Ddo_024742, Ddo_024742 (mRNA) Dugesia dorotocephala

Overview
NameDdo_024742
Unique NameDdo_024742
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length6908
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_024742 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 729/833 (87.52%), Postives = 770/833 (92.44%), Query Frame = 3
Query: 3567 NGSETKXXXXXXXXXX-XFRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 6059
            NGSET+G+    G  R TFRIVEPNL P DITEKTGN+GR V+LQS+FTKFS++RSEK+MMYDSVFS +GL PK KLQ IVR+CQENKLPGAFCFDGRRLFTSEKWHGE+DIQEF++++KKMTLRLV+ I+PETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRN GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISE+KEM+VDEKFEMGGRTLSYAEYFKERYNIRLT G+QPFVLTRVKKPMRR  +K   E   +  E E   E+             DMTLNIPGELCFLCGFSDQEK+NMDLQKNLG VLKREPRERL+DIPA+CNW+K +D A  + +KWQ KIDNKPLEIEGRELP CDVISGG+KINEKMGDDWKFGR+QFDIKRDRKHEIDVVIVDRNDFQYKNFM DVEQELR MRIDAR+GKVNTCGPND+ERCLND+ARSGSGCAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSF VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGS P  INERIRNRLFYL
Sbjct:   14 NGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEK-------------DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 729/833 (87.52%), Postives = 770/833 (92.44%), Query Frame = -3
Query:  850 NGSETKXXXXXXXXXX-TFRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 3342
            NGSET+G+    G  R TFRIVEPNL P DITEKTGN+GR V+LQS+FTKFS++RSEK+MMYDSVFS +GL PK KLQ IVR+CQENKLPGAFCFDGRRLFTSEKWHGE+DIQEF++++KKMTLRLV+ I+PETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRN GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISE+KEM+VDEKFEMGGRTLSYAEYFKERYNIRLT G+QPFVLTRVKKPMRR  +K   E   +  E E   E+             DMTLNIPGELCFLCGFSDQEK+NMDLQKNLG VLKREPRERL+DIPA+CNW+K +D A  + +KWQ KIDNKPLEIEGRELP CDVISGG+KINEKMGDDWKFGR+QFDIKRDRKHEIDVVIVDRNDFQYKNFM DVEQELR MRIDAR+GKVNTCGPND+ERCLND+ARSGSGCAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSF VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGS P  INERIRNRLFYL
Sbjct:   14 NGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEK-------------DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of Ddo_024742 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 593/814 (72.85%), Postives = 690/814 (84.77%), Query Frame = 3
Query: 3618 FRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 6059
            FRIVEP+L P +  +K GN+G+VVRLQS+FTKFS+ +SEKY+MYD+ FS MGL PK KLQ++VRIC+E  LPG+FC+DGRRLFTS+ W   +DI+EF  ++KK++LRLV+  + +TEEYYQMINVLLNNLQ++MGQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISE+KEM+++E FEM GRTLSYA+YFKERYNI LT  +QPFVLTRVKK  RR  RK   E  A                        D+TLNI GELCFLCGFSDQEK+N+DLQKNLG VLKR PRERL+DIP+FC+W+K N+N+  + +KW  KIDN PLEIEGRELP CDVISGG +INEK+ DDWKFG++QF++++  KHEIDVVIVDRND QY NF+ DVE E++Q+R DA+IG+V  C  ND+ER LND  RSGSGCAK+ALVFVPDDR YAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVSSKTVMQIF+KFGYDPWT++IK+RPTMIVG+DT+HNK SKKSI ASVFSINSTF+QYMSF NSPKG+QEFH+TL  NF  AL +FK+ Y ILP RI+VYRDGVGD+QL FTKQFEVDAMKPLVENIYK NG  VPQIIYVIVKKRI TKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+P+NYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKGS PA+INERIRNRLFYL
Sbjct:   25 FRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDM--------------------DLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 593/814 (72.85%), Postives = 690/814 (84.77%), Query Frame = -3
Query:  850 FRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 3291
            FRIVEP+L P +  +K GN+G+VVRLQS+FTKFS+ +SEKY+MYD+ FS MGL PK KLQ++VRIC+E  LPG+FC+DGRRLFTS+ W   +DI+EF  ++KK++LRLV+  + +TEEYYQMINVLLNNLQ++MGQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISE+KEM+++E FEM GRTLSYA+YFKERYNI LT  +QPFVLTRVKK  RR  RK   E  A                        D+TLNI GELCFLCGFSDQEK+N+DLQKNLG VLKR PRERL+DIP+FC+W+K N+N+  + +KW  KIDN PLEIEGRELP CDVISGG +INEK+ DDWKFG++QF++++  KHEIDVVIVDRND QY NF+ DVE E++Q+R DA+IG+V  C  ND+ER LND  RSGSGCAK+ALVFVPDDR YAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVSSKTVMQIF+KFGYDPWT++IK+RPTMIVG+DT+HNK SKKSI ASVFSINSTF+QYMSF NSPKG+QEFH+TL  NF  AL +FK+ Y ILP RI+VYRDGVGD+QL FTKQFEVDAMKPLVENIYK NG  VPQIIYVIVKKRI TKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+P+NYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKGS PA+INERIRNRLFYL
Sbjct:   25 FRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDM--------------------DLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of Ddo_024742 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 436/818 (53.30%), Postives = 579/818 (70.78%), Query Frame = 3
Query: 3618 FRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLID---KWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 6059
            F I+EP L P  +T+K G  GRVV L+S++  F+I     + MYD V     +  K +L L     + N  P  FCFDGRRLFT+ KWH + D +    +D ++++RL+   +  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS++KEM V+++ ++G + +SY  YFK+RYNI L   +QPFV++RVK+ M R   K   E                           D +L+IPGELC+LCGFSD E++N++LQKNLG VLKREPRERL DI  FC W      AG+  D    W   I+ +P+ I GREL   D+ S   KIN K+ DDWKFG I+FD+ +   H   V++VDRN   + NF+ DV++E+ ++RI+  +  +++C  N++E  L D  R       MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL
Sbjct:   23 FAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTET--------------------DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT----GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 436/818 (53.30%), Postives = 579/818 (70.78%), Query Frame = -3
Query:  850 FRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLID---KWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 3291
            F I+EP L P  +T+K G  GRVV L+S++  F+I     + MYD V     +  K +L L     + N  P  FCFDGRRLFT+ KWH + D +    +D ++++RL+   +  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS++KEM V+++ ++G + +SY  YFK+RYNI L   +QPFV++RVK+ M R   K   E                           D +L+IPGELC+LCGFSD E++N++LQKNLG VLKREPRERL DI  FC W      AG+  D    W   I+ +P+ I GREL   D+ S   KIN K+ DDWKFG I+FD+ +   H   V++VDRN   + NF+ DV++E+ ++RI+  +  +++C  N++E  L D  R       MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL
Sbjct:   23 FAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTET--------------------DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT----GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of Ddo_024742 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 267.314 bits (682), Expect = 2.266e-72
Identity = 230/841 (27.35%), Postives = 386/841 (45.90%), Query Frame = 3
Query: 3663 KTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPP--KAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDI---QEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKIN-EKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDI--------------ERCLNDSARSGSGCAKMALVFVPDDRA--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
            KTG  G  + L+++F +  ++    + +Y   +     PP    +L+  +    E  L  A  FDG  LF   K      +   +  N E  ++T+ L  ++ P +    Q  N+L   +  ++  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI ++  + + +  F+ G   +S+  YFK +Y + +T G Q  +++ VK+    G   P                                 + +P E C+L G +D+ +A+ ++ K+L    +  P +R   I    + + +N +    +  W    +NK L + GR LP+  +I GG          DW        +       I  + +D     Y     DV Q L Q      + KV+  GP  I              E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+VYRDGVGD  L     +EV  +   ++ + ++     P++  V+VKKRI+++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   P++YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK       N  + + L+YL
Sbjct:  102 KTGVSGTAIELRANFMR--LLSRPMWALYQ--YHVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPG------------------------------PAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQT-----LNKVS--GPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE---PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEP-----NMNLDDFLYYL 858          

HSP 2 Score: 267.314 bits (682), Expect = 2.266e-72
Identity = 230/841 (27.35%), Postives = 386/841 (45.90%), Query Frame = -3
Query:  850 KTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPP--KAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDI---QEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKIN-EKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDI--------------ERCLNDSARSGSGCAKMALVFVPDDRA--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3246
            KTG  G  + L+++F +  ++    + +Y   +     PP    +L+  +    E  L  A  FDG  LF   K      +   +  N E  ++T+ L  ++ P +    Q  N+L   +  ++  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI ++  + + +  F+ G   +S+  YFK +Y + +T G Q  +++ VK+    G   P                                 + +P E C+L G +D+ +A+ ++ K+L    +  P +R   I    + + +N +    +  W    +NK L + GR LP+  +I GG          DW        +       I  + +D     Y     DV Q L Q      + KV+  GP  I              E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+VYRDGVGD  L     +EV  +   ++ + ++     P++  V+VKKRI+++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   P++YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK       N  + + L+YL
Sbjct:  102 KTGVSGTAIELRANFMR--LLSRPMWALYQ--YHVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPG------------------------------PAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQT-----LNKVS--GPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE---PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEP-----NMNLDDFLYYL 858          
BLAST of Ddo_024742 vs. uniprot
Match: gi|74716803|sp|Q96J94|PIWL1_HUMAN (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 260.766 bits (665), Expect = 3.275e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = 3
Query: 3660 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          

HSP 2 Score: 260.766 bits (665), Expect = 3.275e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = -3
Query:  850 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3249
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of Ddo_024742 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 1476.84 bits (3822), Expect = 0.000e+0
Identity = 732/833 (87.88%), Postives = 774/833 (92.92%), Query Frame = 3
Query: 3567 NGSETKXXXXXXX-XXXXFRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL* 6062
            NGSET+G+    G LRRTFRIVEPNL P DITEKTGN+GR V+LQS+FTKFS++RSEK+MMYDSVFS +GL PK KLQ IVR+CQENKLPGAFCFDGRRLFTSEKWHGE+DIQEF++++KKMTLRLV+ I+PETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRN GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISE+KEM+VDEKFEMGGRTLSYAEYFKERYNIRLT G+QPFVLTRVKKPMRR  +K   E   +  E E   E   ++         DMTLNIPGELCFLCGFSDQEK+NMDLQKNLG VLKREPRERL+DIPA+CNW+K +D A  + +KWQ KIDNKPLEIEGRELP CDVISGG+KINEKMGDDWKFGR+QFDIKRDRKHEIDVVIVDRNDFQYKNFM DVEQELR MRIDAR+GKVNTCGPND+ERCLND+ARSGSGCAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGS P  INERIRNRLFYL*
Sbjct:   14 NGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEK---------DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          

HSP 2 Score: 1476.84 bits (3822), Expect = 0.000e+0
Identity = 732/833 (87.88%), Postives = 774/833 (92.92%), Query Frame = -3
Query:  847 NGSETKXXXXXXX-XXXTFRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL* 3342
            NGSET+G+    G LRRTFRIVEPNL P DITEKTGN+GR V+LQS+FTKFS++RSEK+MMYDSVFS +GL PK KLQ IVR+CQENKLPGAFCFDGRRLFTSEKWHGE+DIQEF++++KKMTLRLV+ I+PETEEYYQMINVLLNNLQVM+GQERIGKGYFLSPNITKDEVPRN GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISE+KEM+VDEKFEMGGRTLSYAEYFKERYNIRLT G+QPFVLTRVKKPMRR  +K   E   +  E E   E   ++         DMTLNIPGELCFLCGFSDQEK+NMDLQKNLG VLKREPRERL+DIPA+CNW+K +D A  + +KWQ KIDNKPLEIEGRELP CDVISGG+KINEKMGDDWKFGR+QFDIKRDRKHEIDVVIVDRNDFQYKNFM DVEQELR MRIDAR+GKVNTCGPND+ERCLND+ARSGSGCAKMALVFVPDDR YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVG+DTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILV+RDGVGDNQL FTK FEVDAMKPL+ENIYK NGFPVPQIIYVIVKKR+ TKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATP+NYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGS P  INERIRNRLFYL*
Sbjct:   14 NGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEK---------DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          
BLAST of Ddo_024742 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 437/819 (53.36%), Postives = 580/819 (70.82%), Query Frame = 3
Query: 3618 FRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLID---KWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL* 6062
            F I+EP L P  +T+K G  GRVV L+S++  F+I     + MYD V     +  K +L L     + N  P  FCFDGRRLFT+ KWH + D +    +D ++++RL+   +  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS++KEM V+++ ++G + +SY  YFK+RYNI L   +QPFV++RVK+ M R   K   E                           D +L+IPGELC+LCGFSD E++N++LQKNLG VLKREPRERL DI  FC W      AG+  D    W   I+ +P+ I GREL   D+ S   KIN K+ DDWKFG I+FD+ +   H   V++VDRN   + NF+ DV++E+ ++RI+  +  +++C  N++E  L D  R       MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL*
Sbjct:   66 FAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTET--------------------DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT----GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          

HSP 2 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 437/819 (53.36%), Postives = 580/819 (70.82%), Query Frame = -3
Query:  847 FRIVEPNLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLID---KWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL* 3291
            F I+EP L P  +T+K G  GRVV L+S++  F+I     + MYD V     +  K +L L     + N  P  FCFDGRRLFT+ KWH + D +    +D ++++RL+   +  +EEYYQMIN++ NN+Q+ MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS++KEM V+++ ++G + +SY  YFK+RYNI L   +QPFV++RVK+ M R   K   E                           D +L+IPGELC+LCGFSD E++N++LQKNLG VLKREPRERL DI  FC W      AG+  D    W   I+ +P+ I GREL   D+ S   KIN K+ DDWKFG I+FD+ +   H   V++VDRN   + NF+ DV++E+ ++RI+  +  +++C  N++E  L D  R       MALVF+PDD+ YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVGLDT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R+++YRDGVGD+QL FTK+FE DA+  ++E IY+N    +PQIIYV+VKKRI+ K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+P+NYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL*
Sbjct:   66 FAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTET--------------------DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT----GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          
BLAST of Ddo_024742 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 219.55 bits (558), Expect = 5.692e-58
Identity = 172/636 (27.04%), Postives = 307/636 (48.27%), Query Frame = 3
Query: 4206 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEID--VVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPND--IERCLNDSARSGSGCAKMALVF---VPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL* 6062
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI+++    +   +F+ GG  +SY +YFK  Y +++   EQP ++++                               +  +     +  +   IP ELC L G +D    +  L + L    +  P++R E +  F + +   + A +L+  W   I+   + I   ++   ++I  GN+ +   G+  +F +     K      I+  ++I  ++     N +       +  R+    GK      N+   E  L +  R+ +   ++ +     V +DR Y  +K F  +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VGLD +H+ K   +S+ A V S N+  T++ S  +  +  +E    L       L+ + +  + LP+ I +YRDGV D QL + ++ E++    + E+   +     P ++Y +V+KRI T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TP++Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+  K     ++ +    RLFYL*
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK-----------------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK---PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975          

HSP 2 Score: 219.55 bits (558), Expect = 5.692e-58
Identity = 172/636 (27.04%), Postives = 307/636 (48.27%), Query Frame = -3
Query:  847 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEID--VVIVDRNDFQYKNFMGDVEQELRQMRIDARIGKVNTCGPND--IERCLNDSARSGSGCAKMALVF---VPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL* 2703
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI+++    +   +F+ GG  +SY +YFK  Y +++   EQP ++++                               +  +     +  +   IP ELC L G +D    +  L + L    +  P++R E +  F + +   + A +L+  W   I+   + I   ++   ++I  GN+ +   G+  +F +     K      I+  ++I  ++     N +       +  R+    GK      N+   E  L +  R+ +   ++ +     V +DR Y  +K F  +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VGLD +H+ K   +S+ A V S N+  T++ S  +  +  +E    L       L+ + +  + LP+ I +YRDGV D QL + ++ E++    + E+   +     P ++Y +V+KRI T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TP++Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+  K     ++ +    RLFYL*
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK-----------------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNP-EMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK---PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975          
BLAST of Ddo_024742 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 116.701 bits (291), Expect = 7.454e-26
Identity = 116/444 (26.13%), Postives = 191/444 (43.02%), Query Frame = 3
Query: 4734 KQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD--WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDAR---IGKVNTC----GPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPT------MIVGLDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVL-EDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 5981
            + N NA   +  +   ++ +  +I+GR +PA  +  GG    +       W     QF    + K         +   + ++ +    Q+L+++  DA    +G+   C    G + +E        S +G   + +V       YA+VK    +  GL TQCV  +N     +K      S   ++I  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ YRDGV + Q       E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ PS+Y+VL +D R           + +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  454 RSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVR-EDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRF----------SADEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          

HSP 2 Score: 116.701 bits (291), Expect = 7.454e-26
Identity = 116/444 (26.13%), Postives = 191/444 (43.02%), Query Frame = -3
Query:  928 KQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD--WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDAR---IGKVNTC----GPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPT------MIVGLDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVL-EDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 2175
            + N NA   +  +   ++ +  +I+GR +PA  +  GG    +       W     QF    + K         +   + ++ +    Q+L+++  DA    +G+   C    G + +E        S +G   + +V       YA+VK    +  GL TQCV  +N     +K      S   ++I  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ YRDGV + Q       E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ PS+Y+VL +D R           + +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  454 RSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVR-EDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN----VNKPSPQTLSNLCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRF----------SADEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Ddo_024742 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 115.931 bits (289), Expect = 1.330e-25
Identity = 118/475 (24.84%), Postives = 210/475 (44.21%), Query Frame = 3
Query: 4695 ERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDR--KHEIDVVIVDRNDFQYKNFMGDVEQEL--RQMRIDARIGK---VNTCGPNDIERCLNDSARSGSGCAKMA--LVFVP-DDRAYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGLDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNSPKGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG 6008
            +RL  + +  + L+  +   + +  ++ +ID K + ++ R L   + I GG +     G  W     +F    D+     +  V  +R+  +    + D+E +L      +  R+G     +     +IE+   D+ R+     K    LVFV  +D  Y +VK F  +  G++TQC+  +  T    K         ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + +     ++E        E     +NL +  +K    + P+R++ YRDGV + Q     + E+ A++   + + K+     P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P++Y+VL D          +    +ELQ  TY L H+Y     ++  P P +YAH LA   G+   G
Sbjct:  519 DRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          

HSP 2 Score: 115.931 bits (289), Expect = 1.330e-25
Identity = 118/475 (24.84%), Postives = 210/475 (44.21%), Query Frame = -3
Query:  901 ERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDR--KHEIDVVIVDRNDFQYKNFMGDVEQEL--RQMRIDARIGK---VNTCGPNDIERCLNDSARSGSGCAKMA--LVFVP-DDRAYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGLDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNSPKGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG 2214
            +RL  + +  + L+  +   + +  ++ +ID K + ++ R L   + I GG +     G  W     +F    D+     +  V  +R+  +    + D+E +L      +  R+G     +     +IE+   D+ R+     K    LVFV  +D  Y +VK F  +  G++TQC+  +  T    K         ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + +     ++E        E     +NL +  +K    + P+R++ YRDGV + Q     + E+ A++   + + K+     P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P++Y+VL D          +    +ELQ  TY L H+Y     ++  P P +YAH LA   G+   G
Sbjct:  519 DRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          
BLAST of Ddo_024742 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = 3
Query: 3660 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          

HSP 2 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = -3
Query:  850 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3249
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of Ddo_024742 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = 3
Query: 3660 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          

HSP 2 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = -3
Query:  850 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3249
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of Ddo_024742 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = 3
Query: 3660 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          

HSP 2 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = -3
Query:  850 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3249
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of Ddo_024742 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = 3
Query: 3660 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          

HSP 2 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = -3
Query:  850 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3249
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of Ddo_024742 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = 3
Query: 3660 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 6059
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          

HSP 2 Score: 260.766 bits (665), Expect = 1.236e-70
Identity = 221/848 (26.06%), Postives = 377/848 (44.46%), Query Frame = -3
Query:  850 EKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWH---GETDIQEFNYEDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEVK-EMSVDEKFEMG-GRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNK-------------------INEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRID------ARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSAPAVINERIRNRLFYL 3249
             KTG+ G +VRL  S   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++      E   +  N ED ++T+ L  ++ P +    Q  N++   L  +M  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ ++  + +    F+   G  +S+ EY++++YN  +T  +QP ++++                              PK R           + IP ELC+L G +D+ + + ++ K+L    +  P +R  ++    +++ +NDN  R +  W    D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    MG   ++   + +D       R+ +        I  CL  S R               D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+VYRDGVGD QL     +EV      +++I +      P++  ++VKKR+ T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +P++YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:  103 SKTGSSGIIVRL--STNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQ------------------------------PKRRRGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRK--------------DKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of Ddo_024742 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 248.825 bits (634), Expect = 2.627e-67
Identity = 206/817 (25.21%), Postives = 360/817 (44.06%), Query Frame = 3
Query: 3636 NLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYE---DKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDW-KFGRIQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGK---VNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRA--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 5993
            N  P ++  K G  G  V LQ++F +       + + Y   F      P+ ++ ++      N L   + FDG +LFT+ K+  E  +     +   + K++++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI++V    +    F   GR +S+ EY+  +YNIR+    QP ++++                                  +       ++ + IP ELC + G + + ++N  L + +    +  P++R + + AF + L+    + +++  W  ++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  +  + +    M +  R  +   +         R ++D  RS     K+ L  VP+D A  Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ YRDGV    L    +FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +P++YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPR----AKIEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK-------------------------------NRDKALKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 248.825 bits (634), Expect = 2.627e-67
Identity = 206/817 (25.21%), Postives = 360/817 (44.06%), Query Frame = -3
Query:  916 NLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYE---DKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDW-KFGRIQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGK---VNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRA--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 3273
            N  P ++  K G  G  V LQ++F +       + + Y   F      P+ ++ ++      N L   + FDG +LFT+ K+  E  +     +   + K++++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI++V    +    F   GR +S+ EY+  +YNIR+    QP ++++                                  +       ++ + IP ELC + G + + ++N  L + +    +  P++R + + AF + L+    + +++  W  ++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  +  + +    M +  R  +   +         R ++D  RS     K+ L  VP+D A  Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ YRDGV    L    +FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +P++YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPR----AKIEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK-------------------------------NRDKALKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of Ddo_024742 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 248.825 bits (634), Expect = 2.627e-67
Identity = 206/817 (25.21%), Postives = 360/817 (44.06%), Query Frame = 3
Query: 3636 NLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYE---DKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDW-KFGRIQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGK---VNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRA--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 5993
            N  P ++  K G  G  V LQ++F +       + + Y   F      P+ ++ ++      N L   + FDG +LFT+ K+  E  +     +   + K++++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI++V    +    F   GR +S+ EY+  +YNIR+    QP ++++                                  +       ++ + IP ELC + G + + ++N  L + +    +  P++R + + AF + L+    + +++  W  ++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  +  + +    M +  R  +   +         R ++D  RS     K+ L  VP+D A  Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ YRDGV    L    +FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +P++YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPR----AKIEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK-------------------------------NRDKALKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 248.825 bits (634), Expect = 2.627e-67
Identity = 206/817 (25.21%), Postives = 360/817 (44.06%), Query Frame = -3
Query:  916 NLAPTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENKLPGAFCFDGRRLFTSEKWHGETDIQEFNYE---DKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEVK-EMSVDEKFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDW-KFGRIQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARIGK---VNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRA--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 3273
            N  P ++  K G  G  V LQ++F +       + + Y   F      P+ ++ ++      N L   + FDG +LFT+ K+  E  +     +   + K++++ V  I      + Q++N++L      +  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI++V    +    F   GR +S+ EY+  +YNIR+    QP ++++                                  +       ++ + IP ELC + G + + ++N  L + +    +  P++R + + AF + L+    + +++  W  ++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  +  + +    M +  R  +   +         R ++D  RS     K+ L  VP+D A  Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ YRDGV    L    +FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +P++YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPR----AKIEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK-------------------------------NRDKALKTNASELVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of Ddo_024742 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 236.884 bits (603), Expect = 1.037e-63
Identity = 225/851 (26.44%), Postives = 383/851 (45.01%), Query Frame = 3
Query: 3645 PTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK-LPGAFCFDGRRLFTSEKWHGETDIQEFNY-----------EDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQE-RIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNS---VMKAYNRRSID-------QLIGRDIITKYNNKTYRISEVKEMSVDE-KFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELR------QMRI-DARIGKVNTCGP---------NDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPV-PQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 6059
            P  +T K G +G  + +Q+++  F +++   + +Y   +     P     +L      E+K + G + FDG  +F   ++     +Q+  Y           E+ ++ ++ V  +     E +Q++N++L   + M G + ++   Y+  P    +           E    ++  G+ T++++      E   LL  E  ++V+   +   ++    R S D        ++G  I+T YNNKTYRI +V   S    KF+     +SY +Y+K+RYNI +   +QP V++R                                  ++      D  + I  EL    G +D  +A+    + +    +  P  R+E +  F   LK    +   +  W  ++D+  +EI  R LP   ++ G  KI               D + D  +E     + +N    + ++    + LR      QM I  A   K+N C P         N       D+A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S  +K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N   AL  +++++  LP+RIL +RDGVGD QL+     EV+ +K  ++ IYK+ G     ++ ++IV KRI ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +P++YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +     AP+     ++N+L++L
Sbjct:   26 PPGMTSKKGVVGTHITVQANY--FKVLKRPNWTIYQ--YRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKA---VQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILR--RAMEGLDLKLVSRYYYDPQAKIN----------LENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR--------------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKI------------FVCDARADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE-SINRAPSA---GLQNQLYFL 795          

HSP 2 Score: 236.884 bits (603), Expect = 1.037e-63
Identity = 225/851 (26.44%), Postives = 383/851 (45.01%), Query Frame = -3
Query:  850 PTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK-LPGAFCFDGRRLFTSEKWHGETDIQEFNY-----------EDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQE-RIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNS---VMKAYNRRSID-------QLIGRDIITKYNNKTYRISEVKEMSVDE-KFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELR------QMRI-DARIGKVNTCGP---------NDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPV-PQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 3264
            P  +T K G +G  + +Q+++  F +++   + +Y   +     P     +L      E+K + G + FDG  +F   ++     +Q+  Y           E+ ++ ++ V  +     E +Q++N++L   + M G + ++   Y+  P    +           E    ++  G+ T++++      E   LL  E  ++V+   +   ++    R S D        ++G  I+T YNNKTYRI +V   S    KF+     +SY +Y+K+RYNI +   +QP V++R                                  ++      D  + I  EL    G +D  +A+    + +    +  P  R+E +  F   LK    +   +  W  ++D+  +EI  R LP   ++ G  KI               D + D  +E     + +N    + ++    + LR      QM I  A   K+N C P         N       D+A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S  +K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N   AL  +++++  LP+RIL +RDGVGD QL+     EV+ +K  ++ IYK+ G     ++ ++IV KRI ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +P++YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +     AP+     ++N+L++L
Sbjct:   26 PPGMTSKKGVVGTHITVQANY--FKVLKRPNWTIYQ--YRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKA---VQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILR--RAMEGLDLKLVSRYYYDPQAKIN----------LENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR--------------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKI------------FVCDARADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE-SINRAPSA---GLQNQLYFL 795          
BLAST of Ddo_024742 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 237.654 bits (605), Expect = 1.335e-63
Identity = 225/851 (26.44%), Postives = 383/851 (45.01%), Query Frame = 3
Query: 3645 PTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK-LPGAFCFDGRRLFTSEKWHGETDIQEFNY-----------EDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQE-RIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNS---VMKAYNRRSID-------QLIGRDIITKYNNKTYRISEVKEMSVDE-KFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELR------QMRI-DARIGKVNTCGP---------NDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPV-PQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 6059
            P  +T K G +G  + +Q+++  F +++   + +Y   +     P     +L      E+K + G + FDG  +F   ++     +Q+  Y           E+ ++ ++ V  +     E +Q++N++L   + M G + ++   Y+  P    +           E    ++  G+ T++++      E   LL  E  ++V+   +   ++    R S D        ++G  I+T YNNKTYRI +V   S    KF+     +SY +Y+K+RYNI +   +QP V++R                                  ++      D  + I  EL    G +D  +A+    + +    +  P  R+E +  F   LK    +   +  W  ++D+  +EI  R LP   ++ G  KI               D + D  +E     + +N    + ++    + LR      QM I  A   K+N C P         N       D+A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S  +K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N   AL  +++++  LP+RIL +RDGVGD QL+     EV+ +K  ++ IYK+ G     ++ ++IV KRI ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +P++YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +     AP+     ++N+L++L
Sbjct:   97 PPGMTSKKGVVGTHITVQANY--FKVLKRPNWTIYQ--YRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKA---VQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILR--RAMEGLDLKLVSRYYYDPQAKIN----------LENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR--------------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKI------------FVCDARADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE-SINRAPSA---GLQNQLYFL 866          

HSP 2 Score: 237.654 bits (605), Expect = 1.335e-63
Identity = 225/851 (26.44%), Postives = 383/851 (45.01%), Query Frame = -3
Query:  850 PTDITEKTGNLGRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK-LPGAFCFDGRRLFTSEKWHGETDIQEFNY-----------EDKKMTLRLVAQIIPETEEYYQMINVLLNNLQVMMGQE-RIGKGYFLSPNITKDEVPRNCGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNS---VMKAYNRRSID-------QLIGRDIITKYNNKTYRISEVKEMSVDE-KFEMGGRTLSYAEYFKERYNIRLTGGEQPFVLTRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELR------QMRI-DARIGKVNTCGP---------NDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPV-PQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 3264
            P  +T K G +G  + +Q+++  F +++   + +Y   +     P     +L      E+K + G + FDG  +F   ++     +Q+  Y           E+ ++ ++ V  +     E +Q++N++L   + M G + ++   Y+  P    +           E    ++  G+ T++++      E   LL  E  ++V+   +   ++    R S D        ++G  I+T YNNKTYRI +V   S    KF+     +SY +Y+K+RYNI +   +QP V++R                                  ++      D  + I  EL    G +D  +A+    + +    +  P  R+E +  F   LK    +   +  W  ++D+  +EI  R LP   ++ G  KI               D + D  +E     + +N    + ++    + LR      QM I  A   K+N C P         N       D+A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S  +K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN     QE  E +  N   AL  +++++  LP+RIL +RDGVGD QL+     EV+ +K  ++ IYK+ G     ++ ++IV KRI ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +P++YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +     AP+     ++N+L++L
Sbjct:   97 PPGMTSKKGVVGTHITVQANY--FKVLKRPNWTIYQ--YRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKA---VQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILR--RAMEGLDLKLVSRYYYDPQAKIN----------LENFRMQLWPGYQTSIRQH-----ENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR--------------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKI------------FVCDARADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE-SINRAPSA---GLQNQLYFL 866          
BLAST of Ddo_024742 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 214.927 bits (546), Expect = 1.802e-56
Identity = 149/501 (29.74%), Postives = 254/501 (50.70%), Query Frame = 3
Query: 4593 IPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEID--VVIVDRNDFQYK-NFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVP---DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 6059
            IP ELC+L G  D+ +++  L + +    +  P +R   +  F   +     A  +++ W   + N   +I GR++    +    +KI+   G   +F +     +  +   +   ++I  RN  Q   + + +++Q    + ++     + +   + I+  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  394 IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          

HSP 2 Score: 214.927 bits (546), Expect = 1.802e-56
Identity = 149/501 (29.74%), Postives = 254/501 (50.70%), Query Frame = -3
Query:  850 IPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCNWLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDDWKFGRIQFDIKRDRKHEID--VVIVDRNDFQYK-NFMGDVEQELRQMRIDARIGKVNTCGPNDIERCLNDSARSGSGCAKMALVFVP---DDRAYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL 2316
            IP ELC+L G  D+ +++  L + +    +  P +R   +  F   +     A  +++ W   + N   +I GR++    +    +KI+   G   +F +     +  +   +   ++I  RN  Q   + + +++Q    + ++     + +   + I+  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I++YRDG+GD QL+    +E+   + +  N  K        I Y++V+KRI T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TP++Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  394 IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
The following BLAST results are available for this feature:
BLAST of Ddo_024742 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+087.52RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+072.85RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+053.30RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE2.266e-7227.35RecName: Full=Piwi-like protein 1[more]
gi|74716803|sp|Q96J94|PIWL1_HUMAN3.275e-7026.06RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of Ddo_024742 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+087.88SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261770.000e+053.36SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001115.692e-5827.04Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389367.454e-2626.13dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329881.330e-2524.84SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
BLAST of Ddo_024742 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|1.236e-7026.06piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|1.236e-7026.06PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|1.236e-7026.06PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|1.236e-7026.06PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|1.236e-7026.06PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Ddo_024742 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|2.627e-6725.21piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|2.627e-6725.21piwi, isoform B [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|1.037e-6326.44aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|1.335e-6326.44aubergine, isoform A [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|1.802e-5629.74argonaute 3, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_024742 ID=Ddo_024742|Name=Ddo_024742|organism=Dugesia dorotocephala|type=mRNA|length=6908bp
TTTTTTTTGAAGACATTAAATTATATTTATTATTCATACATATAATATAA
CAAATCACAAAATATCATTCAATAAGTTGTATGACTATTAATGTACAGTT
GACTAACAATCATTGAATACAGATTACTGCAGATAATCAATTTAAATTAA
TAGAGAACGAAATAAAAGGATTTAACCCAAACAACTAAACAAATCAATAA
TTTTACAGCGTTGCTCGCACGATATTCACAATTAGCAACGTATTAAAACT
AATCAAGAAACACAGAAAAATTCACCTAAGAAAACCGTGATAAAAGATGA
TAACAAAGAGCGAATATTAACGAACTAATTTATTAATATATATTTATTAT
GATAAGAGAAAAATAACAATAAAAATTTACTTAATAATACATAAAAATTT
TACAAAAAGTTCCATATATTATAATTTTCAATTCGGAAAACGTAAATTTT
TTCGATTGCAGTTGGACAACAGAAACGCTCATCGAGAGAACAATCACGAC
TACAACAGCAACAAGAGCAGCACCACACGCACTACCACATCGATCAATCA
AAACTGCTGTTCGAGAAACTCGCAGAAACGATAACGAATTCGATCAGCAT
GATAAAGATTATAATAATGGTAATCAACACGCAACAACGACAAAGTAAGA
AGGAGCATTAATAATAATAGAATTAATAATAATTATTGGAACATTACGAT
AAATTAATAATTATTGATTAATTAATTTCGAATTACTAAAGTGAATGAAT
TATTAATGTAATTAAGTATTGCTAATATAATATTGTATAAGTGTATTCTA
ATAAATATTAATTGTTTATCCGGCTCCACTTGTCTCACGCGACCTTCTAC
AAGTAAAAGAGGCGGTTCCTGATTCTCTCGTTGATGACGGCTGGCGCGGA
GCCCTTGTGCACCTTGCCGACGAGCTCTGCCAGGCGGTGCGCGTAGTGGA
CGGGCACAGGCACGCGGATCGTTCCCATCCAGTTGAAGTACAGATGAGTC
AGAGCGTACGTGATCTTCTGGAGCTCGTTGGGCGCCATGGGGTCCATCGT
GCCCTTCTTGGTGAGCAGCCGCGTGTCCTCGAGCACGTTGTAGTTTGAGG
GAGTCGCTGTCCCTTTCGTCGTGCGCTGCGACACGAGGAAGAATTCATAG
AAGTTGGGCTTGACGATCTCCTTGTCGACGACTGTGCCCGGGTTGGGGTT
GTTGCCGCGGTTGAAGAGCTTGGTCGTGATGCGCTTCTTGACGATCACGT
AGATGATCTGCGGCACCGGGAACCCGTTGTTCTTGTAGATGTTCTCGACT
AGCGGCTTCATCGCGTCCACCTCGAACTGCTTGGTGAACCAGAGCTGGTT
GTCGCCCACGCCATCGCGGTATACGAGGATTCTCTGCGGCAGGATGTCGT
AGCGCTTCTTGAAGTCCTCGAGCGCCAGGTTGAAGTTCTTGCCGAGCGTC
TCGTGGAACTCCTGGCGGCCCTTGGGCGAGTTCACGAAGCTCATGTACTG
GGTGAACGTGCTGTTGATGGAGAACACGGACGCCTGGATCGACTTCTTAC
TCGACTTGTTGTGGTACGTGTCTAGACCCACGATCATAGTCGGGCGCAGT
TTGATCTCCACCGTCCACGGGTCGTATCCGAATTTGGCGAAGATTTGCAT
GACGGTCTTGCTCGACACGACCTTTCTTCTCTTATCGTTTCTGTTCGTGC
CATTCCTTGTGGTGACGCACTGCGTGAGCAGACCAGTGCTCATCGTGAAC
GACTTTACCTTCGCGTACGCTCGGTCATCCGGAACGAAAACGAGCGCCAT
CTTGGCGCAGCCGCTGCCAGATCTCGCCGAGTCATTTAGGCACCGCTCGA
TGTCGTTGGGACCACACGTGTTCACCTTTCCGATACGCGCGTCGATTCTC
ATCTGTCGCAGCTCCTGCTCGACATCTCCCATGAAGTTCTTGTACTGGAA
ATCGTTCCTGTCGACAATCACGACATCAATTTCGTGTTTTCGGTCCCGCT
TGATATCAAATTGAATTCTTCCGAATTTCCAGTCGTCGCCCATTTTCTCG
TTGATTTTGTTGCCGCCACTTATTACATCGCACGCCGGTAACTCTCGACC
CTCGATCTCCAGTGGTTTATTGTCGATCTTGAACTGCCATTTATCGATCA
ATCTGCCAGCATTGTCGTTCTGCTTCAGCCAGTTGCAAAAAGCGGGAATA
TCCTCCAGTCGCTCCCTCGGCTCCCGCTTCAACACTCCACCGAGATTCTT
CTGCAAATCCATATTCGCTTTCTCCTGGTCAGAGAATCCACACAAGAAGC
ACAATTCTCCGGGAATATTCAACGTCATATCTTTCTCCTCAGGCGCTTCT
CGTTCTCGTTCTTTCGGCGCTTCTTCTGCCACGACTTCAGCTTCACCACC
CTCGGCCGGTTTCTCCCCACGTGGTTTCCTCGGTCCTCGTCTCATGGGTT
TCTTGACACGCGTCAAGACAAACGGCTGCTCGCCTCCCGTCAATCGTATA
TTGTATCGCTCTTTGAAGTATTCCGCATATGACAACGTTCTTCCTCCCAT
TTCAAACTTCTCATCGACGCTCATTTCTTTAACTTCACTGATCCGGTAAG
TCTTATTGTTGTATTTGGTGATGATATCACGCCCGATCAATTGATCGATC
GAGCGACGATTATACGCTTTCATCACTGAATTGTCGTTGAGAACGCGATT
GATCCTTTCGATATAGAGTAACGTCGTCAATTCTCCGGTGGGTTTCGTAC
CTCGTTGAAGAGTCGTTCCAAATCCACCCAAAACTTTGAAACTGTTTGTC
TCGAAAAACGTCGGTCCGCAATTTCGTGGAACTTCGTCTTTGGTGATGTT
CGGCGACAGGAAATACCCTTTTCCGATGCGTTCTTGACCCATCATGACCT
GGAGATTGTTGAGGAGAACATTGATCATTTGGTAGTACTCTTCGGTCTCG
GGGATGATTTGTGCCACTAATCTCAGTGTCATTTTCTTGTCTTCGTAATT
GAACTCTTGGATATCGGTCTCTCCGTGCCATTTTTCACTCGTGAACAAGC
GGCGACCATCGAAACAGAACGCACCCGGTAACTTGTTCTCCTGGCAAATT
CGGACGATCAATTGCAATTTGGCTTTCGGGGGTAATCCCATCGTTGAGAA
AACACTGTCGTACATCATATACTTCTCAGATCGCATGATCGAGAATTTCG
TGAATGACGATTGCAATCGGACAACGCGACCGAGATTTCCAGTTTTCTCC
GTGATGTCCGTTGGGGCGAGATTCGGTTCGACGATTCGAAACGTTCTTCG
CAGACCTCCTCTGGTGCCACGACCTTTCGTTTCGCTTCCGTTTTCGTGTT
TGATCATTTTCTTTCCGTTGTTTTCATCCATGTTTTTTTTTGTAATGTCA
ATTTAAACAAATTTTAAATTAATGTTTTAGGTAATATAATTAAAGAATAT
GTATATACATATTCTTTAATTATATTACCTAAAACATTAATTTAAAATTT
GTTTAAATTGACATTACAAAAAAAAACATGGATGAAAACAACGGAAAGAA
AATGATCAAACACGAAAACGGAAGCGAAACGAAAGGTCGTGGCACCAGAG
GAGGTCTGCGAAGAACGTTTCGAATCGTCGAACCGAATCTCGCCCCAACG
GACATCACGGAGAAAACTGGAAATCTCGGTCGCGTTGTCCGATTGCAATC
GTCATTCACGAAATTCTCGATCATGCGATCTGAGAAGTATATGATGTACG
ACAGTGTTTTCTCAACGATGGGATTACCCCCGAAAGCCAAATTGCAATTG
ATCGTCCGAATTTGCCAGGAGAACAAGTTACCGGGTGCGTTCTGTTTCGA
TGGTCGCCGCTTGTTCACGAGTGAAAAATGGCACGGAGAGACCGATATCC
AAGAGTTCAATTACGAAGACAAGAAAATGACACTGAGATTAGTGGCACAA
ATCATCCCCGAGACCGAAGAGTACTACCAAATGATCAATGTTCTCCTCAA
CAATCTCCAGGTCATGATGGGTCAAGAACGCATCGGAAAAGGGTATTTCC
TGTCGCCGAACATCACCAAAGACGAAGTTCCACGAAATTGCGGACCGACG
TTTTTCGAGACAAACAGTTTCAAAGTTTTGGGTGGATTTGGAACGACTCT
TCAACGAGGTACGAAACCCACCGGAGAATTGACGACGTTACTCTATATCG
AAAGGATCAATCGCGTTCTCAACGACAATTCAGTGATGAAAGCGTATAAT
CGTCGCTCGATCGATCAATTGATCGGGCGTGATATCATCACCAAATACAA
CAATAAGACTTACCGGATCAGTGAAGTTAAAGAAATGAGCGTCGATGAGA
AGTTTGAAATGGGAGGAAGAACGTTGTCATATGCGGAATACTTCAAAGAG
CGATACAATATACGATTGACGGGAGGCGAGCAGCCGTTTGTCTTGACGCG
TGTCAAGAAACCCATGAGACGAGGACCGAGGAAACCACGTGGGGAGAAAC
CGGCCGAGGGTGGTGAAGCTGAAGTCGTGGCAGAAGAAGCGCCGAAAGAA
CGAGAACGAGAAGCGCCTGAGGAGAAAGATATGACGTTGAATATTCCCGG
AGAATTGTGCTTCTTGTGTGGATTCTCTGACCAGGAGAAAGCGAATATGG
ATTTGCAGAAGAATCTCGGTGGAGTGTTGAAGCGGGAGCCGAGGGAGCGA
CTGGAGGATATTCCCGCTTTTTGCAACTGGCTGAAGCAGAACGACAATGC
TGGCAGATTGATCGATAAATGGCAGTTCAAGATCGACAATAAACCACTGG
AGATCGAGGGTCGAGAGTTACCGGCGTGCGATGTAATAAGTGGCGGCAAC
AAAATCAACGAGAAAATGGGCGACGACTGGAAATTCGGAAGAATTCAATT
TGATATCAAGCGGGACCGAAAACACGAAATTGATGTCGTGATTGTCGACA
GGAACGATTTCCAGTACAAGAACTTCATGGGAGATGTCGAGCAGGAGCTG
CGACAGATGAGAATCGACGCGCGTATCGGAAAGGTGAACACGTGTGGTCC
CAACGACATCGAGCGGTGCCTAAATGACTCGGCGAGATCTGGCAGCGGCT
GCGCCAAGATGGCGCTCGTTTTCGTTCCGGATGACCGAGCGTACGCGAAG
GTAAAGTCGTTCACGATGAGCACTGGTCTGCTCACGCAGTGCGTCACCAC
AAGGAATGGCACGAACAGAAACGATAAGAGAAGAAAGGTCGTGTCGAGCA
AGACCGTCATGCAAATCTTCGCCAAATTCGGATACGACCCGTGGACGGTG
GAGATCAAACTGCGCCCGACTATGATCGTGGGTCTAGACACGTACCACAA
CAAGTCGAGTAAGAAGTCGATCCAGGCGTCCGTGTTCTCCATCAACAGCA
CGTTCACCCAGTACATGAGCTTCGTGAACTCGCCCAAGGGCCGCCAGGAG
TTCCACGAGACGCTCGGCAAGAACTTCAACCTGGCGCTCGAGGACTTCAA
GAAGCGCTACGACATCCTGCCGCAGAGAATCCTCGTATACCGCGATGGCG
TGGGCGACAACCAGCTCTGGTTCACCAAGCAGTTCGAGGTGGACGCGATG
AAGCCGCTAGTCGAGAACATCTACAAGAACAACGGGTTCCCGGTGCCGCA
GATCATCTACGTGATCGTCAAGAAGCGCATCACGACCAAGCTCTTCAACC
GCGGCAACAACCCCAACCCGGGCACAGTCGTCGACAAGGAGATCGTCAAG
CCCAACTTCTATGAATTCTTCCTCGTGTCGCAGCGCACGACGAAAGGGAC
AGCGACTCCCTCAAACTACAACGTGCTCGAGGACACGCGGCTGCTCACCA
AGAAGGGCACGATGGACCCCATGGCGCCCAACGAGCTCCAGAAGATCACG
TACGCTCTGACTCATCTGTACTTCAACTGGATGGGAACGATCCGCGTGCC
TGTGCCCGTCCACTACGCGCACCGCCTGGCAGAGCTCGTCGGCAAGGTGC
ACAAGGGCTCCGCGCCAGCCGTCATCAACGAGAGAATCAGGAACCGCCTC
TTTTACTTGTAGAAGGTCGCGTGAGACAAGTGGAGCCGGATAAACAATTA
ATATTTATTAGAATACACTTATACAATATTATATTAGCAATACTTAATTA
CATTAATAATTCATTCACTTTAGTAATTCGAAATTAATTAATCAATAATT
ATTAATTTATCGTAATGTTCCAATAATTATTATTAATTCTATTATTATTA
ATGCTCCTTCTTACTTTGTCGTTGTTGCGTGTTGATTACCATTATTATAA
TCTTTATCATGCTGATCGAATTCGTTATCGTTTCTGCGAGTTTCTCGAAC
AGCAGTTTTGATTGATCGATGTGGTAGTGCGTGTGGTGCTGCTCTTGTTG
CTGTTGTAGTCGTGATTGTTCTCTCGATGAGCGTTTCTGTTGTCCAACTG
CAATCGAAAAAATTTACGTTTTCCGAATTGAAAATTATAATATATGGAAC
TTTTTGTAAAATTTTTATGTATTATTAAGTAAATTTTTATTGTTATTTTT
CTCTTATCATAATAAATATATATTAATAAATTAGTTCGTTAATATTCGCT
CTTTGTTATCATCTTTTATCACGGTTTTCTTAGGTGAATTTTTCTGTGTT
TCTTGATTAGTTTTAATACGTTGCTAATTGTGAATATCGTGCGAGCAACG
CTGTAAAATTATTGATTTGTTTAGTTGTTTGGGTTAAATCCTTTTATTTC
GTTCTCTATTAATTTAAATTGATTATCTGCAGTAATCTGTATTCAATGAT
TGTTAGTCAACTGTACATTAATAGTCATACAACTTATTGAATGATATTTT
GTGATTTGTTATATTATATGTATGAATAATAAATATAATTTAATGTCTTC
AAAAAAAA

Design Primers for Ddo_024742

back to top

protein sequence

>Ddo_024742-protein ID=Ddo_024742-protein|Name=Ddo_024742|organism=Dugesia dorotocephala|type=polypeptide|length=845bp
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
back to top

coding sequence

>Ddo_024742.3528.6062 ID=Ddo_024742.3528.6062|Name=Ddo_024742.3528.6062|organism=Dugesia dorotocephala|type=CDS|length=2535bp
ATGGATGAAAACAACGGAAAGAAAATGATCAAACACGAAAACGGAAGCGA
AACGAAAGGTCGTGGCACCAGAGGAGGTCTGCGAAGAACGTTTCGAATCG
TCGAACCGAATCTCGCCCCAACGGACATCACGGAGAAAACTGGAAATCTC
GGTCGCGTTGTCCGATTGCAATCGTCATTCACGAAATTCTCGATCATGCG
ATCTGAGAAGTATATGATGTACGACAGTGTTTTCTCAACGATGGGATTAC
CCCCGAAAGCCAAATTGCAATTGATCGTCCGAATTTGCCAGGAGAACAAG
TTACCGGGTGCGTTCTGTTTCGATGGTCGCCGCTTGTTCACGAGTGAAAA
ATGGCACGGAGAGACCGATATCCAAGAGTTCAATTACGAAGACAAGAAAA
TGACACTGAGATTAGTGGCACAAATCATCCCCGAGACCGAAGAGTACTAC
CAAATGATCAATGTTCTCCTCAACAATCTCCAGGTCATGATGGGTCAAGA
ACGCATCGGAAAAGGGTATTTCCTGTCGCCGAACATCACCAAAGACGAAG
TTCCACGAAATTGCGGACCGACGTTTTTCGAGACAAACAGTTTCAAAGTT
TTGGGTGGATTTGGAACGACTCTTCAACGAGGTACGAAACCCACCGGAGA
ATTGACGACGTTACTCTATATCGAAAGGATCAATCGCGTTCTCAACGACA
ATTCAGTGATGAAAGCGTATAATCGTCGCTCGATCGATCAATTGATCGGG
CGTGATATCATCACCAAATACAACAATAAGACTTACCGGATCAGTGAAGT
TAAAGAAATGAGCGTCGATGAGAAGTTTGAAATGGGAGGAAGAACGTTGT
CATATGCGGAATACTTCAAAGAGCGATACAATATACGATTGACGGGAGGC
GAGCAGCCGTTTGTCTTGACGCGTGTCAAGAAACCCATGAGACGAGGACC
GAGGAAACCACGTGGGGAGAAACCGGCCGAGGGTGGTGAAGCTGAAGTCG
TGGCAGAAGAAGCGCCGAAAGAACGAGAACGAGAAGCGCCTGAGGAGAAA
GATATGACGTTGAATATTCCCGGAGAATTGTGCTTCTTGTGTGGATTCTC
TGACCAGGAGAAAGCGAATATGGATTTGCAGAAGAATCTCGGTGGAGTGT
TGAAGCGGGAGCCGAGGGAGCGACTGGAGGATATTCCCGCTTTTTGCAAC
TGGCTGAAGCAGAACGACAATGCTGGCAGATTGATCGATAAATGGCAGTT
CAAGATCGACAATAAACCACTGGAGATCGAGGGTCGAGAGTTACCGGCGT
GCGATGTAATAAGTGGCGGCAACAAAATCAACGAGAAAATGGGCGACGAC
TGGAAATTCGGAAGAATTCAATTTGATATCAAGCGGGACCGAAAACACGA
AATTGATGTCGTGATTGTCGACAGGAACGATTTCCAGTACAAGAACTTCA
TGGGAGATGTCGAGCAGGAGCTGCGACAGATGAGAATCGACGCGCGTATC
GGAAAGGTGAACACGTGTGGTCCCAACGACATCGAGCGGTGCCTAAATGA
CTCGGCGAGATCTGGCAGCGGCTGCGCCAAGATGGCGCTCGTTTTCGTTC
CGGATGACCGAGCGTACGCGAAGGTAAAGTCGTTCACGATGAGCACTGGT
CTGCTCACGCAGTGCGTCACCACAAGGAATGGCACGAACAGAAACGATAA
GAGAAGAAAGGTCGTGTCGAGCAAGACCGTCATGCAAATCTTCGCCAAAT
TCGGATACGACCCGTGGACGGTGGAGATCAAACTGCGCCCGACTATGATC
GTGGGTCTAGACACGTACCACAACAAGTCGAGTAAGAAGTCGATCCAGGC
GTCCGTGTTCTCCATCAACAGCACGTTCACCCAGTACATGAGCTTCGTGA
ACTCGCCCAAGGGCCGCCAGGAGTTCCACGAGACGCTCGGCAAGAACTTC
AACCTGGCGCTCGAGGACTTCAAGAAGCGCTACGACATCCTGCCGCAGAG
AATCCTCGTATACCGCGATGGCGTGGGCGACAACCAGCTCTGGTTCACCA
AGCAGTTCGAGGTGGACGCGATGAAGCCGCTAGTCGAGAACATCTACAAG
AACAACGGGTTCCCGGTGCCGCAGATCATCTACGTGATCGTCAAGAAGCG
CATCACGACCAAGCTCTTCAACCGCGGCAACAACCCCAACCCGGGCACAG
TCGTCGACAAGGAGATCGTCAAGCCCAACTTCTATGAATTCTTCCTCGTG
TCGCAGCGCACGACGAAAGGGACAGCGACTCCCTCAAACTACAACGTGCT
CGAGGACACGCGGCTGCTCACCAAGAAGGGCACGATGGACCCCATGGCGC
CCAACGAGCTCCAGAAGATCACGTACGCTCTGACTCATCTGTACTTCAAC
TGGATGGGAACGATCCGCGTGCCTGTGCCCGTCCACTACGCGCACCGCCT
GGCAGAGCTCGTCGGCAAGGTGCACAAGGGCTCCGCGCCAGCCGTCATCA
ACGAGAGAATCAGGAACCGCCTCTTTTACTTGTAG
back to top
Gene Groups
Ddo_024742 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.