Gsp_005528, Gsp_005528 (mRNA) Girardia sp.

Overview
NameGsp_005528
Unique NameGsp_005528
TypemRNA
OrganismGirardia sp. (Girardia sp.)
Sequence length1558
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Girardia sp. Transcriptome2016-03-03
Girardia Sp Translation2016-04-28
Girardia Sp. BLASTX Human2016-03-08
Girardia Sp. BLASTX Swissprot Uniprot2016-03-08
Girardia Sp. BLASTX Drosophila melanogaster2016-03-09
Girardia Sp. BLASTX Schmidtea mediterranea2016-03-09
Girardia Sp CDS2016-05-06
Homology
BLAST of Gsp_005528 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 217.238 bits (552), Expect = 3.083e-63
Identity = 133/391 (34.02%), Postives = 213/391 (54.48%), Query Frame = 2
Query:  131 MESLLTQF-SAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLED-LFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIY 1297
            M  LL  F SA K  ++   +D  DK ++ ++ AI+ V +I++S KQYV   I C++P   +    E++  NYCWV  T     ++ +P    E       ++I YYQWVPFVL L+ +LFY+P ++W  + +  SG H++ +V  A  +     +SR   ++ IA ++E+ L ++ +V+   +  +L    +L+ C R +G  +  LY  +KILY +N  GQI L+  FL       +  +G  +L D+++G++W E+  FPR T C      L  V  H V QC L INM NEKI++FLWFW   +   T+ S+  W++     S++  FV K+L     Y  V  + L   FV  FLR DG+F+L +++ +AG+L   ++   LW  Y
Sbjct:    1 MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTV-QCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSL-RRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Gsp_005528 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 210.305 bits (534), Expect = 3.092e-59
Identity = 119/387 (30.75%), Postives = 209/387 (54.01%), Query Frame = 2
Query:  155 SAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRV--LGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYS--KVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTK 1303
            SAF+       +D  DK ++ ++  IL   ++++S KQYV   I C++P   + +  E++  NYCWV  T      E +P+     + +   ++I YYQWVPF+L ++ +LFY+P ++W  ++Y  SG +L+G+V  A  A     + +   +  +A+ ++D      +   GH +      ++    CGR  G ++  LY  IK+LY  N   Q  L+ +   LG+  L  A+G+++L+D++   +W +  +FPR T C      L  +  H V QC L INM NEKI++FLWFW +   I+T+ +   W+  M   S+   FV+K+L++   +    +     +  F   FLR DG+F+L +IS +AG+L++++++  LW+ +  
Sbjct:  128 SAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLG-ANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHL--LGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTV-QCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 503          
BLAST of Gsp_005528 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 197.978 bits (502), Expect = 1.350e-55
Identity = 119/374 (31.82%), Postives = 196/374 (52.41%), Query Frame = 2
Query:  188 EDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGT--IPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAF--GWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKN--HFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWE 1291
            +D  D+ S++ +  +L   SI++S KQYV + I C++P+   G  +E++  +YC++  T  IP RS   +P   E+   AE    I YYQWVP VL +Q  +FYLP  IWS++ Y   G     ++  A+   +Q  ++R + +  +   + D+   R    + +F   R        G+  G     LY  IK++YL N F Q +++  FL       N  F  G+    D+ +G++W ++ +FPR T C   D S+  + N   +  QC L INM NEKIY+F+WFW V VLI T I+    ++R++F S R  +++  L    +  K   K +I+ F    L+ DG+ ++  I  +AG ++  +I  EL++
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGG-WEQYAEDYCFIQNTFFIPERSE--IPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG------NETFLWGFHTFADLYAGREWQDSGVFPRVTLC---DFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFK-DEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFK 369          
BLAST of Gsp_005528 vs. uniprot
Match: gi|44889063|sp|Q23027|INX5_CAEEL (RecName: Full=Innexin-5; AltName: Full=Protein opu-5 [Caenorhabditis elegans])

HSP 1 Score: 187.578 bits (475), Expect = 1.640e-51
Identity = 121/399 (30.33%), Postives = 211/399 (52.88%), Query Frame = 2
Query:  164 KVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGT--IP--FRSNETLPQTK-EEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYN--LSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKE--LISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSKN 1333
            K ++     D AD+ S+ ++  +L   +I+++  QYV   I C++P   + + +EK+   YC++ GT  +P  F S   +  T  ++ +TA  T ++ YYQW+P VL LQ  LFYLP +IW T   +  L    L  +  +++K  + + D      ++ A      F ++    ++  PV ++  S+V  G+    FL +LY L+KILYL N   Q  ++  FL    TK +  +GW   QD+++G++W    +FPR T C    + L +V +H + QC + INML EK+Y+F WFW + V +LT+ S+  W       S  + F+  +L+    +   + +   + ++FV + L  DG+FI  ++  N+GDL  + ++ E++ +Y     EK   K+
Sbjct:   11 KFQRSAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRT-WEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTA--TPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDD-----QVKATKFGRYFFKKLNFRNES-PVFKETGSVVASGK----FLPALYLLVKILYLANIVLQFWILTYFLE---TK-SWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTSVHDHSI-QCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYRAREAEKAHKKD 391          
BLAST of Gsp_005528 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 187.578 bits (475), Expect = 2.143e-51
Identity = 122/392 (31.12%), Postives = 203/392 (51.79%), Query Frame = 2
Query:  188 EDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT--KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKC-----SYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSKNMVS 1342
            +D +D+ ++L +  IL+  S++IS KQ+    I C  P    GS +E++  NYCW   T      + +   K+E     YT  ++++YYQWVPF L LQ   F  P  +W     N SG  +  +V  A+ + N   + R++NI ++ + L      +  +  KK  V  + ++ +     +G F+  +Y   K+LY +N F Q+ LM  FL  GT + +  +G+ ++QDI+ G+ W  +  FPR   C   ++  VA    +  QC L IN+ NEKI++ LWFW V +L+ + +S+  W   + F    + FVK+ L +         +  +    +S FV ++L  DG+F+L ++S +AG + ATD+V  L+E Y      KD   + VS
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGS-WEQYAENYCWSQDTYFVEPTQDVSLLKKE---ERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQV-HKTVTFLNFQYSSG-FISWIYLFTKVLYFLNVFAQLYLMNYFL--GTNR-HHWYGFGVVQDIVQGEPWERSGYFPRAAVCDF-EVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVS 400          
BLAST of Gsp_005528 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 90.5077 bits (223), Expect = 2.033e-19
Identity = 91/386 (23.58%), Postives = 167/386 (43.26%), Query Frame = 2
Query:  179 VGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGT--IPFR------SNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKA--TNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENL-----LFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISH--FVGRFLRHDGIFILHIISLNAGDLIATDIVTEL 1285
            V I++   +  +  +V IL+  S++++++QY+   I C +  +  G      +  YCW++ T  +P R       +   P         +  K   YYQWV FVL  Q ILFY+PR +W +      G  L+ +V+        ++  + RK       K L D F+    L    F   R                   +F+ + L  +N  GQI  +  FL        + +G  +L+   +  +  E +     +FP+ T C                 C LP+N++NEKIY+FLWFW + + I++ IS+   ++R+   +   K     L+ +   ++ +  EL+++   +G +      F+L+ +  N   LI  +++++L
Sbjct:   17 VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFL----DGEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAG-PKLRHLLLRARSRLAESEEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Gsp_005528 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 90.5077 bits (223), Expect = 2.033e-19
Identity = 91/386 (23.58%), Postives = 167/386 (43.26%), Query Frame = 2
Query:  179 VGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGT--IPFR------SNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKA--TNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENL-----LFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISH--FVGRFLRHDGIFILHIISLNAGDLIATDIVTEL 1285
            V I++   +  +  +V IL+  S++++++QY+   I C +  +  G      +  YCW++ T  +P R       +   P         +  K   YYQWV FVL  Q ILFY+PR +W +      G  L+ +V+        ++  + RK       K L D F+    L    F   R                   +F+ + L  +N  GQI  +  FL        + +G  +L+   +  +  E +     +FP+ T C                 C LP+N++NEKIY+FLWFW + + I++ IS+   ++R+   +   K     L+ +   ++ +  EL+++   +G +      F+L+ +  N   LI  +++++L
Sbjct:   17 VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFL----DGEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAG-PKLRHLLLRARSRLAESEEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Gsp_005528 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 90.5077 bits (223), Expect = 2.033e-19
Identity = 91/386 (23.58%), Postives = 167/386 (43.26%), Query Frame = 2
Query:  179 VGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGT--IPFR------SNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKA--TNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENL-----LFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISH--FVGRFLRHDGIFILHIISLNAGDLIATDIVTEL 1285
            V I++   +  +  +V IL+  S++++++QY+   I C +  +  G      +  YCW++ T  +P R       +   P         +  K   YYQWV FVL  Q ILFY+PR +W +      G  L+ +V+        ++  + RK       K L D F+    L    F   R                   +F+ + L  +N  GQI  +  FL        + +G  +L+   +  +  E +     +FP+ T C                 C LP+N++NEKIY+FLWFW + + I++ IS+   ++R+   +   K     L+ +   ++ +  EL+++   +G +      F+L+ +  N   LI  +++++L
Sbjct:   17 VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFL----DGEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAG-PKLRHLLLRARSRLAESEEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Gsp_005528 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 90.5077 bits (223), Expect = 2.033e-19
Identity = 91/386 (23.58%), Postives = 167/386 (43.26%), Query Frame = 2
Query:  179 VGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGT--IPFR------SNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKA--TNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENL-----LFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISH--FVGRFLRHDGIFILHIISLNAGDLIATDIVTEL 1285
            V I++   +  +  +V IL+  S++++++QY+   I C +  +  G      +  YCW++ T  +P R       +   P         +  K   YYQWV FVL  Q ILFY+PR +W +      G  L+ +V+        ++  + RK       K L D F+    L    F   R                   +F+ + L  +N  GQI  +  FL        + +G  +L+   +  +  E +     +FP+ T C                 C LP+N++NEKIY+FLWFW + + I++ IS+   ++R+   +   K     L+ +   ++ +  EL+++   +G +      F+L+ +  N   LI  +++++L
Sbjct:   17 VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFL----DGEFSTYGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAG-PKLRHLLLRARSRLAESEEVELVANKCNIGDW------FLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Gsp_005528 vs. RefSeq Drosophila melanogaster
Match: gi|17864458|ref|NP_524824.1| (optic ganglion reduced, isoform A [Drosophila melanogaster])

HSP 1 Score: 87.8113 bits (216), Expect = 1.485e-18
Identity = 74/282 (26.24%), Postives = 116/282 (41.13%), Query Frame = 2
Query:  218 FSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTI----PFRSNE----TLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENL-LFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFW 1036
            F+  +L+ CS+II+  QYV   ISC    +++G      +  +CW+H T      FR         P    ++   +  K   YYQWV FVL  Q +  Y P+ +W         N  EG ++        +    +E  E    +L D +L + V  HK + +       +CC             +I  +YL+N F        FL  GT  +        L D+   ++    + +FPR T C               + C LP+N++NEK Y+F+WFW
Sbjct:   30 FTTVLLLTCSLIITATQYVGQPISC----IVNGVP-PHVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLW---------NKFEGGLMRMIVMGLNITICTREEKEAKRDALLD-YLIKHVKRHKLYAIRYWACEFLCCIN-----------IIVQMYLMNRF----FDGEFLSYGTNIMK-------LSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Gsp_005528 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 312/416 (75.00%), Postives = 366/416 (87.98%), Query Frame = 2
Query:  131 MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSKNMVSIADEKTKQTFV* 1378
            ME+ L+QF+AF+  KYVGIED ADKASFLFSV ILVVCS+I+STKQY+  DISCYIPVV+SG D +K+++NYCWVHGTIPF +NETLPQTK+EW+ A+ ++KINYYQWVPFVLGLQG+LFYLPRLIW TI+YNLSGN LEG+VVSA+KA+NQVG+ RKE I  +AK LEDLFLQRRVLGH KFPVLRQKMSL+CCGRRTG+F +SLY +IK+LYL NA  QI+LMQNFL+ G +KLNAAFGWTIL+DI+SGKQW +NLLFPR +FCF+ DIS V  KNH +AQC LPINMLNEKIYIFLWFWTVGVL LTIISIP+WL+RMTFF KR+ F+K+FLKIK +Y+K K K LIS FV +FLRHDGIFILHIISLNAGDLIATDIV+ELWEIY KYY++ DF K  +S ++EK+KQTFV*
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV* 415          
BLAST of Gsp_005528 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 304/416 (73.08%), Postives = 362/416 (87.02%), Query Frame = 2
Query:  131 MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSKNMVSIADEKTKQTFV* 1378
            MESL+ +FS F VEKYVG+EDGADKASFLFSV ILVVC++I+STKQY+  +I+CYIP++ +G   E +I+NYCW HGTIPFR NETLPQ +++WM A++ +++NYYQWVPFVLGLQG+LFYLPRLIW TI+YNLSGN LEG+VVSA+KA+NQVG+ RKE I  +AK LEDLFLQRRVLGH KFPVLRQKMSL+CCGRRTG+F +SLY +IK+LYL NA  QI+LMQNFL+ G +KLNAAFGWTIL+DI+SGKQW +NLLFPR +FCF+ DIS V  KNH +AQC LPINMLNEKIYIFLWFWTVGVL LTIISIP+WL+RMTFF KR+ F+K+FLKIK +Y+K K K LIS FV +FLRHDGIFILHIISLNAGDLIATDIV+ELWEIY KYY++ DF K  +S ++EK+KQTFV*
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV* 415          
BLAST of Gsp_005528 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 396.356 bits (1017), Expect = 1.507e-132
Identity = 189/401 (47.13%), Postives = 264/401 (65.84%), Query Frame = 2
Query:  134 ESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVC--C--GRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDF 1324
            E  L     FK+  YVGIED ADK SFLFSV +L++  ++++ K Y+   ++CY      GS+FE ++ NYCWVHGTI F   E +PQ   +W  A+ T++INYYQWVPF+LGLQ I+FY+P++IW  I YN SG +LE IV  A  A N     RK+ IE IA+++ED+  Q R      F  LR+K+   C  C   +  G +L+  Y LIK LY +N  GQ+ +M+ FL    T   ++FG+T+L ++ISGK+W +  +FPR T+C+V +I  V V N +VAQC LP+NMLNEKIY+FLWFW V V I+T ISIP+W +RM F S+R KF+K+FL +  +Y +   K +I++F+  FLRHDG+F++ ++ +NAGD+I  DIV  L EIY + Y   DF
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNT--TSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYER-SDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDF 401          
BLAST of Gsp_005528 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 384.415 bits (986), Expect = 3.424e-128
Identity = 196/403 (48.64%), Postives = 274/403 (67.99%), Query Frame = 2
Query:  155 SAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQ---KMSLVCCGRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSKNMVSIADE 1354
            + +K   +VG+ED ADK SF  S +IL++ +++I+ K Y+ T I+CYIP+  SG DF+ F+++YCWVHGTIP + N  LP   E W   +   +INYYQWVPFVL LQGILFYLPR+IW  I YNLSG  LEG+V  A  A+NQ G ++ E ++ IA +LE+L    R +     P++ +     S +C  +R+G  L + Y  IK+LY+INAFGQ+ LMQ FL  G      +FG+ +L++I+ G++W + ++FPR T+C++ +I  VA+KN+++AQC LPINMLNEKIYIFLWFWTV V+  T IS+  W++R+T  S +  F+KKFL+I+  Y+      L S F G FLR DG+FIL + S+NAGDLI  DIVT LW IY + + E++FSK+ V   DE
Sbjct:   11 TKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHK--GTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRG-FLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVP-GDE 407          
BLAST of Gsp_005528 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 363.999 bits (933), Expect = 3.974e-120
Identity = 176/403 (43.67%), Postives = 256/403 (63.52%), Query Frame = 2
Query:  134 ESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVATDISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYTKKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKATNQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVC--C--GRRTGIFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIISGKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELISHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK 1330
            +  L+    FK+  Y G+ED AD+ +F+FSV IL +  +I++ K Y    +SCY+    SG +F+ ++ NYCWVHGTIPF  NE +P   E+W   +  K+I YYQWVPF+LGLQ ILFY+P+L+W  I YN  G +LE ++ +A  ++      RK  +  I + +EDL  Q R     K    R+++   C  C   +  G +LVS YF IK LY IN  GQ+ LM++FL   ++   ++FG+TIL DIISGK W E   FPR ++C+  DI  +   N +VAQCTLP+NMLNEKIYIFLWFW + V I+T++SI  W+ R+ F SKR  F KK LK+  SY + ++   ++HF+  +LR+DG+F++ +I +N+GD++A +I+  LWE Y   Y+  DF+ 
Sbjct:    4 QEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSM--SSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLT-VNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTN 403          
The following BLAST results are available for this feature:
BLAST of Gsp_005528 vs. RefSeq Human
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gsp_005528 vs. uniprot
Analysis Date: 2016-03-08 (Girardia Sp. BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL3.083e-6334.02RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL3.092e-5930.75RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|12643734|sp|Q19746|INX3_CAEEL1.350e-5531.82RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|44889063|sp|Q23027|INX5_CAEEL1.640e-5130.33RecName: Full=Innexin-5; AltName: Full=Protein opu... [more]
gi|10720052|sp|Q23157|INX11_CAEEL2.143e-5131.12RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
back to top
BLAST of Gsp_005528 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|2.033e-1923.58innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|2.033e-1923.58innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|2.033e-1923.58innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|2.033e-1923.58innexin 2, isoform D [Drosophila melanogaster][more]
gi|17864458|ref|NP_524824.1|1.485e-1826.24optic ganglion reduced, isoform A [Drosophila mela... [more]
back to top
BLAST of Gsp_005528 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Girardia Sp. BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150036480.000e+075.00SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150036490.000e+073.08SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150008371.507e-13247.13Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150009183.424e-12848.64Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150006573.974e-12043.67Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Gsp_005528 ID=Gsp_005528|Name=Gsp_005528|organism=Girardia sp.|type=mRNA|length=1558bp
ATTAAATGTAACTCGATTACCAAATGGCACCGTTTACTGGTAACTAACAA
TTCATTGTTTGAAATTAAAATTATGTCAAATAATATGTCGAAAAATTTAT
TAGATTCAACAATTTACTAATTCAAATTTAATGGAATCTTTATTAACTCA
ATTTTCGGCATTTAAAGTAGAAAAATATGTAGGAATTGAAGATGGTGCTG
ATAAAGCTAGTTTTCTTTTCAGTGTTGCAATATTAGTTGTTTGCAGTATC
ATTATTTCTACCAAACAATATGTTGCAACAGATATTTCTTGTTATATTCC
TGTTGTAATTTCCGGTTCTGATTTTGAAAAATTTATTAGGAATTATTGTT
GGGTTCATGGTACAATACCATTTAGAAGTAATGAAACTTTACCTCAAACA
AAAGAAGAATGGATGACCGCTGAATACACAAAAAAAATAAATTACTATCA
ATGGGTTCCTTTTGTTCTTGGACTTCAAGGAATTTTGTTTTATTTACCTC
GTTTGATTTGGAGCACAATAGTTTATAATTTAAGTGGAAACCATTTGGAA
GGAATCGTTGTTAGTGCTCAAAAGGCTACTAATCAAGTTGGCGACAGTAG
AAAAGAAAATATAGAACTGATAGCAAAATCTTTAGAAGATTTGTTTTTGC
AAAGACGAGTTTTGGGTCATAAAAAATTTCCTGTTTTACGACAAAAAATG
TCATTAGTATGCTGCGGACGAAGAACGGGAATATTTCTTGTTTCTCTTTA
TTTTCTTATTAAAATTCTTTATTTAATAAACGCCTTTGGACAGATTCTGC
TGATGCAAAACTTCCTTAGACTTGGCACTACAAAATTAAATGCAGCATTT
GGATGGACGATTTTACAAGATATTATTTCTGGTAAACAATGGACGGAAAA
TCTGTTATTTCCAAGAACAACGTTTTGTTTTGTTGGTGATATTTCGCTAG
TTGCTGTCAAAAATCATTTTGTGGCTCAATGTACATTGCCAATAAATATG
CTTAATGAAAAGATATACATATTTTTATGGTTTTGGACTGTTGGAGTTTT
AATTCTCACAATAATTAGTATACCAATTTGGTTGTGGAGAATGACATTTT
TTAGTAAACGTCAAAAATTTGTTAAAAAATTTTTGAAAATTAAATGCTCA
TATTCTAAAGTAAAACATAAAGAATTAATTTCACACTTCGTCGGACGATT
TTTACGACACGATGGAATATTTATTCTACACATCATTTCATTGAATGCTG
GAGATTTAATTGCAACAGATATTGTAACTGAATTATGGGAAATTTATACA
AAATATTATGTGGAAAAAGATTTTAGCAAAAATATGGTTTCTATAGCTGA
TGAAAAAACTAAACAAACCTTTGTTTAGTCATGTTTTTCACACTAACACT
TCATTTTCCGAACATTTTCATTGAATTACATATCAATATTCATTACACTT
TTTATATTTTAAATTTAATTTATGATATTTTCATTTATTTGGCTTTAAGT
GTTACTAAATGTAATTTATTATAAAATTTTTTATGAAAAATAAATAATTA
TTAAGATT

Design Primers for Gsp_005528

back to top

protein sequence

>Gsp_005528-protein ID=Gsp_005528-protein|Name=Gsp_005528|organism=Girardia sp.|type=polypeptide|length=416bp
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
back to top

coding sequence

>Gsp_005528.131.1378 ID=Gsp_005528.131.1378|Name=Gsp_005528.131.1378|organism=Girardia sp.|type=CDS|length=1248bp
ATGGAATCTTTATTAACTCAATTTTCGGCATTTAAAGTAGAAAAATATGT
AGGAATTGAAGATGGTGCTGATAAAGCTAGTTTTCTTTTCAGTGTTGCAA
TATTAGTTGTTTGCAGTATCATTATTTCTACCAAACAATATGTTGCAACA
GATATTTCTTGTTATATTCCTGTTGTAATTTCCGGTTCTGATTTTGAAAA
ATTTATTAGGAATTATTGTTGGGTTCATGGTACAATACCATTTAGAAGTA
ATGAAACTTTACCTCAAACAAAAGAAGAATGGATGACCGCTGAATACACA
AAAAAAATAAATTACTATCAATGGGTTCCTTTTGTTCTTGGACTTCAAGG
AATTTTGTTTTATTTACCTCGTTTGATTTGGAGCACAATAGTTTATAATT
TAAGTGGAAACCATTTGGAAGGAATCGTTGTTAGTGCTCAAAAGGCTACT
AATCAAGTTGGCGACAGTAGAAAAGAAAATATAGAACTGATAGCAAAATC
TTTAGAAGATTTGTTTTTGCAAAGACGAGTTTTGGGTCATAAAAAATTTC
CTGTTTTACGACAAAAAATGTCATTAGTATGCTGCGGACGAAGAACGGGA
ATATTTCTTGTTTCTCTTTATTTTCTTATTAAAATTCTTTATTTAATAAA
CGCCTTTGGACAGATTCTGCTGATGCAAAACTTCCTTAGACTTGGCACTA
CAAAATTAAATGCAGCATTTGGATGGACGATTTTACAAGATATTATTTCT
GGTAAACAATGGACGGAAAATCTGTTATTTCCAAGAACAACGTTTTGTTT
TGTTGGTGATATTTCGCTAGTTGCTGTCAAAAATCATTTTGTGGCTCAAT
GTACATTGCCAATAAATATGCTTAATGAAAAGATATACATATTTTTATGG
TTTTGGACTGTTGGAGTTTTAATTCTCACAATAATTAGTATACCAATTTG
GTTGTGGAGAATGACATTTTTTAGTAAACGTCAAAAATTTGTTAAAAAAT
TTTTGAAAATTAAATGCTCATATTCTAAAGTAAAACATAAAGAATTAATT
TCACACTTCGTCGGACGATTTTTACGACACGATGGAATATTTATTCTACA
CATCATTTCATTGAATGCTGGAGATTTAATTGCAACAGATATTGTAACTG
AATTATGGGAAATTTATACAAAATATTATGTGGAAAAAGATTTTAGCAAA
AATATGGTTTCTATAGCTGATGAAAAAACTAAACAAACCTTTGTTTAG
back to top
Gene Groups
Gsp_005528 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.