
BLAST of Gsp_020345 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 192.971 bits (489), Expect = 1.827e-53
Identity = 126/401 (31.42%), Postives = 212/401 (52.87%), Query Frame = 3
Query:  201 GVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDA-DAASHSPPAERKDKIERIVRTIEDML-FQHRDYR---QGKMADIRRNLFKMCNFCVFSKHM-GTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQ--------------------LINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKE 1325
            G +D  D+LN+ ++ +IL +  +V++ K Y   P+ C++    S  + + Y+E+YCW+  T  I   EN+P   +      + K+I YYQWVPFIL  + +MF +P + W+L C  + G N+++L   A D  +    ++R+  +E I     D L  Q  + R   +G +A I+           FS+ + G  L + +   K +Y +NV+ Q  ++   L  +S    FG+ +L++I  G+ W +TG FPRVT C   E+++L   N+Y  QCAL IN++NEK++ FLW W  I+ IIT  S   W     I S +  ++ KF+ + +S      Q                    L+++F+ +FL+ DGV ++RMI  +AGD++   +V  LW+ ++E
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHT----AREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRE 416          
BLAST of Gsp_020345 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 190.274 bits (482), Expect = 1.171e-52
Identity = 121/386 (31.35%), Postives = 195/386 (50.52%), Query Frame = 3
Query:  180 FKLTTYVGVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKH 1337
            FK  T+   +D  D+L+++ +  +L    ++V+ K Y    + C++     G  ++ Y E+YC++  T  I     IP    D     Q   I YYQWVP +L +Q  MFY+P  IW  + Y + G +  S+  +A+A        R   + ++V  I D+L        G+    R           F K +G+   + YI +K MY  NV  Q  ++ KFLG  + +  +G+   +++  G+EW  +G+FPRVT C    ++ L   ++Y  QC L INM NEKIY+F+WFW   V I T I+     +R++  S R  +I+  L    +  + +K +I SF    L+ DGV L+R I  +AG +VT +I   L++ + EN +H
Sbjct:   15 FKPKTF---DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGG-WEQYAEDYCFIQNTFFIPERSEIPGDVED----RQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFL--WGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQH 377          
BLAST of Gsp_020345 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 106.686 bits (265), Expect = 8.767e-25
Identity = 82/294 (27.89%), Postives = 137/294 (46.60%), Query Frame = 3
Query:  282 KSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNI---ADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 1130
            + Y   P+ C +   P G      ++ YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Gsp_020345 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 106.686 bits (265), Expect = 8.767e-25
Identity = 82/294 (27.89%), Postives = 137/294 (46.60%), Query Frame = 3
Query:  282 KSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNI---ADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 1130
            + Y   P+ C +   P G      ++ YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Gsp_020345 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 106.686 bits (265), Expect = 8.767e-25
Identity = 82/294 (27.89%), Postives = 137/294 (46.60%), Query Frame = 3
Query:  282 KSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNI---ADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 1130
            + Y   P+ C +   P G      ++ YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Gsp_020345 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 106.686 bits (265), Expect = 8.767e-25
Identity = 82/294 (27.89%), Postives = 137/294 (46.60%), Query Frame = 3
Query:  282 KSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNI---ADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 1130
            + Y   P+ C +   P G      ++ YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Gsp_020345 vs. RefSeq Drosophila melanogaster
Match: gi|17864322|ref|NP_524730.1| (innexin 3, isoform A [Drosophila melanogaster])

HSP 1 Score: 100.908 bits (250), Expect = 9.455e-23
Identity = 89/309 (28.80%), Postives = 139/309 (44.98%), Query Frame = 3
Query:  354 LENYCWVHGTISILPGENIPQTDSDWA------IVDQNKRI-TYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTIL--SNIADGKEWH-QTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQLINSFIREFLRHDGVFLI 1250
            +  +CW+  T +I PG+   Q  +D A         Q KR  +YYQWVPF+L  Q +MFYVP  +W+ +   K+    + L          P   R+D+ +RI++   + L  H  Y                               +Y   + +  INVI  +F++ KFLG   +  S+G  +L  SN+   K +     IFPR+T C   +    G+  K+   C L +N+LNEKIY+FLWFW  I+  I+ +++      I + + R   IK+      SY  + ++ I   +R      G FLI
Sbjct:   71 INTFCWITYTYTI-PGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNMEDGKIRMITDGLR----GMVSVPDDYRRDRQDRILKYFVNSLNTHNGYS-----------------------------FAYFFCELLNFINVIVNIFMVDKFLG--GAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTRETIIKR------SYRSAQRKEIAGLVRRL--EIGDFLI 335          
BLAST of Gsp_020345 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 332/440 (75.45%), Postives = 395/440 (89.77%), Query Frame = 3
Query:  144 MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMDFLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV* 1463
            MVA+EFL+LIGQFK++TYVG+EDFADKL+FLFSV +LI+SMMVVT+KSY FKPLACY AT P GSNF+NYLENYCWVHGTI+ LPGE+IPQ D DWA  D  +RI YYQWVPFILGLQCIMFY+P++IWQ+ICYNK GTNLES+  DA+AA+++PP ERKDKIERI RTIEDMLFQHRDYRQG  A +RR ++  CNFCVFSKHMGTWL+LSYIL+KF+YG+NVIGQLF+MKKFLGFN++ SSFGYT+LSN+  GKEWHQTGIFPRVTYCY+  IKH+G +NKY+ QCALP+NMLNEKIYVFLWFW+ +VGI+TAISIPLWF+R+A LSRRSKFIK+FLMMHQ+Y RSDK +IN+FI EFLRHDGVFL+RM+ INAGDI+TADIVNRL EIYKENYKH+DF N++AY K++D +  L RN+N+S+SD+SIKKE ++NFV*
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV* 440          
BLAST of Gsp_020345 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 279/433 (64.43%), Postives = 343/433 (79.21%), Query Frame = 3
Query:  144 MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMDFLNFSAYPKSMDMTTGLRRNQNISSSDESIKKE 1442
            MVAQEFLSLI QFKL++Y G+EDFAD+LNF+FSVVIL +SM++VT K+YFFKPL+CY+ATTPSG NFD Y+ENYCWVHGTI  L  E IP    DWAI D +KRITYYQWVPFILGLQCI+FY+P+++W++ICYNK+GTNLE+L   A  +S  PP+ERK  +  IVR IED+L+QHRDYRQGKMA  RR +++ CNFCVFSKH+GTWLV +Y  +K +YGINVIGQL+LMK FLGFNSSMSSFGYTIL++I  GK WH+T  FPRV+YCY  +IKHLGA N Y+ QC LP+NMLNEKIY+FLWFWV +VGIIT +SI  W  RI  LS+RS F KK L MHQSY RS+   +N FI+E+LR+DG+FLIRMI IN+GDIV A+I+N LWE YK  Y + DF N++ Y K   + +G    Q+  S D ++K +
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEK---LISG---RQDDKSFDNTLKND 427          
BLAST of Gsp_020345 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 409.453 bits (1051), Expect = 4.346e-137
Identity = 204/439 (46.47%), Postives = 291/439 (66.29%), Query Frame = 3
Query:  144 MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQ--LINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMDFLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDN 1454
            MVA +F+  + +F+++ Y GVEDFADK NFLF+V++L+I   +VT+K Y  KP++CYI+T  SG+N   Y+ENYCWV GTI I     IP T+ +WA +++ K I YYQWVPF+L LQ IMFY+PR+IWQ+ CYN  GT++  L + A+ A HS    R   +  I +TIE ML+QHRD R G++A  RR+L+K+C FC+ SK  GT L+  Y ++KF+Y  N I QL+ MK FLG N +   FG+ I+ NI +G++W  T +FPRV YCY+  +K++G +N  + QC LP+NMLNEKI+ FLW W+F   I+  ISI +W FR ++  RR  FI +FL ++Q     D++  ++  F  +FLR+DGVFL++MI +NAGDIV ADIV +LW+I+K  Y + +FL+  +        T +R + N  S     K   L +
Sbjct:    1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAELNKYK-ILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYANRNFLSDGSDDDENHGRTLIRLDNNNHSKPSFDKSNSLQS 436          
BLAST of Gsp_020345 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 400.208 bits (1027), Expect = 6.382e-134
Identity = 191/406 (47.04%), Postives = 283/406 (69.70%), Query Frame = 3
Query:  144 MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNS-SMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQ--LINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMDFLN 1352
            MVA EFL  + + +++T VG+ED  D+LNF FSV++L++ +++VTVK Y FKP++CY+     GSN  +Y+EN CWV GTI++      P TD +W  ++++K + YYQWVPF+LGLQCIMFYVP+++WQ+ICYN+ GT+++ L + A+ A HS    R   +  + +T+E +L+QHRD+R GK+A  RR +     F + SK +GTWLV SY+L+K  Y  N   QL +M+KFLGF+  ++ +FG  + +NI  G +W  T IFPRV+YC++ ++ HLG  N  + QC LP+NMLNE+IY FLW W+ IV  +T +SIP+W  RI  +  R  FI++FL++ +   +  K+  L+  F  +FLRHDG+FL++MI +NAGDI+T++IV +LW IYK NY + +FLN
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKML-YYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLN 404          
BLAST of Gsp_020345 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 395.971 bits (1016), Expect = 3.013e-132
Identity = 191/428 (44.63%), Postives = 279/428 (65.19%), Query Frame = 3
Query:  144 MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFXXXXXXXXXXXXXXKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHM----DFLNFSAYPKSMDMTTGLRRNQNIS 1415
            MVA EF SLI +       G+ED ADK++ +FSV+IL + + +VT+KSY  KP++CY++  PSG NF +Y+ENYCW+HGTI + P + +      W  +++ ++I YYQWVPFILGLQCIMFY+P++IWQ+ C+N+ GTNL+++   +   +  P +ER+ + E I + IE+ML  HRD+R  K+A+IRR+++  C+  + SK +GT +V SY + K +Y  N IGQLF+++  LGF + + +FG  +   I  G E      FPRV +CY+  I+H+G  N Y+ QC LP+NMLNEKIY FLW W+ +V   T ISIPLW  R+     R  +I  FL M  SY+   K LI+ FI +FLRHDG+FL+RMI  NAGD++ A +VN LW+IY + Y++     D  + S + K  +       +QN++
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLRKDIFSVSNHLKEDEANNSTSNSQNLN 428          
The following BLAST results are available for this feature:
BLAST of Gsp_020345 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gsp_020345 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL3.685e-6833.42RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL5.487e-6334.41RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR9.439e-5732.35RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL1.827e-5331.42RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|12643734|sp|Q19746|INX3_CAEEL1.171e-5231.35RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of Gsp_020345 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|8.767e-2527.89innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|8.767e-2527.89innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|8.767e-2527.89innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|8.767e-2527.89innexin 2, isoform D [Drosophila melanogaster][more]
gi|17864322|ref|NP_524730.1|9.455e-2328.80innexin 3, isoform A [Drosophila melanogaster][more]
back to top
BLAST of Gsp_020345 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008370.000e+075.45Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006570.000e+064.43Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150331264.346e-13746.47SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150364826.382e-13447.04dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150281813.013e-13244.63SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_020345 ID=Gsp_020345|Name=Gsp_020345|organism=Girardia sp.|type=mRNA|length=1594bp
CTGGATTCGTCAATTCACCTGTTGTATAAATAAAGTGTAGTCTTTGAAAC
TGACCTTCGACACATTTTGTCGATATTAATTAAACAAAATACGTTATTCC
ATGATTCCTCGGTTGTAAATCCTAGAAAGTTAAATTATTAAAAATGGTCG
CTCAAGAATTTCTATCGTTAATCGGACAATTCAAATTAACAACTTATGTA
GGAGTAGAAGACTTTGCCGACAAACTCAATTTTCTATTCAGCGTTGTGAT
TTTAATAATCTCAATGATGGTGGTTACTGTAAAATCGTATTTTTTCAAGC
CACTTGCATGTTACATAGCCACAACACCTAGTGGGTCTAATTTTGATAAT
TATTTAGAGAATTATTGCTGGGTTCATGGAACAATATCAATATTACCAGG
AGAAAATATTCCTCAAACTGATTCGGATTGGGCAATTGTCGATCAAAACA
AAAGAATAACATACTATCAATGGGTTCCATTTATTCTCGGTCTCCAATGT
ATAATGTTTTATGTTCCCAGAGTGATTTGGCAGTTAATTTGCTATAATAA
AGTTGGCACTAATCTCGAAAGTCTTGCAATTGATGCTGATGCTGCGAGTC
ACAGTCCTCCTGCCGAAAGAAAAGATAAAATCGAAAGAATTGTCAGAACA
ATTGAAGATATGTTATTCCAACATCGAGATTATCGTCAAGGTAAAATGGC
AGATATTCGTAGAAATTTATTTAAAATGTGCAACTTTTGTGTATTTTCAA
AACATATGGGAACTTGGTTAGTTCTGTCGTACATTTTAATGAAATTTATG
TATGGAATAAATGTTATTGGACAATTATTTCTGATGAAGAAATTTTTGGG
CTTCAATTCTTCCATGTCCTCATTCGGCTACACGATATTAAGCAATATTG
CAGATGGCAAAGAATGGCACCAAACTGGAATATTTCCTCGGGTGACATAC
TGTTATATTGGAGAAATTAAACATCTCGGTGCCAGTAACAAATATATAGG
ACAATGTGCGTTACCAATTAATATGTTGAATGAAAAAATCTACGTTTTCT
TATGGTTCTGGGTATTTATAGTGGGAATAATTACCGCTATAAGTATTCCA
TTGTGGTTTTTTAGAATTGCAATACTTAGTCGGCGAAGCAAATTCATTAA
AAAATTTTTAATGATGCACCAGTCTTATAACAGATCAGATAAACAACTGA
TCAACTCATTTATAAGAGAATTCCTTCGTCACGATGGAGTTTTCTTAATT
CGAATGATTTGTATAAACGCTGGTGATATTGTAACAGCAGACATTGTCAA
TAGATTATGGGAGATTTATAAAGAAAACTATAAACACATGGATTTTTTAA
ATTTCTCGGCATATCCAAAATCAATGGATATGACTACTGGACTTCGACGA
AACCAAAATATTTCTTCATCTGATGAATCGATCAAAAAGGAACATTTGGA
TAATTTTGTTTAACAAGTCATTTTTCATACTTGCTAATTTAATTCTTTGA
TTTTGAGTTAAACAACAAAATTTATATTTTTTTATTACTGACAAAAATTA
TTATCTGATTGTTTTCGCTAAAATCTTTATCTTATTGATTAATA

Design Primers for Gsp_020345

back to top

protein sequence

>Gsp_020345-protein ID=Gsp_020345-protein|Name=Gsp_020345|organism=Girardia sp.|type=polypeptide|length=440bp
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
back to top

coding sequence

>Gsp_020345.144.1463 ID=Gsp_020345.144.1463|Name=Gsp_020345.144.1463|organism=Girardia sp.|type=CDS|length=1320bp
ATGGTCGCTCAAGAATTTCTATCGTTAATCGGACAATTCAAATTAACAAC
TTATGTAGGAGTAGAAGACTTTGCCGACAAACTCAATTTTCTATTCAGCG
TTGTGATTTTAATAATCTCAATGATGGTGGTTACTGTAAAATCGTATTTT
TTCAAGCCACTTGCATGTTACATAGCCACAACACCTAGTGGGTCTAATTT
TGATAATTATTTAGAGAATTATTGCTGGGTTCATGGAACAATATCAATAT
TACCAGGAGAAAATATTCCTCAAACTGATTCGGATTGGGCAATTGTCGAT
CAAAACAAAAGAATAACATACTATCAATGGGTTCCATTTATTCTCGGTCT
CCAATGTATAATGTTTTATGTTCCCAGAGTGATTTGGCAGTTAATTTGCT
ATAATAAAGTTGGCACTAATCTCGAAAGTCTTGCAATTGATGCTGATGCT
GCGAGTCACAGTCCTCCTGCCGAAAGAAAAGATAAAATCGAAAGAATTGT
CAGAACAATTGAAGATATGTTATTCCAACATCGAGATTATCGTCAAGGTA
AAATGGCAGATATTCGTAGAAATTTATTTAAAATGTGCAACTTTTGTGTA
TTTTCAAAACATATGGGAACTTGGTTAGTTCTGTCGTACATTTTAATGAA
ATTTATGTATGGAATAAATGTTATTGGACAATTATTTCTGATGAAGAAAT
TTTTGGGCTTCAATTCTTCCATGTCCTCATTCGGCTACACGATATTAAGC
AATATTGCAGATGGCAAAGAATGGCACCAAACTGGAATATTTCCTCGGGT
GACATACTGTTATATTGGAGAAATTAAACATCTCGGTGCCAGTAACAAAT
ATATAGGACAATGTGCGTTACCAATTAATATGTTGAATGAAAAAATCTAC
GTTTTCTTATGGTTCTGGGTATTTATAGTGGGAATAATTACCGCTATAAG
TATTCCATTGTGGTTTTTTAGAATTGCAATACTTAGTCGGCGAAGCAAAT
TCATTAAAAAATTTTTAATGATGCACCAGTCTTATAACAGATCAGATAAA
CAACTGATCAACTCATTTATAAGAGAATTCCTTCGTCACGATGGAGTTTT
CTTAATTCGAATGATTTGTATAAACGCTGGTGATATTGTAACAGCAGACA
TTGTCAATAGATTATGGGAGATTTATAAAGAAAACTATAAACACATGGAT
TTTTTAAATTTCTCGGCATATCCAAAATCAATGGATATGACTACTGGACT
TCGACGAAACCAAAATATTTCTTCATCTGATGAATCGATCAAAAAGGAAC
ATTTGGATAATTTTGTTTAA
back to top
Gene Groups
Gsp_020345 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.