Ddo_017828, Ddo_017828 (mRNA) Dugesia dorotocephala

Overview
NameDdo_017828
Unique NameDdo_017828
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length4026
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_017828 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 628/660 (95.15%), Postives = 639/660 (96.82%), Query Frame = 1
Query:    1 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE     EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL
Sbjct:  176 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPE--EKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 628/660 (95.15%), Postives = 639/660 (96.82%), Query Frame = -1
Query: 2050 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 4026
            LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPMRRER+K  EE  EKE+EKE     EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL
Sbjct:  176 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPE--EKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of Ddo_017828 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 498/659 (75.57%), Postives = 570/659 (86.49%), Query Frame = 1
Query:    1 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            L  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFK+RYNI LT   QPFVLTRVKK              +++   E EAP++ D+TLNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERLDDIP+FC+WI+ ++N+ GM NKW LKIDN PLEIEGRELP CDVISG  +INEKI DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSG AK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVS+KTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF N P+G+QEFH+TL  NF  AL +FK+ Y ILP RI+V+RDGVGD+QLQFTK FEVDAMKPL+ENIYK NG  VPQIIYVIVKKR+GTKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKG+ PA+INERIRNRLFYL
Sbjct:  169 LGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK---------IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 498/659 (75.57%), Postives = 570/659 (86.49%), Query Frame = -1
Query: 2050 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 4026
            L  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFK+RYNI LT   QPFVLTRVKK              +++   E EAP++ D+TLNI GELCFLCGFSDQEKSN+DLQK+LG VLKR PRERLDDIP+FC+WI+ ++N+ GM NKW LKIDN PLEIEGRELP CDVISG  +INEKI DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSG AK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVS+KTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF N P+G+QEFH+TL  NF  AL +FK+ Y ILP RI+V+RDGVGD+QLQFTK FEVDAMKPL+ENIYK NG  VPQIIYVIVKKR+GTKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKG+ PA+INERIRNRLFYL
Sbjct:  169 LGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK---------IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of Ddo_017828 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/646 (57.89%), Postives = 491/646 (76.01%), Query Frame = 1
Query:   43 GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL
Sbjct:  177 GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 374/646 (57.89%), Postives = 491/646 (76.01%), Query Frame = -1
Query: 2050 GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 3984
            GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL
Sbjct:  177 GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of Ddo_017828 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 255.373 bits (651), Expect = 2.853e-69
Identity = 185/592 (31.25%), Postives = 289/592 (48.82%), Query Frame = 1
Query:  217 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKIN-EKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNN 1932
            +L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+                               + +P E C+L G +D+ +++ ++ K L S  +  P +R   I    + I  + +       W L  +NK L + GR LP   +I G           DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V+ K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S  V Q RG QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV    P I    K+ G    P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D            + P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:  300 ELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR-------------------LGPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRG-QEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEV----PQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN---------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          

HSP 2 Score: 255.373 bits (651), Expect = 2.853e-69
Identity = 185/592 (31.25%), Postives = 289/592 (48.82%), Query Frame = -1
Query: 2095 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKIN-EKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNN 3810
            +L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+                               + +P E C+L G +D+ +++ ++ K L S  +  P +R   I    + I  + +       W L  +NK L + GR LP   +I G           DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V+ K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S  V Q RG QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV    P I    K+ G    P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D            + P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:  300 ELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR-------------------LGPSGRPPPGPAMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRG-QEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEV----PQIMQSIKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN---------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of Ddo_017828 vs. uniprot
Match: gi|519883174|sp|Q7PLK0|AGO3_DROME (RecName: Full=Protein argonaute-3)

HSP 1 Score: 249.595 bits (636), Expect = 3.025e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  187 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 249.595 bits (636), Expect = 3.025e-67
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 2050 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 3840
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Ddo_017828 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 1260.74 bits (3261), Expect = 0.000e+0
Identity = 627/662 (94.71%), Postives = 643/662 (97.13%), Query Frame = 1
Query:    1 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPM--XXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 1980
            LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPM   R+++     +KEKE+E+EKEAP+EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL*
Sbjct:  176 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          

HSP 2 Score: 1260.74 bits (3261), Expect = 0.000e+0
Identity = 627/662 (94.71%), Postives = 643/662 (97.13%), Query Frame = -1
Query: 2047 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPM--XXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 4026
            LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFK+RYNIRLTQGDQPFVLTRVKKPM   R+++     +KEKE+E+EKEAP+EKDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWI+ SD A GMCNKWQLKIDNKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSG AKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN P+GRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG+NP  INERIRNRLFYL*
Sbjct:  176 LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837          
BLAST of Ddo_017828 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 375/647 (57.96%), Postives = 492/647 (76.04%), Query Frame = 1
Query:   43 GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 1980
            GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL*
Sbjct:  220 GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          

HSP 2 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 375/647 (57.96%), Postives = 492/647 (76.04%), Query Frame = -1
Query: 2047 GPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 3984
            GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK RYNI L    QPFV++RVK+ M R + K   E +          P E D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  G+  +      W + I+ +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  +G+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P  IN+RIR RLFYL*
Sbjct:  220 GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPE---------GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWT-GAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852          
BLAST of Ddo_017828 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 226.098 bits (575), Expect = 1.988e-60
Identity = 173/628 (27.55%), Postives = 307/628 (48.89%), Query Frame = 1
Query:  157 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD--MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNN-KINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND--VERCLNDAARSGSGSAKMA---LVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENI---YKSNGFPVPQIIYVIVKKRVGTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 1980
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK+ Y +++   +QP ++++               +    + +  +  +E D  +   IP ELC L G +D    +  L + L    +  P++R + +  F + I   + A  +   W + I+   + I   ++ P  +  GN   ++     ++K       +    + E  ++I  ++     N +       ++ R+    GK      N+   E  L +  R+ +   ++    L  V +DR  A  K   +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VG+D +H+ K   +S+ A V S N+  T++ S  +     +E    L       L+ + +  + LP+ I ++RDGV D QL + +  E++    + E+    YK      P ++Y +V+KR+ T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TPT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+    N  A  +  + +RLFYL*
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK--------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQ----NLKAEPSNLLCDRLFYL* 975          

HSP 2 Score: 226.098 bits (575), Expect = 1.988e-60
Identity = 173/628 (27.55%), Postives = 307/628 (48.89%), Query Frame = -1
Query: 2047 INRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD--MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNN-KINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND--VERCLNDAARSGSGSAKMA---LVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENI---YKSNGFPVPQIIYVIVKKRVGTKLF-----NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL* 3870
            IN+ +N+   M+     +I+QL+G+ ++T +NN+ YRI++I    N   +F+ GG  +SY +YFK+ Y +++   +QP ++++               +    + +  +  +E D  +   IP ELC L G +D    +  L + L    +  P++R + +  F + I   + A  +   W + I+   + I   ++ P  +  GN   ++     ++K       +    + E  ++I  ++     N +       ++ R+    GK      N+   E  L +  R+ +   ++    L  V +DR  A  K   +   + +Q V  +  T +   +   V+    +QI AK G + W V+I ++  M+VG+D +H+ K   +S+ A V S N+  T++ S  +     +E    L       L+ + +  + LP+ I ++RDGV D QL + +  E++    + E+    YK      P ++Y +V+KR+ T+L+     N+G  NNPNPGT+VD  + + N Y+FFLVSQ   +GT TPT+Y VL D    T         P+++Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+    N  A  +  + +RLFYL*
Sbjct:  388 INKTVNNKGQMQT---AAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK--------------SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMS-KSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYK------PNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYT---------PHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQ----NLKAEPSNLLCDRLFYL* 975          
BLAST of Ddo_017828 vs. Smed Unigenes AA
Match: SMU15038936 (dd_smedV4_3861_0_1|m.24705|m.16148)

HSP 1 Score: 126.331 bits (316), Expect = 3.668e-29
Identity = 141/558 (25.27%), Postives = 234/558 (41.94%), Query Frame = 1
Query:  316 GRTL--SYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSD-NANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDAR---VGKVNTC----GPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPT------MIVGMDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 1899
            G+T+  +  +YF+DRY ++L     P +                            +  QE+  T  +P E+C +       K   D+Q S  +++K   R   D      N +R S+ NA+     + + ++ +  +I+GR +P   +  G     +  P    W     QF    + K         +   + ++ +    Q+L+ +  DA    VG+   C    G + VE        S +G   + +V      VYA+VK    +  GL TQCV  +N    N    + +SN   ++I  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ +RDGV + Q     N E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  370 GQTIECTVTKYFQDRYGMKLQHPHLPCL----------------------------QVGQEQKHTY-LPLEVCNIVSGQRCIKKLTDMQTS--TMIKATARSAPDREKEINNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVR-EDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN---VNKPSPQTLSN-LCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          

HSP 2 Score: 126.331 bits (316), Expect = 3.668e-29
Identity = 141/558 (25.27%), Postives = 234/558 (41.94%), Query Frame = -1
Query: 2128 GRTL--SYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSD-NANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDAR---VGKVNTC----GPNDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPT------MIVGMDTYHNKS---SKKSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 3711
            G+T+  +  +YF+DRY ++L     P +                            +  QE+  T  +P E+C +       K   D+Q S  +++K   R   D      N +R S+ NA+     + + ++ +  +I+GR +P   +  G     +  P    W     QF    + K         +   + ++ +    Q+L+ +  DA    VG+   C    G + VE        S +G   + +V      VYA+VK    +  GL TQCV  +N    N    + +SN   ++I  K G     +   +RP       + +G D  H  +   +K SI A V S+++  ++Y + V+    RQE  + L       L  F K     P RI+ +RDGV + Q     N E+ A++   E   K      P I +V+V+KR  T+LF         R  N   GT VD+ I  P  ++F+L S    +GT+ P++Y+VL D    +          +E+Q +TY L H Y     ++ +P P +YAH +A
Sbjct:  370 GQTIECTVTKYFQDRYGMKLQHPHLPCL----------------------------QVGQEQKHTY-LPLEVCNIVSGQRCIKKLTDMQTS--TMIKATARSAPDREKEINNLVRRSNFNADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKVWAIACFAPQRTVR-EDSLRTFTQQLQKISNDAGMPIVGQPCFCKYATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKN---VNKPSPQTLSN-LCLKINVKLGGINSILVPSVRPAVFKEPVIFLGADFTHPPAGDKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQETIQDLAAMVKELLIQFYKSTRFKPTRIIYYRDGVSEGQFLNVLNHELKAIR---EACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSA---------DEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVA 879          
BLAST of Ddo_017828 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 114.005 bits (284), Expect = 2.411e-25
Identity = 147/636 (23.11%), Postives = 259/636 (40.72%), Query Frame = 1
Query:  130 LTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDR--KHEIDVVIVDRNDFQYKNFMNDVEQELRNMR--IDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMA--LVFVP-DDRVYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGMDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNQPRGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG 1926
            LT  L   R+      N+  KAY+R+          I  ++NK+ R  +I E N           L+  +YF+  YNI+L   + P V T   KP                                +P EL  +       +S+  + + +         +RL  + +  + ++  +  +     ++++ID K + ++ R L   + I G  +        W     +F    D+     +  V  +R+  +    + D+E +L      +  R+G     +     ++E+   D  R+     K    LVFV  +D  Y +VK F  +  G++TQC+      NR     + + N  ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + + Q   ++E        E     +NL +  +K    + P+R++ +RDGV + Q       E+ A++   + + K      P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P +Y+VL D          +    +ELQ  TY L H+Y     ++  P P +YAH LA   G+   G
Sbjct:  407 LTRKLKTLRVQANHLKNADGKAYSRKYT--------IFGFSNKSAREEKIVEKN-----------LTIEQYFQKEYNIKLKYPNLPMVKTSPNKPTF------------------------------VPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYAT-LNRQKFLDQYLGN-IMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          

HSP 2 Score: 114.005 bits (284), Expect = 2.411e-25
Identity = 147/636 (23.11%), Postives = 259/636 (40.72%), Query Frame = -1
Query: 2101 LTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDR--KHEIDVVIVDRNDFQYKNFMNDVEQELRNMR--IDARVGK---VNTCGPNDVERCLNDAARSGSGSAKMA--LVFVP-DDRVYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVE-IKLR-------PTMIVGMDTYHNKSSK----KSIQASVFSINSTFTQYMSFVNQPRGRQE------FHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG 3897
            LT  L   R+      N+  KAY+R+          I  ++NK+ R  +I E N           L+  +YF+  YNI+L   + P V T   KP                                +P EL  +       +S+  + + +         +RL  + +  + ++  +  +     ++++ID K + ++ R L   + I G  +        W     +F    D+     +  V  +R+  +    + D+E +L      +  R+G     +     ++E+   D  R+     K    LVFV  +D  Y +VK F  +  G++TQC+      NR     + + N  ++++  K G   W +  I+ R         M+ G+D  H  S++    KS+ A V S+++  T Y + + Q   ++E        E     +NL +  +K    + P+R++ +RDGV + Q       E+ A++   + + K      P I Y++V+KR   + F         R  N   GTVVDK+I     ++F+L S    +GT+ P +Y+VL D          +    +ELQ  TY L H+Y     ++  P P +YAH LA   G+   G
Sbjct:  407 LTRKLKTLRVQANHLKNADGKAYSRKYT--------IFGFSNKSAREEKIVEKN-----------LTIEQYFQKEYNIKLKYPNLPMVKTSPNKPTF------------------------------VPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYAT-LNRQKFLDQYLGN-IMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQ---PPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE---------NNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIG 978          
BLAST of Ddo_017828 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = 1
Query:  217 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 1977
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = -1
Query: 2050 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 3810
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Ddo_017828 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = 1
Query:  217 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 1977
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = -1
Query: 2050 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 3810
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Ddo_017828 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = 1
Query:  217 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 1977
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = -1
Query: 2050 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 3810
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Ddo_017828 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = 1
Query:  217 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 1977
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = -1
Query: 2050 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 3810
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Ddo_017828 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = 1
Query:  217 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 1977
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          

HSP 2 Score: 240.736 bits (613), Expect = 9.096e-65
Identity = 177/603 (29.35%), Postives = 298/603 (49.42%), Query Frame = -1
Query: 2050 QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD--DWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPND-VERCLNDAARSGSGSAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMS-FVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 3810
            +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++ +YN  +T   QP ++++ K+               +        P      + IP ELC+L G +D+ +++ ++ K L    +  P +R  ++    ++I  +DN       W L  D+  L   GR L    +  G    +   P   DW        +   +  +  ++I  R +++  N  + ++ +    M +  R  K      +D  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    ++ K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S  + Q RG QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +      P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + NRL+YL
Sbjct:  302 ELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR--------------RRGPGGTLPGP-----AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYN-PQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMR--KAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRG-QELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLS-----LSNRLYYL 861          
BLAST of Ddo_017828 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 249.595 bits (636), Expect = 3.492e-68
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  187 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 249.595 bits (636), Expect = 3.492e-68
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 2050 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 3840
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Ddo_017828 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 249.595 bits (636), Expect = 3.492e-68
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  187 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 249.595 bits (636), Expect = 3.492e-68
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 2050 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 3840
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Ddo_017828 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 249.595 bits (636), Expect = 3.492e-68
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = 1
Query:  187 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 1977
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          

HSP 2 Score: 249.595 bits (636), Expect = 3.492e-68
Identity = 172/609 (28.24%), Postives = 308/609 (50.57%), Query Frame = -1
Query: 2050 MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEKD-MTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK-NFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINERIRNRLFYL 3840
            ++ Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K  +NI +   +QP + + +KK                     +  P E++ +   +  ELC+L G  D+ +S+  L + + +  +  P +R   +  F   +  +  A  + N W L + N   +I GR++    +      ++     ++    V  ++ +       ++I  RN  Q   + +++++Q   ++ ++     + +   + ++  +    R+ + + +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+  + +    + E +  +LFYL
Sbjct:  304 VEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKS--------------------RGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD---------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD----VAEALSEKLFYL 867          
BLAST of Ddo_017828 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 236.113 bits (601), Expect = 4.236e-64
Identity = 184/592 (31.08%), Postives = 284/592 (47.97%), Query Frame = 1
Query:  220 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD---DW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 1914
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI   + D   DW  +F R     K    +   V+   RN  + + F   V+  +R     A   K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  233 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIF--VCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEF---VQMCIRT----ASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          

HSP 2 Score: 236.113 bits (601), Expect = 4.236e-64
Identity = 184/592 (31.08%), Postives = 284/592 (47.97%), Query Frame = -1
Query: 2113 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPD---DW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK 3807
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI   + D   DW  +F R     K    +   V+   RN  + + F   V+  +R     A   K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  233 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIF--VCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEF---VQMCIRT----ASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          
BLAST of Ddo_017828 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 236.113 bits (601), Expect = 7.856e-64
Identity = 186/612 (30.39%), Postives = 294/612 (48.04%), Query Frame = 1
Query:  220 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXXAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINE-KIPDDW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 1977
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI       DW  +F R     K    +   V+   RN  + + F   V+  +R     A   K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV + +++  +       ++N+L++L
Sbjct:  304 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEF---VQMCIRT----ASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAESINRAPSAG-----LQNQLYFL 866          

HSP 2 Score: 236.113 bits (601), Expect = 7.856e-64
Identity = 186/612 (30.39%), Postives = 294/612 (48.04%), Query Frame = -1
Query: 2050 LIGRDIITKYNNKTYRISEIKEMNVDE-KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMXXXXXXXXXXXXXXXXXXXXEAPQEK------DMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCDVISGNNKINE-KIPDDW--KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------NDVERCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVS--NKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFT-QYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPV-PQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGNNPAVINERIRNRLFYL 3807
            ++G  I+T YNNKTYRI ++   +    KF+     +SY +Y+K RYNI +    QP V++R                           P +K      D  + I  EL    G +D  +++    +++    +  P  R++ +  F   ++    +      W +++D+  +EI  R LPP  ++ GN KI       DW  +F R     K    +   V+   RN  + + F   V+  +R     A   K+N C P         N       D A +      M ++  P++  Y+ +K  T +   + +Q VT +    R  K   ++S   K V+Q+ AK    PW V I L   M VG D  H+ K+  KS  A V +++   + +Y S VN+    QE  E +  N   AL  +++++  LP+RIL FRDGVGD QL    N EV+ +K  ++ IYKS G     ++ ++IV KR+ ++ F    NP PGTVVD  I  P  Y+FFLVSQ    GT +PT+YNV+ D   L           ++LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV + +++  +       ++N+L++L
Sbjct:  304 VMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSR---------------------------PTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWTNEF-RTCSMFKNVHINRWYVITPSRNLRETQEF---VQMCIRT----ASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNA---------DKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAESINRAPSAG-----LQNQLYFL 866          
The following BLAST results are available for this feature:
BLAST of Ddo_017828 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000e+095.15RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000e+075.57RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+057.89RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE2.853e-6931.25RecName: Full=Piwi-like protein 1[more]
gi|519883174|sp|Q7PLK0|AGO3_DROME3.025e-6728.24RecName: Full=Protein argonaute-3[more]
back to top
BLAST of Ddo_017828 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150159470.000e+094.71SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150261770.000e+057.96SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150001111.988e-6027.55Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150389363.668e-2925.27dd_smedV4_3861_0_1|m.24705|m.16148[more]
SMU150329882.411e-2523.11SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
back to top
BLAST of Ddo_017828 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|9.096e-6529.35piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|9.096e-6529.35PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|9.096e-6529.35PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|9.096e-6529.35PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|9.096e-6529.35PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Ddo_017828 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|221513719|ref|NP_001036627.2|3.492e-6828.24argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|3.492e-6828.24argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|3.492e-6828.24argonaute 3, isoform F [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|4.236e-6431.08aubergine, isoform C [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|7.856e-6430.39aubergine, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_017828 ID=Ddo_017828|Name=Ddo_017828|organism=Dugesia dorotocephala|type=mRNA|length=4026bp
TTGAGTCCAAATATAACTAAGGACGAAGTTCCTCGAAACAGTGGTCCGAC
ATTCTTTGAAACAAATAGTTTTAAAGTATTAGGAGGGTTTGGAACAACAT
TACAAAGAGGTACCAAGCCAACTGGAGAACTAACAACATTATTGTATATT
GAGAGAATAAACAGAGTTTTGAACGACAATTCAGTAATGAAAGCTTACAA
TAGACGAAGTATTGACCAGTTGATTGGCCGGGATATTATTACGAAGTATA
ATAACAAAACTTATAGAATATCCGAGATAAAAGAAATGAATGTTGATGAG
AAATTTGAAATGGGTGGACGTACTTTATCGTACGCAGAATATTTCAAAGA
TCGATATAACATACGCTTGACACAAGGCGATCAGCCTTTTGTCTTAACTA
GAGTTAAGAAGCCTATGCGCCGAGAAAGAAGAAAACCTGGAGAAGAAGAT
AAAGAAAAAGAAAGGGAAAAGGAAAAGGAAGCACCTCAAGAAAAAGATAT
GACATTGAATATTCCAGGTGAACTATGCTTCCTATGTGGATTTTCAGATC
AAGAAAAATCGAACATGGACCTTCAAAAAAGCCTGGGTAGTGTTTTAAAA
AGAGAACCACGCGAAAGACTTGATGATATTCCAGCCTTTTGTAATTGGAT
TAGAGGCAGTGACAATGCAAACGGAATGTGTAATAAGTGGCAATTAAAGA
TTGATAATAAACCATTGGAAATAGAAGGTCGTGAATTGCCACCATGTGAT
GTTATAAGTGGTAATAATAAAATTAACGAGAAAATTCCAGATGATTGGAA
ATTTGGAAGAGTGCAGTTTGATATAAAAAGAGACCGTAAACACGAAATTG
ATGTTGTAATTGTTGATAGAAATGATTTCCAATATAAAAATTTCATGAAT
GACGTAGAACAGGAATTAAGAAATATGAGAATAGATGCCAGAGTTGGAAA
AGTTAATACATGCGGGCCAAATGACGTTGAGAGATGCTTGAATGATGCCG
CAAGAAGCGGCAGTGGCTCTGCAAAAATGGCCTTGGTTTTTGTCCCGGAT
GATCGAGTTTATGCAAAGGTTAAATCATTTACTATGAGCACCGGACTTTT
AACGCAGTGTGTTACCACGAGGAATGGAACAAACAGAAATGATAAACGCA
GGAAAGTTGTTTCGAATAAAACGGTTATGCAAATATTTGCCAAATTTGGT
TACGATCCATGGACTGTTGAAATTAAATTGCGGCCTACGATGATTGTTGG
TATGGATACATATCACAATAAATCAAGTAAGAAGTCTATTCAAGCATCTG
TATTCTCAATCAATAGTACATTTACTCAATATATGAGTTTTGTTAATCAA
CCACGTGGTAGACAAGAATTTCACGAAACACTTGGTAAAAATTTCAATCT
CGCATTGGAAGATTTCAAAAAACGATATGACATCTTACCACAGAGAATCC
TGGTTTTCAGAGATGGTGTTGGAGATAATCAGTTGCAATTTACAAAGAAT
TTTGAAGTTGATGCTATGAAACCATTAATAGAAAATATATATAAAAGCAA
CGGTTTCCCAGTTCCACAAATAATTTATGTGATTGTTAAAAAAAGAGTGG
GAACTAAATTATTCAATCGTGGAAATAATCCAAATCCCGGAACTGTTGTG
GATAAAGAAATTGTAAAACCAAATTTCTATGAATTTTTCTTAGTGTCTCA
AAGAACTACAAAGGGTACTGCAACGCCAACAAATTACAATGTCTTGGAAG
ATACTCGATTGTTGACTAAGAAAGGAACAATGGACCCAATGGCTCCAAAT
GAACTTCAGAAAATTACTTACGCGTTGACCCATCTTTATTTCAATTGGAT
GGGTACTATTCGAGTACCGGTCCCTGTGCATTATGCTCATCGGTTGGCGG
AATTGGTTGGCAAAGTTCATAAAGGCAATAATCCTGCTGTAATCAATGAA
AGAATCAGGAACAGGCTCTTCTATTTATAAAATATAGTTCGGAGTATTAT
AAAATTTATACATATGTATAAATTTTATAATACTCCGAACTATATTTTAT
AAATAGAAGAGCCTGTTCCTGATTCTTTCATTGATTACAGCAGGATTATT
GCCTTTATGAACTTTGCCAACCAATTCCGCCAACCGATGAGCATAATGCA
CAGGGACCGGTACTCGAATAGTACCCATCCAATTGAAATAAAGATGGGTC
AACGCGTAAGTAATTTTCTGAAGTTCATTTGGAGCCATTGGGTCCATTGT
TCCTTTCTTAGTCAACAATCGAGTATCTTCCAAGACATTGTAATTTGTTG
GCGTTGCAGTACCCTTTGTAGTTCTTTGAGACACTAAGAAAAATTCATAG
AAATTTGGTTTTACAATTTCTTTATCCACAACAGTTCCGGGATTTGGATT
ATTTCCACGATTGAATAATTTAGTTCCCACTCTTTTTTTAACAATCACAT
AAATTATTTGTGGAACTGGGAAACCGTTGCTTTTATATATATTTTCTATT
AATGGTTTCATAGCATCAACTTCAAAATTCTTTGTAAATTGCAACTGATT
ATCTCCAACACCATCTCTGAAAACCAGGATTCTCTGTGGTAAGATGTCAT
ATCGTTTTTTGAAATCTTCCAATGCGAGATTGAAATTTTTACCAAGTGTT
TCGTGAAATTCTTGTCTACCACGTGGTTGATTAACAAAACTCATATATTG
AGTAAATGTACTATTGATTGAGAATACAGATGCTTGAATAGACTTCTTAC
TTGATTTATTGTGATATGTATCCATACCAACAATCATCGTAGGCCGCAAT
TTAATTTCAACAGTCCATGGATCGTAACCAAATTTGGCAAATATTTGCAT
AACCGTTTTATTCGAAACAACTTTCCTGCGTTTATCATTTCTGTTTGTTC
CATTCCTCGTGGTAACACACTGCGTTAAAAGTCCGGTGCTCATAGTAAAT
GATTTAACCTTTGCATAAACTCGATCATCCGGGACAAAAACCAAGGCCAT
TTTTGCAGAGCCACTGCCGCTTCTTGCGGCATCATTCAAGCATCTCTCAA
CGTCATTTGGCCCGCATGTATTAACTTTTCCAACTCTGGCATCTATTCTC
ATATTTCTTAATTCCTGTTCTACGTCATTCATGAAATTTTTATATTGGAA
ATCATTTCTATCAACAATTACAACATCAATTTCGTGTTTACGGTCTCTTT
TTATATCAAACTGCACTCTTCCAAATTTCCAATCATCTGGAATTTTCTCG
TTAATTTTATTATTACCACTTATAACATCACATGGTGGCAATTCACGACC
TTCTATTTCCAATGGTTTATTATCAATCTTTAATTGCCACTTATTACACA
TTCCGTTTGCATTGTCACTGCCTCTAATCCAATTACAAAAGGCTGGAATA
TCATCAAGTCTTTCGCGTGGTTCTCTTTTTAAAACACTACCCAGGCTTTT
TTGAAGGTCCATGTTCGATTTTTCTTGATCTGAAAATCCACATAGGAAGC
ATAGTTCACCTGGAATATTCAATGTCATATCTTTTTCTTGAGGTGCTTCC
TTTTCCTTTTCCCTTTCTTTTTCTTTATCTTCTTCTCCAGGTTTTCTTCT
TTCTCGGCGCATAGGCTTCTTAACTCTAGTTAAGACAAAAGGCTGATCGC
CTTGTGTCAAGCGTATGTTATATCGATCTTTGAAATATTCTGCGTACGAT
AAAGTACGTCCACCCATTTCAAATTTCTCATCAACATTCATTTCTTTTAT
CTCGGATATTCTATAAGTTTTGTTATTATACTTCGTAATAATATCCCGGC
CAATCAACTGGTCAATACTTCGTCTATTGTAAGCTTTCATTACTGAATTG
TCGTTCAAAACTCTGTTTATTCTCTCAATATACAATAATGTTGTTAGTTC
TCCAGTTGGCTTGGTACCTCTTTGTAATGTTGTTCCAAACCCTCCTAATA
CTTTAAAACTATTTGTTTCAAAGAATGTCGGACCACTGTTTCGAGGAACT
TCGTCCTTAGTTATATTTGGACTCAA

Design Primers for Ddo_017828

back to top

protein sequence

>Ddo_017828-protein ID=Ddo_017828-protein|Name=Ddo_017828|organism=Dugesia dorotocephala|type=polypeptide|length=660bp
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
back to top

coding sequence

>Ddo_017828.1.1980 ID=Ddo_017828.1.1980|Name=Ddo_017828.1.1980|organism=Dugesia dorotocephala|type=CDS|length=1980bp
TTGAGTCCAAATATAACTAAGGACGAAGTTCCTCGAAACAGTGGTCCGAC
ATTCTTTGAAACAAATAGTTTTAAAGTATTAGGAGGGTTTGGAACAACAT
TACAAAGAGGTACCAAGCCAACTGGAGAACTAACAACATTATTGTATATT
GAGAGAATAAACAGAGTTTTGAACGACAATTCAGTAATGAAAGCTTACAA
TAGACGAAGTATTGACCAGTTGATTGGCCGGGATATTATTACGAAGTATA
ATAACAAAACTTATAGAATATCCGAGATAAAAGAAATGAATGTTGATGAG
AAATTTGAAATGGGTGGACGTACTTTATCGTACGCAGAATATTTCAAAGA
TCGATATAACATACGCTTGACACAAGGCGATCAGCCTTTTGTCTTAACTA
GAGTTAAGAAGCCTATGCGCCGAGAAAGAAGAAAACCTGGAGAAGAAGAT
AAAGAAAAAGAAAGGGAAAAGGAAAAGGAAGCACCTCAAGAAAAAGATAT
GACATTGAATATTCCAGGTGAACTATGCTTCCTATGTGGATTTTCAGATC
AAGAAAAATCGAACATGGACCTTCAAAAAAGCCTGGGTAGTGTTTTAAAA
AGAGAACCACGCGAAAGACTTGATGATATTCCAGCCTTTTGTAATTGGAT
TAGAGGCAGTGACAATGCAAACGGAATGTGTAATAAGTGGCAATTAAAGA
TTGATAATAAACCATTGGAAATAGAAGGTCGTGAATTGCCACCATGTGAT
GTTATAAGTGGTAATAATAAAATTAACGAGAAAATTCCAGATGATTGGAA
ATTTGGAAGAGTGCAGTTTGATATAAAAAGAGACCGTAAACACGAAATTG
ATGTTGTAATTGTTGATAGAAATGATTTCCAATATAAAAATTTCATGAAT
GACGTAGAACAGGAATTAAGAAATATGAGAATAGATGCCAGAGTTGGAAA
AGTTAATACATGCGGGCCAAATGACGTTGAGAGATGCTTGAATGATGCCG
CAAGAAGCGGCAGTGGCTCTGCAAAAATGGCCTTGGTTTTTGTCCCGGAT
GATCGAGTTTATGCAAAGGTTAAATCATTTACTATGAGCACCGGACTTTT
AACGCAGTGTGTTACCACGAGGAATGGAACAAACAGAAATGATAAACGCA
GGAAAGTTGTTTCGAATAAAACGGTTATGCAAATATTTGCCAAATTTGGT
TACGATCCATGGACTGTTGAAATTAAATTGCGGCCTACGATGATTGTTGG
TATGGATACATATCACAATAAATCAAGTAAGAAGTCTATTCAAGCATCTG
TATTCTCAATCAATAGTACATTTACTCAATATATGAGTTTTGTTAATCAA
CCACGTGGTAGACAAGAATTTCACGAAACACTTGGTAAAAATTTCAATCT
CGCATTGGAAGATTTCAAAAAACGATATGACATCTTACCACAGAGAATCC
TGGTTTTCAGAGATGGTGTTGGAGATAATCAGTTGCAATTTACAAAGAAT
TTTGAAGTTGATGCTATGAAACCATTAATAGAAAATATATATAAAAGCAA
CGGTTTCCCAGTTCCACAAATAATTTATGTGATTGTTAAAAAAAGAGTGG
GAACTAAATTATTCAATCGTGGAAATAATCCAAATCCCGGAACTGTTGTG
GATAAAGAAATTGTAAAACCAAATTTCTATGAATTTTTCTTAGTGTCTCA
AAGAACTACAAAGGGTACTGCAACGCCAACAAATTACAATGTCTTGGAAG
ATACTCGATTGTTGACTAAGAAAGGAACAATGGACCCAATGGCTCCAAAT
GAACTTCAGAAAATTACTTACGCGTTGACCCATCTTTATTTCAATTGGAT
GGGTACTATTCGAGTACCGGTCCCTGTGCATTATGCTCATCGGTTGGCGG
AATTGGTTGGCAAAGTTCATAAAGGCAATAATCCTGCTGTAATCAATGAA
AGAATCAGGAACAGGCTCTTCTATTTATAA
back to top
Gene Groups
Ddo_017828 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.