Ddo_024546, Ddo_024546 (mRNA) Dugesia dorotocephala

Overview
NameDdo_024546
Unique NameDdo_024546
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1063
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Homology
BLAST of Ddo_024546 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 174.096 bits (440), Expect = 9.637e-49
Identity = 106/291 (36.43%), Postives = 165/291 (56.70%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYID 874
            +I YYQWVPF+L L+ ++FY+P I+W+L+ + ++G  ++ L+  A  +     E R   +  +A  +E+ L        G          K+ N  + ++  G  +   Y  +K LY VN+ GQ+ ++  FLG N S   +G  VLN+++NG+ W ++G FPRVT C   E++ LG  +++  QC L INM NEKI++FLWFW FL+   T  S+  W     + S + +FV K+L   + Y   D QSL  F+  FLR DGVFL+RM+  +AG+L   ++ + LW  Y D
Sbjct:   98 QIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRL-------KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG-NRS-KWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCD 377          
BLAST of Ddo_024546 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 171.4 bits (433), Expect = 9.813e-47
Identity = 105/290 (36.21%), Postives = 169/290 (58.28%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFL-LMKDKYTR--SDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWE 862
            +I YYQWVPFIL ++ ++FY+P I+W+ + Y  +G +L+ L+  A  A     E +   V  MAR ++D +      RQG        +    N C   +H G ++ + Y  +K LY  NV  Q  ++   LG N+   A+G+++L ++++   W QTG+FPRVT C   E+R LG  +++  QC L INM NEKI++FLWFW    G++T  +   W L + + S    FV+K+L ++ D   +  +D  +L  F + FLR DGVF++RMI  +AG+L++S+++  LW+
Sbjct:  216 QIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Ddo_024546 vs. uniprot
Match: gi|67460980|sp|O01634|INX12_CAEEL (RecName: Full=Innexin-12; AltName: Full=Protein opu-12)

HSP 1 Score: 157.532 bits (397), Expect = 2.250e-42
Identity = 96/286 (33.57%), Postives = 157/286 (54.90%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLW 859
            +I YYQWVPFIL LQ ++FY P +IW+L  Y   G ++  L N  + A     E RKG +  +A  I     +HR+    +++  + R              G+ ++  Y  MK L+ +NV  Q +++K+ LG +     +G  V +++ +G  W +TG FPRVT C   E+R+L   +K+  QC L INM NEKI+V LW+W+  + V+T  +   WF R +  S   +F++ ++   D   ++++  L  F+SEFL  D VF++R+I +N G     +++R +W
Sbjct:  108 QIGYYQWVPFILALQAMLFYFPVVIWRLF-YGMAGQNVTSLCNTCT-ATEGNEESRKGTITTIAGYISQK--RHRNLIVKQLSGFQNRA------------NGSAVITSYLFMKALFLINVLFQFVLLKRMLGVDSYF--WGAEVTSDLWSGNEWPETGNFPRVTMCEY-EVRNLDNIHKHSVQCVLMINMFNEKIFVALWWWLCFLTVVTITNTIYWFWRASGTSVSKNFIRPYVEDIDPKVKNNRGKLQQFVSEFLSPDTVFILRLIELNNGKTPVVELIRDMW 374          
BLAST of Ddo_024546 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 155.221 bits (391), Expect = 3.055e-41
Identity = 114/336 (33.93%), Postives = 179/336 (53.27%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKA-ANSAPEDRKGIVDKMARTIEDML-FQHRDYR---QGKMADIRRRMYKMCNFCVFSKHM-GTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKD-----KYTRSDKQS---------------LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDV 931
            +I YYQWVPFIL  + +MF +P I W+L C  ++G +++ LIN A  A A     DR+  V+ +     D L  Q  + R   +G +A I+           FS+ + G  + + Y   K LY VNV  Q  I+   L  +E +  FG+ VL+++  G+ W +TG FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W  ++ +IT  S   W     + S +  +V KF+ + +     K  + +K +               LD F+S+FL+ DG+ ++RMI  +AGD+I   +VR LW+    +Y+  ++R F  + +  DV
Sbjct:   98 QIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF-FGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQ----EYRERNWREFEEHEEMKDV 415          
BLAST of Ddo_024546 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 154.066 bits (388), Expect = 8.101e-41
Identity = 110/336 (32.74%), Postives = 179/336 (53.27%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEA--SKAANSAPEDRKGIVDKMARTIEDMLFQHRDYR---QGKMADIRRRMYKMCNFCVFSKHM-GTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKD-----KYTRSDKQS---------------LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDV 931
            +I YYQWVPFIL  + +MF +P I W+L C  ++G +++ LIN A   +A   A + +K +       ++++  Q  + R   +G +A I+           FS+ + G  L + +   K LY +NV  Q LI+   L  +     FG+ VLN++  G+ W +TG FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W  ++ +IT  S   W     + S +  +V KF+ + +     K  + +K +               LD F+S+FL+ DGV ++RMI  +AGD+I   +VR LW+    +++  ++R F  + +  DV
Sbjct:  114 QIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQ----EFRERNWREFEEHEEMKDV 431          
BLAST of Ddo_024546 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 475.322 bits (1222), Expect = 4.533e-166
Identity = 223/337 (66.17%), Postives = 282/337 (83.68%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV* 1012
            RI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK+GT+LE ++N+A+ A N+ P +RK  ++++ARTIEDMLFQHRDYRQG  A +RR++Y  CNFCVFSKHMGTWL+L Y ++K LY +NV GQL IMKKFLGFN + ++FGYTVL+NM++G+ WHQTGIFPRVTYCY+  I+H+G +NKYVAQCALP+NMLNEKIYVFLWFW+ LVG++TAISIP+WF R+A LS RS F+K+FL+M   Y RSDK  +++FI EFLRHDGVFL+RM+FINAGD+IT+DIV RL EIY + YKH+DFRN++ Y K  D    + R+     S++SI+KEP+E+FV*
Sbjct:  104 RINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV* 440          
BLAST of Ddo_024546 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 401.749 bits (1031), Expect = 3.064e-137
Identity = 190/324 (58.64%), Postives = 252/324 (77.78%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDVGTAIRRSGRQPDSN 973
            RITYYQWVPFILGLQCI+FYIP+++W++ICYNK GT+LE LI  A+ ++   P +RK +++ + R IED+L+QHRDYRQGKMA  RRR+Y+ CNFCVFSKH+GTWLV  YF +KCLY +NV GQL +MK FLGFN S+++FGYT+LN++++G+ WH+T  FPRV+YCY  +I+HLGA N YVAQC LP+NMLNEKIY+FLWFWV LVG+IT +SI  W +RI  LS RS F KK L M   Y RS+  +++HFI E+LR+DG+FLIRMI+IN+GD++ ++I+  LWE Y ++Y + DF N+++Y K          SGRQ D +
Sbjct:  104 RITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEK--------LISGRQDDKS 419          
BLAST of Ddo_024546 vs. Smed Unigenes AA
Match: SMU15031907 (SmedSxlregen_c71685_g2_i2|m.13384|m.29837)

HSP 1 Score: 310.071 bits (793), Expect = 1.395e-102
Identity = 155/294 (52.72%), Postives = 213/294 (72.45%), Query Frame = 2
Query:   11 YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLM----KDKYTRSDKQSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQY 880
            YYQWVPF+L LQCIMFYIPRIIWQ+ CYN+TGTD++ LI  A+ A +S+ E RK +V  +A+++E +LFQHRD+R  K+A+ RR++YK CNF V SK +G WLV  YF++K +Y  N  GQL++M+ FLG + + + FG  V  N++ GQ W  T IFPRV YCY+ +I  LG+ N  VAQC LP+NMLNE+IY+FLW+WV +V ++T ISIP WF+RI L  +R  FV+K+L +     +K  +  K  L  F  +FLRHDG FL++MI +NAGD+IT++IV +LW I+  +Y
Sbjct:    2 YYQWVPFVLSLQCIMFYIPRIIWQMFCYNRTGTDIQHLITSANHAVHSSEEARKKMVIHLAKSLEQLLFQHRDFRNDKIANFRRKVYKHCNFLVISKRLGNWLVFSYFVLKIIYLSNAIGQLVLMQHFLGLDSNYSFFGIEVARNILRGQDWQTTLIFPRVGYCYV-KIDMLGSKNAVVAQCVLPVNMLNERIYLFLWYWVVVVILLTGISIPTWFIRIMLQKSRHGFVRKYLKLGEEESNKKLKRYKYLLKKFERDFLRHDGHFLLQMICLNAGDIITAEIVCQLWRIFKTKY 294          
BLAST of Ddo_024546 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 311.997 bits (798), Expect = 3.730e-102
Identity = 153/312 (49.04%), Postives = 227/312 (72.76%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNE-SITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQS--LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDD 928
            ++ YYQWVPF+LGLQCIMFY+P+++WQ+ICYN+TGTD++ L+  A++A +S+ E R  +V  +++T+E +L+QHRD+R GK+A  RR+++    F + SK +GTWLV  Y ++K  Y  N F QL+IM+KFLGF++ ++  FG  V NN+ +G  W  T IFPRV+YC++ ++ HLG  N  VAQC LP+NMLNE+IY FLW W+ +V  +T +SIP+W LRI  +  R HF+++FL++ ++ T+  K++  L  F S+FLRHDG+FL++MI +NAGD+ITS+IV +LW IY   Y +   RNF + G  +D
Sbjct:  103 KMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVN---RNFLNDGSDED 410          
BLAST of Ddo_024546 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 302.368 bits (773), Expect = 5.083e-98
Identity = 156/334 (46.71%), Postives = 219/334 (65.57%), Query Frame = 2
Query:    2 RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQS--LDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRNFSHYGKPDDV--GTAIRRSGRQPDSNESIEKE 991
            +I YYQWVPF+L LQ IMFYIPR+IWQ+ CYN TGTD+  LI  A++A +S+ E R  +V+ +A+TIE ML+QHRD R G++A  RR +YK+C FC+ SK  GT L+  YFI+K LY  N   QL  MK FLG NE+   FG+ ++ N++NGQ W  T +FPRV YCY+  ++++G +N  VAQC LP+NMLNEKI+ FLW W+F   ++  ISI +W  R ++   R  F+ +FL +  +    D++   +  F  +FLR+DGVFL++MI +NAGD++ +DIV +LW+I+  QY +   RNF   G  DD   G  + R      S  S +K 
Sbjct:  102 KILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYAN---RNFLSDGSDDDENHGRTLIRLDNNNHSKPSFDKS 431          
BLAST of Ddo_024546 vs. RefSeq Drosophila melanogaster
Match: gi|221500180|ref|NP_001138222.1| (shaking B, isoform F [Drosophila melanogaster])

HSP 1 Score: 70.0922 bits (170), Expect = 2.555e-13
Identity = 55/197 (27.92%), Postives = 83/197 (42.13%), Query Frame = 2
Query:   11 YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 592
            YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   29 YYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYH-------------------------NWWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 189          
BLAST of Ddo_024546 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 70.4774 bits (171), Expect = 4.514e-13
Identity = 55/197 (27.92%), Postives = 83/197 (42.13%), Query Frame = 2
Query:   11 YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 592
            YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:  114 YYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Ddo_024546 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 70.4774 bits (171), Expect = 4.514e-13
Identity = 55/197 (27.92%), Postives = 83/197 (42.13%), Query Frame = 2
Query:   11 YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 592
            YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:  114 YYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Ddo_024546 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 70.4774 bits (171), Expect = 4.514e-13
Identity = 55/197 (27.92%), Postives = 83/197 (42.13%), Query Frame = 2
Query:   11 YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 592
            YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:  114 YYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Ddo_024546 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 70.0922 bits (170), Expect = 4.949e-13
Identity = 55/197 (27.92%), Postives = 83/197 (42.13%), Query Frame = 2
Query:   11 YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMVNGQHWHQTG---IFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY 592
            YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      S  E       +  + + D L+++  Y                           W    Y++ + L  +NV GQ+ +M +F  F+     FG  V++ M   Q         IFPR+T C   +    G   K+ A C LP+N++NEKIY
Sbjct:   98 YYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAE-----KKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 258          
The following BLAST results are available for this feature:
BLAST of Ddo_024546 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL9.637e-4936.43RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL9.813e-4736.21RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|67460980|sp|O01634|INX12_CAEEL2.250e-4233.57RecName: Full=Innexin-12; AltName: Full=Protein op... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR3.055e-4133.93RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL8.101e-4132.74RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
back to top
BLAST of Ddo_024546 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008374.533e-16666.17Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006573.064e-13758.64Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150319071.395e-10252.72SmedSxlregen_c71685_g2_i2|m.13384|m.29837[more]
SMU150364823.730e-10249.04dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150331265.083e-9846.71SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
back to top
BLAST of Ddo_024546 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_024546 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221500180|ref|NP_001138222.1|2.555e-1327.92shaking B, isoform F [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|4.514e-1327.92shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|4.514e-1327.92shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|4.514e-1327.92shaking B, isoform I [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|4.949e-1327.92shaking B, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_024546 ID=Ddo_024546|Name=Ddo_024546|organism=Dugesia dorotocephala|type=mRNA|length=1063bp
AAGAATAACTTACTATCAATGGGTGCCATTCATCCTCGGGCTCCAGTGCA
TCATGTTCTATATTCCGAGGATCATCTGGCAGCTGATCTGCTACAACAAG
ACCGGCACTGACCTCGAATTCCTCATCAATGAGGCCAGCAAGGCCGCCAA
TAGTGCTCCGGAAGACCGAAAGGGCATCGTCGATAAGATGGCGAGAACTA
TCGAGGACATGCTGTTCCAGCACCGGGATTATCGGCAAGGAAAGATGGCG
GACATCCGCAGGAGAATGTACAAGATGTGCAACTTCTGCGTCTTTTCCAA
GCACATGGGCACCTGGCTCGTTTTATGCTACTTCATCATGAAGTGCCTCT
ATTGTGTCAATGTGTTTGGGCAACTACTCATCATGAAGAAGTTCCTCGGC
TTCAATGAGTCCATTACCGCTTTTGGGTACACGGTTCTCAACAATATGGT
CAACGGACAGCACTGGCACCAGACTGGGATATTCCCCAGAGTGACGTACT
GCTACTTGGGCGAGATCCGCCATCTCGGGGCCAGCAATAAGTACGTGGCC
CAGTGCGCACTGCCTATCAATATGCTCAACGAGAAGATATATGTCTTCCT
CTGGTTCTGGGTGTTCCTTGTGGGCGTCATAACCGCCATCAGCATCCCAG
TTTGGTTCCTCCGGATCGCACTTCTATCCAATCGAAGTCACTTCGTGAAG
AAGTTCCTCCTCATGAAGGACAAGTACACTAGGTCCGACAAGCAGTCTCT
TGATCACTTCATTAGCGAGTTCCTTCGGCACGACGGAGTGTTCCTAATCA
GGATGATCTTCATTAATGCCGGCGATCTGATCACGTCAGACATTGTGAGA
CGTCTCTGGGAGATCTACATCGACCAGTACAAGCACATCGACTTCAGGAA
CTTCTCCCACTATGGGAAGCCGGACGATGTTGGTACCGCTATACGACGGA
GTGGCAGGCAACCGGACTCCAACGAGTCCATTGAGAAAGAGCCCATAGAA
CACTTTGTGTGAGACAATGCCATTAGTGATTCATCGTACTTTAAAGTGCT
CAAATTATTGACT

Design Primers for Ddo_024546

back to top

protein sequence

>Ddo_024546-protein ID=Ddo_024546-protein|Name=Ddo_024546|organism=Dugesia dorotocephala|type=polypeptide|length=337bp
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
back to top

coding sequence

>Ddo_024546.2.1012 ID=Ddo_024546.2.1012|Name=Ddo_024546.2.1012|organism=Dugesia dorotocephala|type=CDS|length=1011bp
AGAATAACTTACTATCAATGGGTGCCATTCATCCTCGGGCTCCAGTGCAT
CATGTTCTATATTCCGAGGATCATCTGGCAGCTGATCTGCTACAACAAGA
CCGGCACTGACCTCGAATTCCTCATCAATGAGGCCAGCAAGGCCGCCAAT
AGTGCTCCGGAAGACCGAAAGGGCATCGTCGATAAGATGGCGAGAACTAT
CGAGGACATGCTGTTCCAGCACCGGGATTATCGGCAAGGAAAGATGGCGG
ACATCCGCAGGAGAATGTACAAGATGTGCAACTTCTGCGTCTTTTCCAAG
CACATGGGCACCTGGCTCGTTTTATGCTACTTCATCATGAAGTGCCTCTA
TTGTGTCAATGTGTTTGGGCAACTACTCATCATGAAGAAGTTCCTCGGCT
TCAATGAGTCCATTACCGCTTTTGGGTACACGGTTCTCAACAATATGGTC
AACGGACAGCACTGGCACCAGACTGGGATATTCCCCAGAGTGACGTACTG
CTACTTGGGCGAGATCCGCCATCTCGGGGCCAGCAATAAGTACGTGGCCC
AGTGCGCACTGCCTATCAATATGCTCAACGAGAAGATATATGTCTTCCTC
TGGTTCTGGGTGTTCCTTGTGGGCGTCATAACCGCCATCAGCATCCCAGT
TTGGTTCCTCCGGATCGCACTTCTATCCAATCGAAGTCACTTCGTGAAGA
AGTTCCTCCTCATGAAGGACAAGTACACTAGGTCCGACAAGCAGTCTCTT
GATCACTTCATTAGCGAGTTCCTTCGGCACGACGGAGTGTTCCTAATCAG
GATGATCTTCATTAATGCCGGCGATCTGATCACGTCAGACATTGTGAGAC
GTCTCTGGGAGATCTACATCGACCAGTACAAGCACATCGACTTCAGGAAC
TTCTCCCACTATGGGAAGCCGGACGATGTTGGTACCGCTATACGACGGAG
TGGCAGGCAACCGGACTCCAACGAGTCCATTGAGAAAGAGCCCATAGAAC
ACTTTGTGTGA
back to top
Gene Groups
Ddo_024546 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.