Gsp_010608, Gsp_010608 (mRNA) Girardia sp.

Overview
NameGsp_010608
Unique NameGsp_010608
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1696
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of Gsp_010608 vs. RefSeq Human
Match: gi|767975980|ref|XP_011537308.1| (PREDICTED: piwi-like protein 1 isoform X1 [Homo sapiens])

HSP 1 Score: 163.696 bits (413), Expect = 4.583e-43
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  934 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  203 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 447          

HSP 2 Score: 163.696 bits (413), Expect = 4.583e-43
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = -1
Query:    2 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 763
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  203 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 447          
BLAST of Gsp_010608 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  934 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          

HSP 2 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = -1
Query:    2 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 763
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          
BLAST of Gsp_010608 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  934 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          

HSP 2 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = -1
Query:    2 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 763
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          
BLAST of Gsp_010608 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  934 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          

HSP 2 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = -1
Query:    2 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 763
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          
BLAST of Gsp_010608 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  934 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          

HSP 2 Score: 162.54 bits (410), Expect = 2.363e-41
Identity = 90/259 (34.75%), Postives = 143/259 (55.21%), Query Frame = -1
Query:    2 TQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 763
            +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G+IR
Sbjct:  583 SQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIR 827          
BLAST of Gsp_010608 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 273/289 (94.46%), Postives = 278/289 (96.19%), Query Frame = 1
Query:  832 APSWHSCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFV-NSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            A S   CAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSFV NSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMG IR
Sbjct:  507 ARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIR 795          

HSP 2 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 273/289 (94.46%), Postives = 278/289 (96.19%), Query Frame = -1
Query:    2 APSWHSCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFV-NSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 865
            A S   CAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSFV NSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMG IR
Sbjct:  507 ARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIR 795          
BLAST of Gsp_010608 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 488.034 bits (1255), Expect = 2.018e-161
Identity = 229/286 (80.07%), Postives = 255/286 (89.16%), Query Frame = 1
Query:  838 SWHSCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            S   CAK+ALVFVPDDR YAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVSSKTVMQIF+KFGYDPWT++IK+RPTMIVG+DT+HNK SKKSI ASVFSINSTF+QYMSF NSPKG+QEFH+TL  NF  AL +FK+ Y ILP RI+VYRDGVGD+QL FTKQFEVDAMKPLVENIYK NG  VPQIIYVIVKKRI TKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+P+NYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMG IR
Sbjct:  495 SGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIR 780          

HSP 2 Score: 488.034 bits (1255), Expect = 2.018e-161
Identity = 229/286 (80.07%), Postives = 255/286 (89.16%), Query Frame = -1
Query:    2 SWHSCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 859
            S   CAK+ALVFVPDDR YAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVSSKTVMQIF+KFGYDPWT++IK+RPTMIVG+DT+HNK SKKSI ASVFSINSTF+QYMSF NSPKG+QEFH+TL  NF  AL +FK+ Y ILP RI+VYRDGVGD+QL FTKQFEVDAMKPLVENIYK NG  VPQIIYVIVKKRI TKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+P+NYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMG IR
Sbjct:  495 SGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIR 780          
BLAST of Gsp_010608 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 396.356 bits (1017), Expect = 2.871e-126
Identity = 184/284 (64.79%), Postives = 236/284 (83.10%), Query Frame = 1
Query:  847 SCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            S   MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMG IR
Sbjct:  489 SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIR 770          

HSP 2 Score: 396.356 bits (1017), Expect = 2.871e-126
Identity = 184/284 (64.79%), Postives = 236/284 (83.10%), Query Frame = -1
Query:    2 SCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGMIR 850
            S   MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMG IR
Sbjct:  489 SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIR 770          
BLAST of Gsp_010608 vs. uniprot
Match: gi|519883174|sp|Q7PLK0|AGO3_DROME (RecName: Full=Protein argonaute-3)

HSP 1 Score: 175.252 bits (443), Expect = 2.818e-45
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  880 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          

HSP 2 Score: 175.252 bits (443), Expect = 2.818e-45
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = -1
Query:    2 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 817
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          
BLAST of Gsp_010608 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 171.785 bits (434), Expect = 4.372e-44
Identity = 101/288 (35.07%), Postives = 162/288 (56.25%), Query Frame = 1
Query:  856 KMALVFVPDDRA--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+VYRDGVGD  L     +EV  +   ++ + ++     P++  V+VKKRI+++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   P++YNV+ D   L          P+ +Q++TY L H+Y+NW G++R
Sbjct:  551 QMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE---PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLK---------PDHMQRLTYKLCHMYYNWQGIVR 824          

HSP 2 Score: 171.785 bits (434), Expect = 4.372e-44
Identity = 101/288 (35.07%), Postives = 162/288 (56.25%), Query Frame = -1
Query:    2 KMALVFVPDDRA--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 841
            +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+VYRDGVGD  L     +EV  +   ++ + ++     P++  V+VKKRI+++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   P++YNV+ D   L          P+ +Q++TY L H+Y+NW G++R
Sbjct:  551 QMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE---PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGLK---------PDHMQRLTYKLCHMYYNWQGIVR 824          
BLAST of Gsp_010608 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 175.252 bits (443), Expect = 3.253e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  880 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          

HSP 2 Score: 175.252 bits (443), Expect = 3.253e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = -1
Query:    2 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 817
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          
BLAST of Gsp_010608 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 175.252 bits (443), Expect = 3.253e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  880 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          

HSP 2 Score: 175.252 bits (443), Expect = 3.253e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = -1
Query:    2 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 817
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          
BLAST of Gsp_010608 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 175.252 bits (443), Expect = 3.253e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  880 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          

HSP 2 Score: 175.252 bits (443), Expect = 3.253e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = -1
Query:    2 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 817
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          
BLAST of Gsp_010608 vs. RefSeq Drosophila melanogaster
Match: gi|281366635|ref|NP_001163498.1| (argonaute 3, isoform G [Drosophila melanogaster])

HSP 1 Score: 174.866 bits (442), Expect = 4.290e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  880 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          

HSP 2 Score: 174.866 bits (442), Expect = 4.290e-46
Identity = 104/278 (37.41%), Postives = 157/278 (56.47%), Query Frame = -1
Query:    2 DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 817
            DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW G +R
Sbjct:  576 DDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVR 833          
BLAST of Gsp_010608 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 158.688 bits (400), Expect = 9.375e-41
Identity = 102/285 (35.79%), Postives = 157/285 (55.09%), Query Frame = 1
Query:  859 MALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPV-PQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S  +K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N   AL  +++++  LP+RIL +RDGVGD QL+     EV+ +K  ++ IYK+ G     ++ ++IV KRI ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +P++YNV+ D   L           ++LQ ++Y +TH+Y+N+ G IR
Sbjct:  486 MVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLN---------ADKLQMLSYKMTHMYYNYSGTIR 761          

HSP 2 Score: 158.688 bits (400), Expect = 9.375e-41
Identity = 102/285 (35.79%), Postives = 157/285 (55.09%), Query Frame = -1
Query:    2 MALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPV-PQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 838
            M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S  +K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N   AL  +++++  LP+RIL +RDGVGD QL+     EV+ +K  ++ IYK+ G     ++ ++IV KRI ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +P++YNV+ D   L           ++LQ ++Y +TH+Y+N+ G IR
Sbjct:  486 MVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLN---------ADKLQMLSYKMTHMYYNYSGTIR 761          
BLAST of Gsp_010608 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 273/288 (94.79%), Postives = 278/288 (96.53%), Query Frame = 1
Query:  832 APSWHSCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            A S   CAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMG IR
Sbjct:  511 ARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIR 798          

HSP 2 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 273/288 (94.79%), Postives = 278/288 (96.53%), Query Frame = -1
Query:    2 APSWHSCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 865
            A S   CAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMG IR
Sbjct:  511 ARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIR 798          
BLAST of Gsp_010608 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 396.741 bits (1018), Expect = 5.498e-127
Identity = 184/284 (64.79%), Postives = 236/284 (83.10%), Query Frame = 1
Query:  847 SCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            S   MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMG IR
Sbjct:  532 SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIR 813          

HSP 2 Score: 396.741 bits (1018), Expect = 5.498e-127
Identity = 184/284 (64.79%), Postives = 236/284 (83.10%), Query Frame = -1
Query:    2 SCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGMIR 850
            S   MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMG IR
Sbjct:  532 SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIR 813          
BLAST of Gsp_010608 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 147.132 bits (370), Expect = 5.622e-37
Identity = 96/289 (33.22%), Postives = 155/289 (53.63%), Query Frame = 1
Query:  865 LVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENI---YKNNGFPVPQIIYVIVKKRITTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 1695
            L  V +DR Y  +K F  +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VGLD +H+ K   +S+ A V S N+  T++ S  +  +  +E    L       L+ + +  + LP+ I +YRDGV D QL + ++ E++    + E+    YK      P ++Y +V+KRI T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TP++Y VL D    T         P+++Q + Y   H+Y+NW G +R
Sbjct:  670 LSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVR 940          

HSP 2 Score: 147.132 bits (370), Expect = 5.622e-37
Identity = 96/289 (33.22%), Postives = 155/289 (53.63%), Query Frame = -1
Query:    2 LVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENI---YKNNGFPVPQIIYVIVKKRITTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGMIR 832
            L  V +DR Y  +K F  +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VGLD +H+ K   +S+ A V S N+  T++ S  +  +  +E    L       L+ + +  + LP+ I +YRDGV D QL + ++ E++    + E+    YK      P ++Y +V+KRI T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TP++Y VL D    T         P+++Q + Y   H+Y+NW G +R
Sbjct:  670 LSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVR 940          
BLAST of Gsp_010608 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 95.9005 bits (237), Expect = 1.722e-20
Identity = 85/279 (30.47%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  892 YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPT------MIVGLDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVL-EDTRLLTKKGTMDPMAPNELQKITYALTHLY 1671
            YA+VK    +  GL TQCV  +N     +K      S   ++I  K G     +   +RP       + +G D  H      +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ YRDGV + Q       E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ PS+Y+VL +D R           + +E+Q +TY L H Y
Sbjct:  598 YAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRF----------SADEIQTLTYQLCHTY 859          

HSP 2 Score: 95.9005 bits (237), Expect = 1.722e-20
Identity = 85/279 (30.47%), Postives = 126/279 (45.16%), Query Frame = -1
Query:   26 YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPT------MIVGLDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVL-EDTRLLTKKGTMDPMAPNELQKITYALTHLY 805
            YA+VK    +  GL TQCV  +N     +K      S   ++I  K G     +   +RP       + +G D  H      +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ YRDGV + Q       E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ PS+Y+VL +D R           + +E+Q +TY L H Y
Sbjct:  598 YAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRF----------SADEIQTLTYQLCHTY 859          
BLAST of Gsp_010608 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 94.7449 bits (234), Expect = 4.052e-20
Identity = 82/297 (27.61%), Postives = 138/297 (46.46%), Query Frame = 1
Query:  865 LVFVP-DDRAYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGLDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNSPKGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLY 1671
            LVFV  +D  Y +VK F  +  G++TQC+  +  T    K         ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + +     ++E        E     +NL +  +K    + P+R++ YRDGV + Q     + E+ A++   + + K+     P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P++Y+VL D          +    +ELQ  TY L H+Y
Sbjct:  668 LVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIY 950          

HSP 2 Score: 94.7449 bits (234), Expect = 4.052e-20
Identity = 82/297 (27.61%), Postives = 138/297 (46.46%), Query Frame = -1
Query:   26 LVFVP-DDRAYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGLDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNSPKGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLY 832
            LVFV  +D  Y +VK F  +  G++TQC+  +  T    K         ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + +     ++E        E     +NL +  +K    + P+R++ YRDGV + Q     + E+ A++   + + K+     P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P++Y+VL D          +    +ELQ  TY L H+Y
Sbjct:  668 LVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIY 950          
The following BLAST results are available for this feature:
BLAST of Gsp_010608 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767975980|ref|XP_011537308.1|4.583e-4334.75PREDICTED: piwi-like protein 1 isoform X1 [Homo sa... [more]
gi|66346725|ref|NP_004755.2|2.363e-4134.75piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|2.363e-4134.75PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|2.363e-4134.75PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|2.363e-4134.75PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Gsp_010608 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+094.46RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA2.018e-16180.07RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD2.871e-12664.79RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|519883174|sp|Q7PLK0|AGO3_DROME2.818e-4537.41RecName: Full=Protein argonaute-3[more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE4.372e-4435.07RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Gsp_010608 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221513719|ref|NP_001036627.2|3.253e-4637.41argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|3.253e-4637.41argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|3.253e-4637.41argonaute 3, isoform F [Drosophila melanogaster][more]
gi|281366635|ref|NP_001163498.1|4.290e-4637.41argonaute 3, isoform G [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|9.375e-4135.79aubergine, isoform C [Drosophila melanogaster][more]
back to top
BLAST of Gsp_010608 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+094.79SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261775.498e-12764.79SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001115.622e-3733.22Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389361.722e-2030.47dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329884.052e-2027.61SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_010608 ID=Gsp_010608|Name=Gsp_010608|organism=Girardia sp.|type=mRNA|length=1696bp
CGCGGATCATCCCCATCCAATTGAAATATAAATGTGTCAACGCATAAGTA
ATCTTCTGCAACTCGTTCGGTGCCATCGGATCCATCGTTCCCTTCTTCGT
GAGCAGGCGAGTGTCCTCGAGCACGTTGTAATTGGAAGGTGTGGCAGTTC
CTTTCGTTGTTCTCTGTGACACAAGGAAGAACTCGTAGAAATTCGGTTTC
ACAATCTCCTTGTCGACCACGGTTCCCGGGTTCGGGTTGTTGCCACGGTT
GAAGAGCTTCGTCGTGATGCGCTTCTTGACGATCACGTAAATGATCTGCG
GCACTGGGAACCCGTTGTTCTTGTAGATGTTCTCCACGAGCGGTTTCATC
GCGTCCACCTCGAACTGCTTGGTGAACCAGAGCTGGTTGTCGCCCACGCC
GTCGCGGTACACGAGGATTCTCTGCGGCAGGATGTCGTAGCGCTTCTTGA
AGTCCTCGAGCGCCAGGTTGAAGTTCTTGCCGAGCGTCTCGTGGAACTCC
TGGCGGCCCTTGGGCGAGTTCACGAAGCTCATGTACTGGGTGAACGTGCT
GTTGATGGAGAACACGGACGCCTGGATCGACTTCTTACTCGACTTGTTGT
GGTACGTGTCTAGACCCACGATCATAGTCGGGCGCAGTTTGATCTCCACC
GTCCACGGGTCGTATCCGAATTTGGCGAAGATTTGCATGACGGTCTTGCT
CGACACGACCTTTCGTCTCTTATCGTTTCTGTTCGTGCCATTCCTTGTGG
TGACGCACTGCGTGAGCAGACCAGTGCTCATCGTGAACGACTTTACCTTC
GCGTACGCTCGGTCATCCGGAACGAAAACGAGCGCCATCTTGGCACAGCT
GTGCCAAGATGGCGCTCGTTTTCGTTCCGGATGACCGAGCGTACGCGAAG
GTAAAGTCGTTCACGATGAGCACTGGTCTGCTCACGCAGTGCGTCACCAC
AAGGAATGGCACGAACAGAAACGATAAGAGACGAAAGGTCGTGTCGAGCA
AGACCGTCATGCAAATCTTCGCCAAATTCGGATACGACCCGTGGACGGTG
GAGATCAAACTGCGCCCGACTATGATCGTGGGTCTAGACACGTACCACAA
CAAGTCGAGTAAGAAGTCGATCCAGGCGTCCGTGTTCTCCATCAACAGCA
CGTTCACCCAGTACATGAGCTTCGTGAACTCGCCCAAGGGCCGCCAGGAG
TTCCACGAGACGCTCGGCAAGAACTTCAACCTGGCGCTCGAGGACTTCAA
GAAGCGCTACGACATCCTGCCGCAGAGAATCCTCGTGTACCGCGACGGCG
TGGGCGACAACCAGCTCTGGTTCACCAAGCAGTTCGAGGTGGACGCGATG
AAACCGCTCGTGGAGAACATCTACAAGAACAACGGGTTCCCAGTGCCGCA
GATCATTTACGTGATCGTCAAGAAGCGCATCACGACGAAGCTCTTCAACC
GTGGCAACAACCCGAACCCGGGAACCGTGGTCGACAAGGAGATTGTGAAA
CCGAATTTCTACGAGTTCTTCCTTGTGTCACAGAGAACAACGAAAGGAAC
TGCCACACCTTCCAATTACAACGTGCTCGAGGACACTCGCCTGCTCACGA
AGAAGGGAACGATGGATCCGATGGCACCGAACGAGTTGCAGAAGATTACT
TATGCGTTGACACATTTATATTTCAATTGGATGGGGATGATCCGCG

Design Primers for Gsp_010608

back to top

protein sequence

>Gsp_010608-protein ID=Gsp_010608-protein|Name=Gsp_010608|organism=Girardia sp.|type=polypeptide|length=279bp
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
back to top

coding sequence

>Gsp_010608.859.1695 ID=Gsp_010608.859.1695|Name=Gsp_010608.859.1695|organism=Girardia sp.|type=CDS|length=837bp
ATGGCGCTCGTTTTCGTTCCGGATGACCGAGCGTACGCGAAGGTAAAGTC
GTTCACGATGAGCACTGGTCTGCTCACGCAGTGCGTCACCACAAGGAATG
GCACGAACAGAAACGATAAGAGACGAAAGGTCGTGTCGAGCAAGACCGTC
ATGCAAATCTTCGCCAAATTCGGATACGACCCGTGGACGGTGGAGATCAA
ACTGCGCCCGACTATGATCGTGGGTCTAGACACGTACCACAACAAGTCGA
GTAAGAAGTCGATCCAGGCGTCCGTGTTCTCCATCAACAGCACGTTCACC
CAGTACATGAGCTTCGTGAACTCGCCCAAGGGCCGCCAGGAGTTCCACGA
GACGCTCGGCAAGAACTTCAACCTGGCGCTCGAGGACTTCAAGAAGCGCT
ACGACATCCTGCCGCAGAGAATCCTCGTGTACCGCGACGGCGTGGGCGAC
AACCAGCTCTGGTTCACCAAGCAGTTCGAGGTGGACGCGATGAAACCGCT
CGTGGAGAACATCTACAAGAACAACGGGTTCCCAGTGCCGCAGATCATTT
ACGTGATCGTCAAGAAGCGCATCACGACGAAGCTCTTCAACCGTGGCAAC
AACCCGAACCCGGGAACCGTGGTCGACAAGGAGATTGTGAAACCGAATTT
CTACGAGTTCTTCCTTGTGTCACAGAGAACAACGAAAGGAACTGCCACAC
CTTCCAATTACAACGTGCTCGAGGACACTCGCCTGCTCACGAAGAAGGGA
ACGATGGATCCGATGGCACCGAACGAGTTGCAGAAGATTACTTATGCGTT
GACACATTTATATTTCAATTGGATGGGGATGATCCGC
back to top
Gene Groups
Gsp_010608 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.