Gsp_010768, Gsp_010768 (mRNA) Girardia sp.

Overview
NameGsp_010768
Unique NameGsp_010768
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1537
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of Gsp_010768 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 236.884 bits (603), Expect = 9.606e-71
Identity = 125/371 (33.69%), Postives = 217/371 (58.49%), Query Frame = 1
Query:  160 EDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIY 1272
            +D  DK+N+ ++  +I +  ++V+ K Y   P+ C+   T +    ++Y ENYCWV  T  +   + IP + +E E    N++I YYQWVPF+L L+ ++FY P I+W+++ +   G ++++LV  A ++     + R   L  I+  +E+ L+      + ++ S  R      N  + ++  G  +   Y  +K+LY +N++GQ++L+ +FLG  S   ++G  VL +++NG+EW ++G FPRV+ C + +++ LG+ + +  QC L INM NEKI++FLWFW  L+   TL S+F W    V  S++ +F+ K L   + YK  D   + +F+  +LR DGVFL+RM+  +AG++   E+  TLW  Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHNYAERE----NRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHV-----KHQVMSGNRL--KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSK--WYGLQVLNDLMNGREWEESGHFPRVTLC-DFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Gsp_010768 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 234.572 bits (597), Expect = 2.029e-68
Identity = 127/373 (34.05%), Postives = 218/373 (58.45%), Query Frame = 1
Query:  160 EDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDA-NKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKM---HQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWE 1266
            +DF DK+N+ ++  ++    ++V+ K Y   P+ C+   T +    ++Y ENYCWV  T  +   E+IP+     E++   N++I YYQWVPFIL ++ ++FY P I+W+ + Y   G NL+ LV  A +A     + +   +  ++R ++D +      RQG   S    +    N C   +H G ++ + Y  IKVLY  NV+ Q +L+   LG N     +G+++L+++++  EW QTG+FPRV+ C + ++R LG+ + +  QC L INM NEKI++FLWFW L  GI+T+ +   W + M   S+   F++K L++   H +    D + + +F   +LR DGVF++RMI  +AG+++++E++  LW+
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPR-----EIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLC-DFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Gsp_010768 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 211.46 bits (537), Expect = 1.483e-60
Identity = 123/405 (30.37%), Postives = 218/405 (53.83%), Query Frame = 1
Query:  145 SYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPP-KDRKDILNKISRTIEDML----YQHRDYRQGKIASTRRAIYSYCNFCVFSKHL-GTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQS--YKRTDQL------------------LVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEK 1281
            S  G +D  D++N+ ++ +++ +  +V++ K Y   P+ C+     S    ++Y+E+YCW+  T  I   EN+P   +  E     K+I YYQWVPFIL  + +MF  P I W++ C  + G N++ L+N A +A       DR+  +  I+    D L       R   +G IA  +           FS+ L G  + + Y F K+LY +NV+ Q +++ + L  +S   +FG+ VL ++  G+ W +TG FPRV+ C + ++R+L + N Y  QC L IN++NEK++ FLW W +++ IIT  S   W       S++ D++ K +++ +S  YK+  +                   L++ F+ ++L+ DG+ ++RMI  +AGD++  +++  LW+ Y+E+
Sbjct:   16 SVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE----EKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLC-DFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER 401          
BLAST of Gsp_010768 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 204.912 bits (520), Expect = 6.441e-58
Identity = 121/405 (29.88%), Postives = 216/405 (53.33%), Query Frame = 1
Query:  145 SYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQ-PPKDRKDILNKISRTIEDML----YQHRDYRQGKIASTRRAIYSYCNFCVFSKHL-GTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQS--YKRTDQL------------------LVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEK 1281
            S  G +D  D++N+ ++ +++ +  +V++ K Y   P+ C+     S    ++Y+E+YCW+  T  I   EN+P   +  E     K+I YYQWVPFIL  + +MF  P I W++ C  + G N++ L+N A +        DR+  +  I+    D L       R   +G IA  +           FS+ L G  L + + F K+LY +NV+ Q  ++ + L  +S   +FG+ VL ++  G+ W +TG FPRV+ C + ++R+L + N Y  QC L IN++NEK++ FLW W +++ IIT  S   W       S++ D++ K +++ +S  +K+  +                   L++ F+ ++L+ DGV ++RMI  +AGD++  +++  LW+ ++E+
Sbjct:   32 SVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE----EKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLC-DFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER 417          
BLAST of Gsp_010768 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 198.749 bits (504), Expect = 1.371e-55
Identity = 115/391 (29.41%), Postives = 215/391 (54.99%), Query Frame = 1
Query:  118 SLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKM------HQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIY 1272
            + +G  K  S    +D++D++N+L +  +++   ++++ K +  +P+ C       G  +++Y ENYCW   T  + P++++     E E +  +++++YYQWVPF L LQ   F  P  +W+    N  G  +  +V  A++++    + R+  +  + R +   L    +  + K+   +    ++ NF  +S    +W+   Y F KVLY +NV  QLYLM  FLG N    ++G+ V+++++ G+ W ++G FPR + C + ++R + +   Y  QC L IN+ NEKI+V LWFW +++ + + +S+  WFI +VF      F+K+ L +      +Q   R +   V++F+ +YL  DGVF++RM+  +AG I   +++  L+E Y
Sbjct:    6 TFLGMAKYLSPREDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDTYFVEPTQDVSLLKKE-ERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTV--TFLNFQ-YSSGFISWI---YLFTKVLYFLNVFAQLYLMNYFLGTNRH-HWYGFGVVQDIVQGEPWERSGYFPRAAVC-DFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of Gsp_010768 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 108.227 bits (269), Expect = 2.165e-25
Identity = 92/326 (28.22%), Postives = 149/326 (45.71%), Query Frame = 1
Query:  112 FFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPI------LPSENI--PQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEA--SKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE-NMLNGKEW--HQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISI 1050
            F S+ G  K+   V +++   +M++  + +++I   ++VT + Y   P+ C     P GV     M+ YCW++ T  +      +   ++  P   S  E  D  K   YYQWV F+L  Q I+FY P+ +W+    +  G  L+ LV        + +   DRK IL               DY  G +   R   Y++                 +F  + L  +NVIGQ+Y +  FL  +   + +G  VL+   L   E       +FP+V+ C        GS  T+   C LP+N++NEKIYVFLWFW +++ I++ IS+
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL--------------VDYFIGNL--NRHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Gsp_010768 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 108.227 bits (269), Expect = 2.165e-25
Identity = 92/326 (28.22%), Postives = 149/326 (45.71%), Query Frame = 1
Query:  112 FFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPI------LPSENI--PQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEA--SKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE-NMLNGKEW--HQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISI 1050
            F S+ G  K+   V +++   +M++  + +++I   ++VT + Y   P+ C     P GV     M+ YCW++ T  +      +   ++  P   S  E  D  K   YYQWV F+L  Q I+FY P+ +W+    +  G  L+ LV        + +   DRK IL               DY  G +   R   Y++                 +F  + L  +NVIGQ+Y +  FL  +   + +G  VL+   L   E       +FP+V+ C        GS  T+   C LP+N++NEKIYVFLWFW +++ I++ IS+
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL--------------VDYFIGNL--NRHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Gsp_010768 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 108.227 bits (269), Expect = 2.165e-25
Identity = 92/326 (28.22%), Postives = 149/326 (45.71%), Query Frame = 1
Query:  112 FFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPI------LPSENI--PQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEA--SKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE-NMLNGKEW--HQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISI 1050
            F S+ G  K+   V +++   +M++  + +++I   ++VT + Y   P+ C     P GV     M+ YCW++ T  +      +   ++  P   S  E  D  K   YYQWV F+L  Q I+FY P+ +W+    +  G  L+ LV        + +   DRK IL               DY  G +   R   Y++                 +F  + L  +NVIGQ+Y +  FL  +   + +G  VL+   L   E       +FP+V+ C        GS  T+   C LP+N++NEKIYVFLWFW +++ I++ IS+
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL--------------VDYFIGNL--NRHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Gsp_010768 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 108.227 bits (269), Expect = 2.165e-25
Identity = 92/326 (28.22%), Postives = 149/326 (45.71%), Query Frame = 1
Query:  112 FFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPI------LPSENI--PQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEA--SKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE-NMLNGKEW--HQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISI 1050
            F S+ G  K+   V +++   +M++  + +++I   ++VT + Y   P+ C     P GV     M+ YCW++ T  +      +   ++  P   S  E  D  K   YYQWV F+L  Q I+FY P+ +W+    +  G  L+ LV        + +   DRK IL               DY  G +   R   Y++                 +F  + L  +NVIGQ+Y +  FL  +   + +G  VL+   L   E       +FP+V+ C        GS  T+   C LP+N++NEKIYVFLWFW +++ I++ IS+
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL--------------VDYFIGNL--NRHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Gsp_010768 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 95.9005 bits (237), Expect = 2.840e-21
Identity = 79/305 (25.90%), Postives = 130/305 (42.62%), Query Frame = 1
Query:  145 SYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLAC-YTATTPSGVDFDKYMENYCWVHGTIPIL-----------PSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTG---IFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFW 1014
            S+V ++    +++   + +L+I   + VT + Y   P+ C +T   P  V     +  YCW+H T  ++           P   +  S     +    K   YYQWV F L  Q I+FYTP+ +W+     KI   + +L  G    +++          +  + + D L+++  Y                           W    Y+  ++L  INVIGQ++LM  F  F+     FG  V++ M   +E        IFPR++ C        G    + + C LP+N++NEKIY+FLWFW
Sbjct:    3 SHVKIDSPVFRLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDV-----LNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL--TIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAEK---------KQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264          
BLAST of Gsp_010768 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 302/436 (69.27%), Postives = 362/436 (83.03%), Query Frame = 1
Query:   97 MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLDFRXXXXXXXXXXXXXXXPDESCNNTLKNDSPDNFI* 1404
            MVA+EF SLI +FK+SSY G+EDFAD++NF+FS V++ LSM++VT K+YFFKPL+CY ATTPSG++FD YMENYCWVHGTIP L +E IP    +W +WDA+KRITYYQWVPFILGLQ I+FY PK++W+IICYNK+GTNLE L+  A ++SK PP +RK +LN I R IED+LYQHRDYRQGK+A  RR IY YCNFCVFSKHLGTWLV +YFFIK LYGINVIGQLYLMKSFLGFNSS++ FGYT+L ++++GK WH+T  FPRVSYCYNADI+HLG+ NTYV+QCTLP+NMLNEKIY+FLWFW+LLVGIITL+SI  W +R+VFLSKRS F KKLLKMHQSY+R++ L VN FIKEYLR+DG+FL+RMIYIN+GDIV AEIL  LWE YK KYI+ DF   N        S    D+S +NTLKNDS    +*
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDF--TNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL* 434          
BLAST of Gsp_010768 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 278/402 (69.15%), Postives = 338/402 (84.08%), Query Frame = 1
Query:   97 MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLDFR 1302
            MVAEEF +LIG+FK+S+YVG+EDFADK++FLFS  L+ILSMMVVT+KSY FKPLACYTAT P G +F+ Y+ENYCWVHGTI  LP E+IPQ+  +W   D  +RI YYQWVPFILGLQ IMFY PKIIWQIICYNK GTNLE++VN A  A+  PP +RKD + +I+RTIEDML+QHRDYRQG  A  RR +Y+ CNFCVFSKH+GTWL+LSY  IK LYG+NVIGQL++MK FLGFN++ + FGYTVL NM++GKEWHQTGIFPRV+YCY  +I+H+G  N YV+QC LP+NMLNEKIYVFLWFW++LVGI+T ISI LWF RM FLS+RS FIK+ L MHQ+Y+R+D+ ++N FI+E+LRHDGVFLVRM++INAGDI+TA+I+  L EIYKE Y  LDFR
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFR 402          
BLAST of Gsp_010768 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 408.683 bits (1049), Expect = 3.538e-137
Identity = 194/404 (48.02%), Postives = 277/404 (68.56%), Query Frame = 1
Query:   97 MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANK-RITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ--LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLDF 1299
            MVA +F   + +F+VS+Y GVEDFADK NFLF+ +++++   +VT+K Y  KP++CY +T  SG +  +Y+ENYCWV GTIPI     IP +  EW   + NK +I YYQWVPF+L LQ IMFY P++IWQI CYN  GT++ +L+  A +A     + R  ++N I++TIE MLYQHRD R G++A  RR++Y  C FC+ SK  GT L+  YF IK LY  N I QLY MK FLG N +  +FG+ +++N++NG++W  T +FPRV YCY  +++++G+TN  V+QC LP+NMLNEKI+ FLW WI    I+  ISI +W  R     +R  FI + LK++Q  K  D+   +V +F  ++LR+DGVFL++MI +NAGDIV A+I+  LW+I+K +Y + +F
Sbjct:    1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWA--ELNKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCY-VNVKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYANRNF 400          
BLAST of Gsp_010768 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 396.356 bits (1017), Expect = 9.654e-133
Identity = 189/402 (47.01%), Postives = 269/402 (66.92%), Query Frame = 1
Query:   97 MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLDFR 1302
            MVA EFFSLI         G+ED ADKM+ +FS +++ + + +VT+KSY  KP++CY +  PSG +F  Y+ENYCW+HGTIP+ P++ +  +   W+  +  ++I YYQWVPFILGLQ IMFY PK+IWQI C+N+ GTNL+ ++  + + ++ P  +R+     I++ IE+ML  HRD+R  KIA+ RR++YS C+  + SK LGT +V SYF  K+LY  N IGQL++++S LGF + L  FG  +   +++G E      FPRV +CY   IRH+G  N YV+QC LP+NMLNEKIY FLW WILLV   T ISI LW  R+     R  +I   L+M  SY    + L+++FI ++LRHDG+FL+RMI  NAGD++ A ++  LW+IY +KY + + R
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLR 402          
BLAST of Gsp_010768 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 380.563 bits (976), Expect = 7.349e-127
Identity = 176/401 (43.89%), Postives = 269/401 (67.08%), Query Frame = 1
Query:  106 EEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYFFKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWDANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSL--TYFGYTVLENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIYVFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLDFR 1302
            E F S    F+   YVG+ED ADK +FLFS +++++  ++V+ K Y    ++CY     SGVD DKY++NYCWVHGTIP   +E +PQ+  EW + DA+++I YYQWVPF+LGLQ ++FY P++IW+ I YN  G +LE LV  A++AS Q  + RK+ + ++++ +ED+  Q R     K    R+ +   C  C   +  G + +  Y  IK+LY  N I Q+ LM++FL +  S     FG+T+L+++L+GK+W+   +FPRVS+C+ +DI  +   N +++QC LPINMLNEKIY+FLWFW + V  +T+ISI LW  RM F  KR DFIK+ LK+  +Y +  + L++QF++++LRHDG+F++ +I +NAGD++  +I+  LWEIY + Y+ +DFR
Sbjct:    2 ETFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLIC--C--GRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFR 398          
The following BLAST results are available for this feature:
BLAST of Gsp_010768 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gsp_010768 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL9.606e-7133.69RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL2.029e-6834.05RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.483e-6030.37RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL6.441e-5829.88RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|10720052|sp|Q23157|INX11_CAEEL1.371e-5529.41RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
back to top
BLAST of Gsp_010768 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|2.165e-2528.22innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|2.165e-2528.22innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|2.165e-2528.22innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|2.165e-2528.22innexin 2, isoform D [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|2.840e-2125.90shaking B, isoform C [Drosophila melanogaster][more]
back to top
BLAST of Gsp_010768 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150006570.000e+069.27Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150008370.000e+069.15Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150331263.538e-13748.02SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150281819.654e-13347.01SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
SMU150036487.349e-12743.89SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_010768 ID=Gsp_010768|Name=Gsp_010768|organism=Girardia sp.|type=mRNA|length=1537bp
TGTTTATGTTCGAATATTTCAAAAAATCGGAAGTGTGTTTTCATACGATA
TACAATTTAAAACTTCAAAATTAAACATTTATTATAAAACTGGACAATGG
TTGCTGAGGAATTCTTCTCTCTAATTGGTGAATTTAAAGTATCTTCTTAT
GTTGGCGTAGAAGATTTTGCAGATAAAATGAATTTCCTGTTTTCCGGTGT
TCTTATCATTCTATCAATGATGGTTGTTACAGTTAAATCATATTTTTTCA
AACCTTTAGCGTGTTACACTGCGACAACACCATCTGGAGTAGATTTTGAT
AAATATATGGAAAACTATTGCTGGGTTCATGGAACTATTCCAATTCTACC
AAGTGAAAATATTCCACAAAGTACTAGTGAATGGGAAGTATGGGATGCAA
ATAAACGAATTACTTACTATCAATGGGTACCTTTTATTCTTGGTTTGCAG
TTTATCATGTTTTACACTCCAAAAATTATCTGGCAAATTATCTGCTACAA
TAAAATTGGAACAAATTTAGAAAATCTTGTAAATGGTGCAGAGGAAGCAT
CAAAACAGCCACCAAAAGATCGTAAAGATATTTTAAACAAAATTTCCAGA
ACAATAGAAGATATGCTTTATCAACATCGTGATTATCGACAAGGAAAAAT
TGCAAGCACTCGTAGAGCAATTTATAGTTATTGTAATTTTTGTGTTTTTT
CAAAACATTTGGGAACATGGCTAGTACTTTCGTACTTTTTCATAAAGGTT
CTTTATGGAATTAACGTTATTGGCCAACTTTACCTAATGAAGTCCTTTTT
GGGTTTTAACAGTTCTTTAACTTATTTCGGATATACAGTTCTTGAGAATA
TGCTCAATGGTAAAGAGTGGCATCAAACTGGAATATTTCCTCGAGTAAGT
TATTGTTACAATGCTGACATCAGACATCTTGGGTCAACGAACACTTATGT
TTCTCAATGTACCTTACCAATCAACATGTTAAATGAAAAGATCTACGTGT
TTCTCTGGTTTTGGATATTGCTTGTTGGTATTATTACTTTGATCAGTATA
TTTCTTTGGTTCATTAGAATGGTGTTCCTCTCAAAACGAAGTGATTTTAT
AAAGAAACTTCTAAAAATGCATCAGTCATATAAAAGAACCGATCAATTGC
TTGTTAATCAATTTATTAAAGAATATTTGAGACATGATGGAGTGTTTTTG
GTAAGAATGATTTATATAAATGCTGGTGATATTGTTACTGCTGAAATTCT
CGGTACATTATGGGAGATTTATAAGGAGAAATATATTGATTTAGATTTTC
GCAATTTCAATAACTATAAAAAATTGAATAATAATTCTGAAAGCAATCCT
GATGAATCGTGCAATAACACACTGAAAAATGATTCACCTGACAATTTTAT
ATAATAATGTTTTTGAAAACTTCATTTTCTTTAATTCGGTTTCGATAATT
TTGACAAATTTCTTAATAATATTGATAATGTTTCATTAAAATATATTCGA
TATTCCATTTAAAAAAAATGAAGTTTTCAAAAACATT

Design Primers for Gsp_010768

back to top

protein sequence

>Gsp_010768-protein ID=Gsp_010768-protein|Name=Gsp_010768|organism=Girardia sp.|type=polypeptide|length=436bp
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
back to top

coding sequence

>Gsp_010768.97.1404 ID=Gsp_010768.97.1404|Name=Gsp_010768.97.1404|organism=Girardia sp.|type=CDS|length=1308bp
ATGGTTGCTGAGGAATTCTTCTCTCTAATTGGTGAATTTAAAGTATCTTC
TTATGTTGGCGTAGAAGATTTTGCAGATAAAATGAATTTCCTGTTTTCCG
GTGTTCTTATCATTCTATCAATGATGGTTGTTACAGTTAAATCATATTTT
TTCAAACCTTTAGCGTGTTACACTGCGACAACACCATCTGGAGTAGATTT
TGATAAATATATGGAAAACTATTGCTGGGTTCATGGAACTATTCCAATTC
TACCAAGTGAAAATATTCCACAAAGTACTAGTGAATGGGAAGTATGGGAT
GCAAATAAACGAATTACTTACTATCAATGGGTACCTTTTATTCTTGGTTT
GCAGTTTATCATGTTTTACACTCCAAAAATTATCTGGCAAATTATCTGCT
ACAATAAAATTGGAACAAATTTAGAAAATCTTGTAAATGGTGCAGAGGAA
GCATCAAAACAGCCACCAAAAGATCGTAAAGATATTTTAAACAAAATTTC
CAGAACAATAGAAGATATGCTTTATCAACATCGTGATTATCGACAAGGAA
AAATTGCAAGCACTCGTAGAGCAATTTATAGTTATTGTAATTTTTGTGTT
TTTTCAAAACATTTGGGAACATGGCTAGTACTTTCGTACTTTTTCATAAA
GGTTCTTTATGGAATTAACGTTATTGGCCAACTTTACCTAATGAAGTCCT
TTTTGGGTTTTAACAGTTCTTTAACTTATTTCGGATATACAGTTCTTGAG
AATATGCTCAATGGTAAAGAGTGGCATCAAACTGGAATATTTCCTCGAGT
AAGTTATTGTTACAATGCTGACATCAGACATCTTGGGTCAACGAACACTT
ATGTTTCTCAATGTACCTTACCAATCAACATGTTAAATGAAAAGATCTAC
GTGTTTCTCTGGTTTTGGATATTGCTTGTTGGTATTATTACTTTGATCAG
TATATTTCTTTGGTTCATTAGAATGGTGTTCCTCTCAAAACGAAGTGATT
TTATAAAGAAACTTCTAAAAATGCATCAGTCATATAAAAGAACCGATCAA
TTGCTTGTTAATCAATTTATTAAAGAATATTTGAGACATGATGGAGTGTT
TTTGGTAAGAATGATTTATATAAATGCTGGTGATATTGTTACTGCTGAAA
TTCTCGGTACATTATGGGAGATTTATAAGGAGAAATATATTGATTTAGAT
TTTCGCAATTTCAATAACTATAAAAAATTGAATAATAATTCTGAAAGCAA
TCCTGATGAATCGTGCAATAACACACTGAAAAATGATTCACCTGACAATT
TTATATAA
back to top
Gene Groups
Gsp_010768 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.