Ddo_019521, Ddo_019521 (mRNA) Dugesia dorotocephala

Overview
NameDdo_019521
Unique NameDdo_019521
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1716
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_019521 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 220.32 bits (560), Expect = 1.868e-62
Identity = 124/372 (33.33%), Postives = 216/372 (58.06%), Query Frame = 2
Query:  191 EDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTD-LDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRV--IGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELIS--QFVERFLRHDGIFILHIISLNAGDLVATDVVSELW 1291
            +D  DK ++ ++ TIL   +L++S KQY+   I C++P  AT TD ++ Y +NYCWV  T      E +P      ++    R++ YYQWVPF+L ++ +LFY+P I+W+ LLY  SGI+L+GLV     A     + +  T+  +A+ ++D      +   GHS+      ++    C R  G ++  LY  IK+LY  N + Q  L+   L  G++ ++  +G+++LKD++   +W++  MFPRVT C  + + ++   + +  QC L INM NEKIF+FLWFW +   I+T+ +   WI  M   ++   FV+++L++   +  +   + ++  +F   FLR DG+F+L +IS +AG+L++++++  LW
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP--ATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRN----RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLG-ANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLA--YGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498          
BLAST of Ddo_019521 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 214.157 bits (544), Expect = 1.364e-61
Identity = 118/371 (31.81%), Postives = 212/371 (57.14%), Query Frame = 2
Query:  191 EDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLED-MFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIY 1300
            +D  DK ++ ++  I+ V ++++S KQY+   I C++P   T   ++ Y +NYCWV  T     ++ +P    + ++    R++ YYQWVPFVL L+ +LFY+P I+W+ L +  SGI ++ LV     +     + R   ++ +A  +E+ + ++ +V+  ++  +L     L+ C+R +G  +  LY  +K+LY  N + QI L+ TFL       S ++G  +L D+++G++W+E+  FPRVT C  + + ++   + +  QC L INM NEKIF+FLWFW   +   T+ S+  WI      +++ +FV ++L     Y K    + + +FV  FLR DG+F+L +++ +AG+L   ++   LW+ Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN----RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLN----LIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGY-KMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Ddo_019521 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 190.274 bits (482), Expect = 1.872e-52
Identity = 110/367 (29.97%), Postives = 191/367 (52.04%), Query Frame = 2
Query:  191 EDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELW 1291
            +DA D+ S++ + T+L   S+++S KQY+ + I C++P+   G   + Y ++YC++  T        +P   +  Q A+    + YYQWVP VL +Q  +FYLP  IW +L Y   G+D   ++       +Q  + R + + ++   + D+   R    + +F   R    L       G     LY  IKL+YL N   Q +++  FL   T      +G+    D+ +G++W ++ +FPRVT C   ++  +A  + Y  QC L INM NEKI++F+WFW V VLI T I+    I R++F + R ++++  L    +  K++   +I+ F    L+ DG+ ++  I  +AG +V  ++  EL+
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGL-------GSMTSMLYICIKLMYLANVFVQFIILNKFLGNETF----LWGFHTFADLYAGREWQDSGVFPRVTLCDF-SVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDE-KAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF 368          
BLAST of Ddo_019521 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 189.889 bits (481), Expect = 4.384e-52
Identity = 125/393 (31.81%), Postives = 201/393 (51.15%), Query Frame = 2
Query:  185 GVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIG-DHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSR-RTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCS--YSKEKHHE-----------------LISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIY 1300
            G +DA D+ ++ ++  IL VC L+IS KQY    I C++   +  + ++ YI++YCW+  T      E +P        A  E+++ YYQWVPF+L  + ++F LP I W+   +  SG++++ L+ +   A   +    R++ +E +     D    +   G  +    R  +A +  SR  +G  +  +Y F KLLY  N + Q  ++   LK   S    FFG+ +L DI +G+ W E   FPRVT C  + +  +A  N Y  QC L IN++NEK+F FLW W + + I+T  S   WI      +++ D+V +F++I  S  Y K +  E                 L+  FV  FL+ DGI +L +IS +AGD++   +V  LW  Y
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRES-MEEYIESYCWIQNTYWIPMYENVPDD----HTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIR---ARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK---SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEY 398          
BLAST of Ddo_019521 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 187.963 bits (476), Expect = 3.144e-51
Identity = 122/390 (31.28%), Postives = 199/390 (51.03%), Query Frame = 2
Query:  185 GVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQI-GDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSR-RTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHE-------------------LISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELW 1291
            G +DA D+ ++ ++  IL VC L+IS KQY    I C++   +  + ++ YI++YCW+  T      E +P        A  E+++ YYQWVPF+L  + ++F LP I W+   +  SG++++ L+ +       +    R++ +E +     D    +   G  +    R  +A +  SR  +G  L  L+ F KLLY  N + Q L++   LK   S    FFG+ +L DI +G+ W E   FPRVT C  + +  +A  N Y  QC L IN++NEK+F FLW W + + I+T  S   WI      +++ D+V +F++I  S   +K  +                   L+  FV  FL+ DG+ +L +IS +AGD++   +V  LW
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRES-MEEYIESYCWIQNTYWIPMYENVPDD----HTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIR---ARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK---SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLW 411          
BLAST of Ddo_019521 vs. Smed Unigenes AA
Match: SMU15003649 (SmedAsxldir_c102510_g2_i2|m.54904|m.29219)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 310/417 (74.34%), Postives = 367/417 (88.01%), Query Frame = 2
Query:  134 MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSRKPGISTSNKEKEQTFV* 1384
            MESL+ +FS+FNVEKY+GVED ADKASFLFSV ILVVC++I+STKQYI  +I+CYIP++ TG  L+ YI+NYCW HGTIPFR NETLP   K W  ADF+RRLNYYQWVPFVLGLQGVLFYLPR+IWK ++YNLSG DLEGLVVS +KA+NQ+G+ RKETI QVAKCLED+FLQRRV+GH+KFP+LRQKM+L+CC RRTGVF +SLY  IKLLYLTNAICQI+LMQ FLK G SK++  FGWTILKDILSGKQW++NL+FPRV+FC+I +I+ V  KNH+ AQC LPINMLNEKI+IFLWFWTV VL LTIISIPLW+ RMTF  KRKDF+KRFLKIK +Y+K+K + LISQFVE+FLRHDGIFILHIISLNAGDL+ATD+VSELW+IY KYY+++DF RK  IS+SN++ +QTFV*
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKN-LISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDF-RKKYISSSNEKSKQTFV* 415          
BLAST of Ddo_019521 vs. Smed Unigenes AA
Match: SMU15003648 (SmedAsxldir_c102510_g2_i1|m.54901|m.45535)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 309/417 (74.10%), Postives = 366/417 (87.77%), Query Frame = 2
Query:  134 MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSRKPGISTSNKEKEQTFV* 1384
            ME+ L+QF++F   KY+G+EDAADKASFLFSV ILVVCS+I+STKQYI  DISCYIPV+ +G DLD Y+KNYCWVHGTIPF ANETLP T  +W  AD  R++NYYQWVPFVLGLQGVLFYLPR+IWK ++YNLSG DLEGLVVS +KA+NQ+G+ RKETI QVAKCLED+FLQRRV+GH+KFP+LRQKM+L+CC RRTGVF +SLY  IKLLYLTNAICQI+LMQ FLK G SK++  FGWTILKDILSGKQW++NL+FPRV+FC+I +I+ V  KNH+ AQC LPINMLNEKI+IFLWFWTV VL LTIISIPLW+ RMTF  KRKDF+KRFLKIK +Y+K+K + LISQFVE+FLRHDGIFILHIISLNAGDL+ATD+VSELW+IY KYY+++DF RK  IS+SN++ +QTFV*
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKN-LISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDF-RKKYISSSNEKSKQTFV* 415          
BLAST of Ddo_019521 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 384.8 bits (987), Expect = 2.320e-127
Identity = 179/401 (44.64%), Postives = 260/401 (64.84%), Query Frame = 2
Query:  137 ESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVC--C--SRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDF 1327
            E  L     F +  Y+G+ED ADK SFLFSVT+L++  ++++ K Y+   ++CY      G++ ++Y++NYCWVHGTI F   E +P     W  AD  RR+NYYQWVPF+LGLQ ++FY+P+IIW+ + YN SG +LE +V     A N     RK+ IE++A+ +EDM  Q R      F  LR+K+   C  C  S+  G +L+  Y  IK LY  N I Q+ +M+ FL  G +  +  FG+T+L +++SGK+W +  +FPRVT+CY+ NI  V   N Y AQC LP+NMLNEKI++FLWFW V V I+T ISIPLW  RM FL++R  F+KRFL +  +Y +     +I+ F+E FLRHDG+F++ ++ +NAGD++  D+V+ L +IY + Y  +DF
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSD-KPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDF 401          
BLAST of Ddo_019521 vs. Smed Unigenes AA
Match: SMU15000918 (Asxlregen_comp60865_c0_seq1|m.9650|m.1056)

HSP 1 Score: 381.333 bits (978), Expect = 2.923e-126
Identity = 194/397 (48.87%), Postives = 273/397 (68.77%), Query Frame = 2
Query:  179 YIGVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDM-FLQRRVIGHSKFPILRQ---KMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSRK--PGIST 1351
            ++G+ED ADK SF  S +IL++ +L+I+ K Y++  I+CYIP+  +G D D ++K+YCWVHGTIP + N  LP   + W+  D   R+NYYQWVPFVL LQG+LFYLPRIIW+ + YNLSG DLEGLV     A+NQ G  + ET++Q+A  LE++ F  R++  HSK PI+ +     + +C  +R+G  L + Y FIK+LY+ NA  Q+ LMQ FL  G    S  FG+ +LK+IL G++W++ ++FPRVT+CY+ NI  VA KN+Y AQC LPINMLNEKI+IFLWFWTV V+  T IS+  WI R+T  + +  F+K+FL+I+  Y+ E    ++  F   FLR DG+FIL + S+NAGDL+  D+V+ LW+IY + + E +FS+   PG  T
Sbjct:   18 FVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSK-PIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTS--FGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDED-CSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDET 408          
BLAST of Ddo_019521 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 358.992 bits (920), Expect = 2.167e-117
Identity = 171/420 (40.71%), Postives = 265/420 (63.10%), Query Frame = 2
Query:  137 ESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVC--C--SRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSRKPGIST--SNKEKEQTF 1378
            +  L+    F +  Y G+ED AD+ +F+FSV IL +  +I++ K Y    +SCY+    +G + D Y++NYCWVHGTIPF  NE +P  P+ W   D ++R+ YYQWVPF+LGLQ +LFY+P+++W+ + YN  G +LE L+ +   ++      RK  +  + + +ED+  Q R     K    R+++   C  C  S+  G +LVS YFFIK LY  N I Q+ LM++FL   +S  S  FG+TIL DI+SGK W E   FPRV++CY  +I  +   N Y AQCTLP+NMLNEKI+IFLWFW + V I+T++SI  W+ R+ FL+KR  F K+ LK+  SY + ++   ++ F++ +LR+DG+F++ +I +N+GD+VA ++++ LW+ Y   Y+  DF+         S ++ +++F
Sbjct:    4 QEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSS--FGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLT-VNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSF 420          
BLAST of Ddo_019521 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 97.0561 bits (240), Expect = 1.613e-21
Identity = 95/370 (25.68%), Postives = 161/370 (43.51%), Query Frame = 2
Query:  224 SVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGT--IPFR------ANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKA--TNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENL-----MFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSEL 1288
            +V IL+  SL+++++QYI + I C +  +  G      +  YCW++ T  +P R       +   P      +  D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+        ++  + RK       K L D F+    +    F   R                   +F  + L   N I QI  +  FL    S     +G  +LK   +  + DE +     +FP+VT C         +   +   C LP+N++NEKI++FLWFW + + I++ IS+   I R+  +   K      L+ +   ++ +  EL++            F+L+ +  N   L+  +V+S+L
Sbjct:   31 TVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFST----YGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPK-LRHLLLRARSRLAESEEVELVANKCNI----GDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Ddo_019521 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 97.0561 bits (240), Expect = 1.613e-21
Identity = 95/370 (25.68%), Postives = 161/370 (43.51%), Query Frame = 2
Query:  224 SVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGT--IPFR------ANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKA--TNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENL-----MFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSEL 1288
            +V IL+  SL+++++QYI + I C +  +  G      +  YCW++ T  +P R       +   P      +  D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+        ++  + RK       K L D F+    +    F   R                   +F  + L   N I QI  +  FL    S     +G  +LK   +  + DE +     +FP+VT C         +   +   C LP+N++NEKI++FLWFW + + I++ IS+   I R+  +   K      L+ +   ++ +  EL++            F+L+ +  N   L+  +V+S+L
Sbjct:   31 TVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFST----YGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPK-LRHLLLRARSRLAESEEVELVANKCNI----GDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Ddo_019521 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 97.0561 bits (240), Expect = 1.613e-21
Identity = 95/370 (25.68%), Postives = 161/370 (43.51%), Query Frame = 2
Query:  224 SVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGT--IPFR------ANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKA--TNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENL-----MFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSEL 1288
            +V IL+  SL+++++QYI + I C +  +  G      +  YCW++ T  +P R       +   P      +  D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+        ++  + RK       K L D F+    +    F   R                   +F  + L   N I QI  +  FL    S     +G  +LK   +  + DE +     +FP+VT C         +   +   C LP+N++NEKI++FLWFW + + I++ IS+   I R+  +   K      L+ +   ++ +  EL++            F+L+ +  N   L+  +V+S+L
Sbjct:   31 TVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFST----YGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPK-LRHLLLRARSRLAESEEVELVANKCNI----GDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Ddo_019521 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 97.0561 bits (240), Expect = 1.613e-21
Identity = 95/370 (25.68%), Postives = 161/370 (43.51%), Query Frame = 2
Query:  224 SVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGT--IPFR------ANETLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKA--TNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILSGKQWDENL-----MFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELISQFVERFLRHDGIFILHIISLNAGDLVATDVVSEL 1288
            +V IL+  SL+++++QYI + I C +  +  G      +  YCW++ T  +P R       +   P      +  D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+        ++  + RK       K L D F+    +    F   R                   +F  + L   N I QI  +  FL    S     +G  +LK   +  + DE +     +FP+VT C         +   +   C LP+N++NEKI++FLWFW + + I++ IS+   I R+  +   K      L+ +   ++ +  EL++            F+L+ +  N   L+  +V+S+L
Sbjct:   31 TVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFST----YGSDVLK--FTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVAGPK-LRHLLLRARSRLAESEEVELVANKCNI----GDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Ddo_019521 vs. RefSeq Drosophila melanogaster
Match: gi|17864458|ref|NP_524824.1| (optic ganglion reduced, isoform A [Drosophila melanogaster])

HSP 1 Score: 93.9745 bits (232), Expect = 1.690e-20
Identity = 78/316 (24.68%), Postives = 130/316 (41.14%), Query Frame = 2
Query:  134 MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMNDISCYIPVMATGTDLDSYIKNYCWVHGTI----PFRANE----TLPSTPKQWQDADFERRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKATNQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTGVFLVSLYFFIKLLYLTNAICQILLMQ-----TFLKIGTSKISGFFGWTILKDILSGKQWDENL-MFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLWFW 1039
            M  LL    S+   + I  ++A  +    F+  +L+ CSLII+  QY+   ISC +  +         +  +CW+H T      FR         P     + D D ++   YYQWV FVL  Q +  Y P+ +W      L  + + GL ++    T +  + +++ +          +L + V  H  + I       +CC                     N I Q+ LM       FL  GT+ +        L D+   ++ D  + +FPRVT C         +   + + C LP+N++NEK ++F+WFW
Sbjct:    1 MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHV-----VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI--CTREEKEAKRDALLD--------YLIKHVKRHKLYAIRYWACEFLCC--------------------INIIVQMYLMNRFFDGEFLSYGTNIMK-------LSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
The following BLAST results are available for this feature:
BLAST of Ddo_019521 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|418153|sp|Q03412|UNC7_CAEEL1.868e-6233.33RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|10720325|sp|O01393|UNC9_CAEEL1.364e-6131.81RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|12643734|sp|Q19746|INX3_CAEEL1.872e-5229.97RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR4.384e-5231.81RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL3.144e-5131.28RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
back to top
BLAST of Ddo_019521 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150036490.000e+074.34SmedAsxldir_c102510_g2_i2|m.54904|m.29219[more]
SMU150036480.000e+074.10SmedAsxldir_c102510_g2_i1|m.54901|m.45535[more]
SMU150008372.320e-12744.64Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150009182.923e-12648.87Asxlregen_comp60865_c0_seq1|m.9650|m.1056[more]
SMU150006572.167e-11740.71Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
back to top
BLAST of Ddo_019521 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_019521 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|1.613e-2125.68innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|1.613e-2125.68innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|1.613e-2125.68innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|1.613e-2125.68innexin 2, isoform D [Drosophila melanogaster][more]
gi|17864458|ref|NP_524824.1|1.690e-2024.68optic ganglion reduced, isoform A [Drosophila mela... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_019521 ID=Ddo_019521|Name=Ddo_019521|organism=Dugesia dorotocephala|type=mRNA|length=1716bp
CGATTATCGAATGGCACAGTTTATGAATAGATTATTTATTGAGTTTTGTA
AATAGCACTTATTCGTTCAGACTTTAAATGTCGTTCAGTGACTAATTTTA
CTTTGTTCAGTTTTTGAGAAAATATAGATCAAAATGGAGTCTTTGCTGAC
ACAGTTTTCCTCTTTCAATGTTGAAAAATATATCGGAGTGGAAGATGCTG
CGGACAAAGCCAGCTTCCTGTTTAGTGTGACGATATTAGTTGTTTGTAGT
CTAATCATTTCCACCAAACAATACATCATGAATGACATCTCCTGCTATAT
TCCAGTGATGGCTACAGGTACCGATCTGGATAGTTATATAAAGAATTATT
GTTGGGTTCATGGAACGATACCTTTTCGGGCAAATGAAACCCTTCCAAGT
ACTCCGAAACAATGGCAAGATGCTGATTTTGAAAGACGATTAAATTACTA
CCAATGGGTTCCATTTGTTCTTGGACTTCAAGGAGTTCTTTTCTATTTAC
CTCGTATCATTTGGAAAGCTTTGCTATACAATCTCAGTGGAATTGATTTG
GAGGGATTAGTTGTCAGTACCAGGAAAGCCACAAATCAAATTGGAGACCA
TAGAAAGGAAACTATCGAACAAGTAGCGAAATGTTTAGAAGATATGTTTT
TACAAAGAAGAGTCATTGGACATTCTAAATTTCCGATATTGCGACAGAAA
ATGGCATTAGTTTGCTGTAGTCGTCGTACTGGAGTTTTTCTGGTTTCTCT
TTATTTTTTTATAAAGTTACTTTACCTGACAAACGCCATTTGTCAAATAC
TATTAATGCAAACTTTTCTCAAAATTGGAACATCAAAAATAAGTGGATTC
TTCGGATGGACGATATTGAAAGACATTCTTTCTGGTAAACAGTGGGACGA
AAACCTTATGTTTCCAAGAGTAACATTTTGCTACATTGATAATATTGCTT
TAGTTGCAACCAAAAACCATTATTTTGCTCAGTGCACTTTACCCATAAAT
ATGCTTAATGAGAAAATATTTATCTTTCTATGGTTTTGGACGGTAGCAGT
GTTGATTCTTACAATTATAAGTATACCCTTATGGATAAACCGAATGACAT
TTTTGAATAAACGAAAAGATTTTGTAAAAAGATTTTTGAAAATCAAATGT
TCCTATTCTAAGGAGAAGCATCATGAGTTGATTTCACAATTCGTTGAAAG
ATTTTTAAGACATGATGGAATTTTTATTTTACATATAATTTCCTTGAACG
CAGGAGACCTGGTGGCTACAGACGTGGTGAGTGAACTATGGGATATTTAT
ATCAAGTATTATATGGAGGTTGACTTCTCCAGGAAGCCAGGTATTTCAAC
TTCCAACAAAGAGAAAGAGCAAACTTTTGTTTAAATAATAAAATTTTCAT
CATAACTTTACATATCTGTTTAAAGTGGTTTAATAATAAATGTAAACGAG
TATTATTTGTGAGAACTAAACGATTTTTATATATTTTTTGTTATACTTTT
CCAAAATTACAGAGCAGATTTCGAAAAGAAGATGTAAACATTTTGCTTAG
TTCCTTGAGTAGCTTTTTGATGGCTATGAGAACAATTACAATAAAAATCT
GGGTATTTTATTTTATTTTAGACTTAACATTTTATACATCATCAATAACT
GAAAAATTCACTTCATTATTTATTCTAATTTGTTTCTCTTGAAAGTTGTA
GTTAGATGTTTTCGAT

Design Primers for Ddo_019521

back to top

protein sequence

>Ddo_019521-protein ID=Ddo_019521-protein|Name=Ddo_019521|organism=Dugesia dorotocephala|type=polypeptide|length=417bp
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
back to top

coding sequence

>Ddo_019521.134.1384 ID=Ddo_019521.134.1384|Name=Ddo_019521.134.1384|organism=Dugesia dorotocephala|type=CDS|length=1251bp
ATGGAGTCTTTGCTGACACAGTTTTCCTCTTTCAATGTTGAAAAATATAT
CGGAGTGGAAGATGCTGCGGACAAAGCCAGCTTCCTGTTTAGTGTGACGA
TATTAGTTGTTTGTAGTCTAATCATTTCCACCAAACAATACATCATGAAT
GACATCTCCTGCTATATTCCAGTGATGGCTACAGGTACCGATCTGGATAG
TTATATAAAGAATTATTGTTGGGTTCATGGAACGATACCTTTTCGGGCAA
ATGAAACCCTTCCAAGTACTCCGAAACAATGGCAAGATGCTGATTTTGAA
AGACGATTAAATTACTACCAATGGGTTCCATTTGTTCTTGGACTTCAAGG
AGTTCTTTTCTATTTACCTCGTATCATTTGGAAAGCTTTGCTATACAATC
TCAGTGGAATTGATTTGGAGGGATTAGTTGTCAGTACCAGGAAAGCCACA
AATCAAATTGGAGACCATAGAAAGGAAACTATCGAACAAGTAGCGAAATG
TTTAGAAGATATGTTTTTACAAAGAAGAGTCATTGGACATTCTAAATTTC
CGATATTGCGACAGAAAATGGCATTAGTTTGCTGTAGTCGTCGTACTGGA
GTTTTTCTGGTTTCTCTTTATTTTTTTATAAAGTTACTTTACCTGACAAA
CGCCATTTGTCAAATACTATTAATGCAAACTTTTCTCAAAATTGGAACAT
CAAAAATAAGTGGATTCTTCGGATGGACGATATTGAAAGACATTCTTTCT
GGTAAACAGTGGGACGAAAACCTTATGTTTCCAAGAGTAACATTTTGCTA
CATTGATAATATTGCTTTAGTTGCAACCAAAAACCATTATTTTGCTCAGT
GCACTTTACCCATAAATATGCTTAATGAGAAAATATTTATCTTTCTATGG
TTTTGGACGGTAGCAGTGTTGATTCTTACAATTATAAGTATACCCTTATG
GATAAACCGAATGACATTTTTGAATAAACGAAAAGATTTTGTAAAAAGAT
TTTTGAAAATCAAATGTTCCTATTCTAAGGAGAAGCATCATGAGTTGATT
TCACAATTCGTTGAAAGATTTTTAAGACATGATGGAATTTTTATTTTACA
TATAATTTCCTTGAACGCAGGAGACCTGGTGGCTACAGACGTGGTGAGTG
AACTATGGGATATTTATATCAAGTATTATATGGAGGTTGACTTCTCCAGG
AAGCCAGGTATTTCAACTTCCAACAAAGAGAAAGAGCAAACTTTTGTTTA
A
back to top
Gene Groups
Ddo_019521 is similar in sequence to the genes of this group: GG549
Gene NameGene ID
SMU15000918SMU15000918
SMU15003648SMU15003648
SMU15003649SMU15003649
Ddo_019521Ddo_019521
innexinDdo_023720
Gsp_005528Gsp_005528
innexinGsp_009731
Pgr_014738Pgr_014738
Pgr_015079Pgr_015079
innexinPgr_016503
Pgr_025217Pgr_025217
Pgr_029537Pgr_029537
Pmo_002029Pmo_002029
Pmo_032051Pmo_032051

Gene Group Protein Sequences

>SMU15000918

MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
>SMU15003648
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>SMU15003649
MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFG
EIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFD
RRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
>Ddo_019521 Ddo_019521
MESLLTQFSSFNVEKYIGVEDAADKASFLFSVTILVVCSLIISTKQYIMN
DISCYIPVMATGTDLDSYIKNYCWVHGTIPFRANETLPSTPKQWQDADFE
RRLNYYQWVPFVLGLQGVLFYLPRIIWKALLYNLSGIDLEGLVVSTRKAT
NQIGDHRKETIEQVAKCLEDMFLQRRVIGHSKFPILRQKMALVCCSRRTG
VFLVSLYFFIKLLYLTNAICQILLMQTFLKIGTSKISGFFGWTILKDILS
GKQWDENLMFPRVTFCYIDNIALVATKNHYFAQCTLPINMLNEKIFIFLW
FWTVAVLILTIISIPLWINRMTFLNKRKDFVKRFLKIKCSYSKEKHHELI
SQFVERFLRHDGIFILHIISLNAGDLVATDVVSELWDIYIKYYMEVDFSR
KPGISTSNKEKEQTFV*
>Ddo_023720 innexin
MVLSEFIDYATKYKWVDFVGMEDFGDRLSFNLSTSILLLLTVVISVKSYL
LASIACYIPIQPTGHDFDDFLKSYCWVHGTIPMHNNRPMPRTENEWEYAD
KMERINYYQWVPFVLALQGVLFYLPRIIWQMITYNLSGTDLEGLVEMANA
ASNQTGQAKAETVNQVAMNLENLLFSHRKIRNHRKLIMLKLSEAKSWFCA
GKRSGRQLIVQYMFIKFLYLINAFGQLILMQYFLNFGHNDSSFGYTVLKN
ILNGKEWNDTLIFPRVTYCYVKNIKHVGITNDYLAQCALPINMLN
>Gsp_005528 Gsp_005528
MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILVVCSIIISTKQYVAT
DISCYIPVVISGSDFEKFIRNYCWVHGTIPFRSNETLPQTKEEWMTAEYT
KKINYYQWVPFVLGLQGILFYLPRLIWSTIVYNLSGNHLEGIVVSAQKAT
NQVGDSRKENIELIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTG
IFLVSLYFLIKILYLINAFGQILLMQNFLRLGTTKLNAAFGWTILQDIIS
GKQWTENLLFPRTTFCFVGDISLVAVKNHFVAQCTLPINMLNEKIYIFLW
FWTVGVLILTIISIPIWLWRMTFFSKRQKFVKKFLKIKCSYSKVKHKELI
SHFVGRFLRHDGIFILHIISLNAGDLIATDIVTELWEIYTKYYVEKDFSK
NMVSIADEKTKQTFV*
>Gsp_009731 innexin
MVLSEFIDYATKFKWVDFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LNSIACYIPIHPSGKDFDDYLKSYCWVHGTIPIQGRLPQDITDWENMDKY
NRINYYQWVPFVLAIQGILFYLPRIIWQMITYNMSGTDLEGLIEMANSVS
NKTGDAKRETVNQVALNLENLLFVHRKINLHSVQVIAKLSKLRSWFCSGK
RSGRQLTAQYMFIKVLYVINAFGQIFLMQYFLDFGHKGSSFGYVVLNNII
NGKEWNETLIFPRVTYCYVKNIQHIGMKNSYLAQCALPINMLNEKIYIFL
WFWTIIVVFFTCISFIQWIYILTRPSSQVNFLKKFLKIREQYSDEDDVVI
KSFFKGFLRKDGVFILRMFSINAGDLITTDIVTELWNIYKEKHTQQNFDQ
MEPLNDGQYSDASTLPVKNENMYYEA*
>Pgr_014738 Pgr_014738
MENLLIYFSKFHVTTYVGVEDGADKASFLFSVTILLVSSIIISTKEYILN
SMSCYIPISISGDKFDTYVKNYCWVHGTIPMRSNETLPMTATEWIIMDSE
RRINYYQWVPFVLGLQGILFYLPRMIWQLVIYNLSGNDLEGLVISAKKAV
TEIGMSRKDSVEQIAHCLEDLFFERRVLKSYEHRLLRNKTSMFCCSRRTG
VFLFSIYFIIKILYLLNAIGQIYLMQHFLRIGTTQLDTGFGMTILMDIIS
GKTWNDNLMFPRVAYCYIGGISTVGTSNPYIAQCALPVNMLNEKLYIFLW
FWTVGVLIITVLSIPIWIFRMSFIRKRRDFIKRFLKRRSCYEKTKHREIL
SQFVTCFLRHDGIFILRIISLNAGDIITTDIVGKLWEIYKESYTEKDFRT
ANVSDKYV*
>Pgr_015079 Pgr_015079
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLPSLN
RFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHFGKL
EEIIDNNSDSSTMPM*
>Pgr_016503 innexin
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAVFTVTSVVQWIFRIALTNNEVGFLKKFLRVREQYQKEDLP
SLNRFCEGFLRKDGVFIIRMLSMNAGDLVTSNIVTKLWDIYKKKYSTRHF
GKLEEIIDNNSDSSTMPM*
>Pgr_025217 Pgr_025217
MVLSEFLSHVTTYKWVNFVGMEDFADKLSFNVSTSLLLLITIIITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNASLPWPKDENAWEELD
RNQRINYYQWVPFVLALQGILFYLPRIVWQIMTYNLSGADLEGLVEMANS
ACNQTGEVKNNTVKQIAENLENMFFCHREINFHNRSLAIKAAKAKNWLCA
GKRSGRQLIIQYMFIKMLYLINVFGQLILMQKFLQFGTHDHYFGYIVLKN
ILSGREWNDTQIFPRVTYCYVNKIQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQ
DLLEQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVY
DFSKASSPKQFV*
>Pgr_029537 Pgr_029537
MEQLLAQFSSANVATYVGVEDAADKASFLFSVAILVVCTIIITAKEYILD
SMSCYIPIMMTGHNFEVYVKNYCWVHGTIPLRSNETIPQTEDQWLQMDLE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQTVVYNLSGNDLEGLVTSAKKAC
SQIDKDRQEAIEQISRCLEDMLFQRRVLDTSKHPLLKQRASMFCCSRRTG
VFLFSLYFLIKILYLINAFGQIYLMQHFLRIGVTHLSGGFGVTILRDIIS
GRTWNDNLMFPRVAYCYIGGISTVGTKNHHVAQCALPVNMLNEKVYIFLW
FWTVGVAIITLCSIPIWVFRMTFIRKRREFVKRFLKVKSNYEKLKHQDLL
EQFVGTFLRHDGVFLLRMISLNAGDLITTDIVSRLWEIYIEHYNDVYDFS
KASSPKQFV*
>Pmo_002029 Pmo_002029
MESLLTQFSEFKVATYVGVEDGADKASFLFSVVLLVVFSLVISTKEYILN
SMSCYIPIMASGEKFDDYVQNYCWVHGTIPFRSNETIPQTEAQWLIMDSE
RRLNYYQWVPFVLGLQGVLFYLPRMIWQIVIYNLSGNDLESLVVSAKKAV
NQIGDDRTETIDQIAECLEDMLFQRRVLDHSKHPLLRQRASIFCCSRRTG
VFLLSFYFVIKILYLLNAIGQIYLMQHFLRIGTTHLNGAFGITILRDIIA
GTTWNDNMIFPRVAYCYIGGMTMVGTKNPYLAQCALPINMLNEKIYIFLW
FWTVGVLIITILSIPLWVYRMSFVRKRRLFVKKFLKVKCDYDKQKHKEVL
DKFVGMFLRHDGVFILRIISLNAGDLITTDIVNKLWEIYQNSYLDTDFRK
VNDSKYMA*
>Pmo_032051 Pmo_032051
MVLSEFLTHVTSYKWVNFVGMEDFADKLSFNVSTSLLLLITIVITVKSYL
LTSIACYIPIQPSGKDFDDFLKSYCWVHGTIPMNSSLPWPKDERSWEELD
RNHRINYYQWVPFVLALQGILFYLPRIIWQIITYNLSGADLEGLVEMANS
ACNQTGETKAKTVTQIAQNLENIFFCHREINFHKRTFVVKAAKAKSWFCA
GKRSGKQLIVQYMFIKVLYVVNVFGQLFLMQRFLQFGHQDKYFGYVILNN
IINGREWNDTQIFPRVTYCYVNKVQHVGMQNDYLAQCALPINMLNEKVYI
FLWFWTVIVAIFTVISLCQWIFRVAVSNREIGFLKKFLRVREKYEKEDSP
RLNAFCEGFLRKDGVFIIRMLAMNAGDLITSNIVTELWKTYQDKYPKVNF
GKYDEPKDCGSDSSTLPMKDEFL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.