Ddo_013304, Ddo_013304 (mRNA) Dugesia dorotocephala

Overview
NameDdo_013304
Unique NameDdo_013304
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1718
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_013304 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 184.111 bits (466), Expect = 1.515e-50
Identity = 101/284 (35.56%), Postives = 163/284 (57.39%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            D  DKLN+ ++  I+T+  ++V+ K Y   P+ C++  T +      Y ENYCWV  T  +     IP + A        ++I YYQW+PF+L L+ ++FY+P +VW+L+ +   G +++SLV  A  +     + R   ++ IA  +E+ L+       G     R KL    N  + ++  G  +   Y+ +K+LY VN++GQ+FL+  FLG  S    +G  +L++++ G+EW+E+G FPRVT C   E++ LG  +R+  QC L INM NEKI++FLWFW
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGN----RLKL---LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSK--WYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFW 289          

HSP 2 Score: 184.111 bits (466), Expect = 1.515e-50
Identity = 101/284 (35.56%), Postives = 163/284 (57.39%), Query Frame = -1
Query:  867 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1718
            D  DKLN+ ++  I+T+  ++V+ K Y   P+ C++  T +      Y ENYCWV  T  +     IP + A        ++I YYQW+PF+L L+ ++FY+P +VW+L+ +   G +++SLV  A  +     + R   ++ IA  +E+ L+       G     R KL    N  + ++  G  +   Y+ +K+LY VN++GQ+FL+  FLG  S    +G  +L++++ G+EW+E+G FPRVT C   E++ LG  +R+  QC L INM NEKI++FLWFW
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGN----RLKL---LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSK--WYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFW 289          
BLAST of Ddo_013304 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 187.193 bits (474), Expect = 1.663e-50
Identity = 105/286 (36.71%), Postives = 162/286 (56.64%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 858
            DF DKLN+ ++  IL    ++V+ K Y   P+ C++  T + +    Y ENYCWV  T  +   + IP++          ++I YYQW+PFIL ++ ++FY+P ++W+ + Y   G NL+ LV  A  A     + +   V  +AR ++D +      RQG        L    N C   +H G ++ + Y+ +KVLY  NV+ Q FL+ H LG N    ++G++LL +++   EW++TG+FPRVT C   E+R LG  +R+  QC L INM NEKI++FLWFW L
Sbjct:  140 DFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFL 414          

HSP 2 Score: 187.193 bits (474), Expect = 1.663e-50
Identity = 105/286 (36.71%), Postives = 162/286 (56.64%), Query Frame = -1
Query:  861 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 1718
            DF DKLN+ ++  IL    ++V+ K Y   P+ C++  T + +    Y ENYCWV  T  +   + IP++          ++I YYQW+PFIL ++ ++FY+P ++W+ + Y   G NL+ LV  A  A     + +   V  +AR ++D +      RQG        L    N C   +H G ++ + Y+ +KVLY  NV+ Q FL+ H LG N    ++G++LL +++   EW++TG+FPRVT C   E+R LG  +R+  QC L INM NEKI++FLWFW L
Sbjct:  140 DFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFL 414          
BLAST of Ddo_013304 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 162.155 bits (409), Expect = 2.810e-42
Identity = 100/290 (34.48%), Postives = 157/290 (54.14%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDA-DSASQNPPQERKDKVERIARKIEDMLYQH----RDYRQGKVADFRRKLYKSCNFCVFSKHL-GTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            D  D+LN+ ++ +IL +  ++++ K Y   P+ C++    S  +   Y+E+YCW+  T  I   + +P D     E    K+I YYQW+PFIL  + +MF +P + W+L C  + G N+++L+  A D+ +     +R+  VE I     D L       R   +G +A  +           FS+ L G  + + Y   K+LY VNV+ Q F++   L  +S    FG+ +LS++  G+ W ETG FPRVT C   E+R+L   NRY  QCAL IN++NEK++ FLW W
Sbjct:   22 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCW 292          

HSP 2 Score: 162.155 bits (409), Expect = 2.810e-42
Identity = 100/290 (34.48%), Postives = 157/290 (54.14%), Query Frame = -1
Query:  867 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDA-DSASQNPPQERKDKVERIARKIEDMLYQH----RDYRQGKVADFRRKLYKSCNFCVFSKHL-GTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1718
            D  D+LN+ ++ +IL +  ++++ K Y   P+ C++    S  +   Y+E+YCW+  T  I   + +P D     E    K+I YYQW+PFIL  + +MF +P + W+L C  + G N+++L+  A D+ +     +R+  VE I     D L       R   +G +A  +           FS+ L G  + + Y   K+LY VNV+ Q F++   L  +S    FG+ +LS++  G+ W ETG FPRVT C   E+R+L   NRY  QCAL IN++NEK++ FLW W
Sbjct:   22 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCW 292          
BLAST of Ddo_013304 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 160.614 bits (405), Expect = 6.286e-42
Identity = 88/287 (30.66%), Postives = 148/287 (51.57%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLY 861
            D  D+L+++ +  +L    ++V+ K Y    + C+M     G  +  Y E+YC++  T  I    +IP D     E      I YYQW+P +L +Q  MFY+P  +W  + Y + G +  S++ +A++      + R   V ++   I D+L        G+   +R           F K LG+   + Y+ +K++Y  NV  Q  ++  FLG  + +  +G+   +++  G+EWQ++G+FPRVT C    +R L   +RY  QC L INM NEKIY+F+WFW ++
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGG-WEQYAEDYCFIQNTFFIPERSEIPGD----VEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFL--WGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVF 288          

HSP 2 Score: 160.614 bits (405), Expect = 6.286e-42
Identity = 88/287 (30.66%), Postives = 148/287 (51.57%), Query Frame = -1
Query:  858 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLY 1718
            D  D+L+++ +  +L    ++V+ K Y    + C+M     G  +  Y E+YC++  T  I    +IP D     E      I YYQW+P +L +Q  MFY+P  +W  + Y + G +  S++ +A++      + R   V ++   I D+L        G+   +R           F K LG+   + Y+ +K++Y  NV  Q  ++  FLG  + +  +G+   +++  G+EWQ++G+FPRVT C    +R L   +RY  QC L INM NEKIY+F+WFW ++
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGG-WEQYAEDYCFIQNTFFIPERSEIPGD----VEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFL--WGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVF 288          
BLAST of Ddo_013304 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 157.147 bits (396), Expect = 1.894e-40
Identity = 97/290 (33.45%), Postives = 155/290 (53.45%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDA-DSASQNPPQERKDKVERIARKIEDMLYQH----RDYRQGKVADFRRKLYKSCNFCVFSKHL-GTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            D  D+LN+ ++ +IL +  ++++ K Y   P+ C++    S  +   Y+E+YCW+  T  I   + +P D     E    K+I YYQW+PFIL  + +MF +P + W+L C  + G N+++L+  A D  +     +R+  VE I     D L       R   +G +A  +           FS+ L G  L + +   K+LY +NV+ Q  ++   L  +S    FG+ +L+++  G+ W ETG FPRVT C   E+R+L   NRY  QCAL IN++NEK++ FLW W
Sbjct:   38 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCW 308          

HSP 2 Score: 157.147 bits (396), Expect = 1.894e-40
Identity = 97/290 (33.45%), Postives = 155/290 (53.45%), Query Frame = -1
Query:  867 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDA-DSASQNPPQERKDKVERIARKIEDMLYQH----RDYRQGKVADFRRKLYKSCNFCVFSKHL-GTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1718
            D  D+LN+ ++ +IL +  ++++ K Y   P+ C++    S  +   Y+E+YCW+  T  I   + +P D     E    K+I YYQW+PFIL  + +MF +P + W+L C  + G N+++L+  A D  +     +R+  VE I     D L       R   +G +A  +           FS+ L G  L + +   K+LY +NV+ Q  ++   L  +S    FG+ +L+++  G+ W ETG FPRVT C   E+R+L   NRY  QCAL IN++NEK++ FLW W
Sbjct:   38 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCW 308          
BLAST of Ddo_013304 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 475.707 bits (1223), Expect = 1.001e-162
Identity = 206/286 (72.03%), Postives = 248/286 (86.71%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 858
            DFADKL+FLFSV +L +S+M+VT+KSY F+PLACY AT P GSNF +YLENYCWVHGTI  LPG+ IPQ+D  W   D  +RI YYQW+PFILGLQCIMFYIP+++WQ+ICYNK GTNLES+V DA++A+  PP ERKDK+ERIAR IEDML+QHRDYRQG  A  RRK+Y +CNFCVFSKH+GTWL+LSY+L+K LYG+NVIGQLF+MK FLGFN++ +SFGYT+LSNM+ GKEW +TGIFPRVTYCYV  I+H+G  N+YVAQCALP+NMLNEKIYVFLWFW++
Sbjct:   23 DFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMV 308          

HSP 2 Score: 475.707 bits (1223), Expect = 1.001e-162
Identity = 206/286 (72.03%), Postives = 248/286 (86.71%), Query Frame = -1
Query:  861 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 1718
            DFADKL+FLFSV +L +S+M+VT+KSY F+PLACY AT P GSNF +YLENYCWVHGTI  LPG+ IPQ+D  W   D  +RI YYQW+PFILGLQCIMFYIP+++WQ+ICYNK GTNLES+V DA++A+  PP ERKDK+ERIAR IEDML+QHRDYRQG  A  RRK+Y +CNFCVFSKH+GTWL+LSY+L+K LYG+NVIGQLF+MK FLGFN++ +SFGYT+LSNM+ GKEW +TGIFPRVTYCYV  I+H+G  N+YVAQCALP+NMLNEKIYVFLWFW++
Sbjct:   23 DFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMV 308          
BLAST of Ddo_013304 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 435.261 bits (1118), Expect = 4.028e-147
Identity = 191/286 (66.78%), Postives = 240/286 (83.92%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 858
            DFAD+LNF+FSVVIL++S++IVT K+YFF+PL+CY+ATTPSG NF+ Y+ENYCWVHGTI  L  ++IP     W   D+ KRITYYQW+PFILGLQCI+FYIP+++W++ICYNK+GTNLE+L+  A  +S+ PP ERK  +  I R IED+LYQHRDYRQGK+A  RR++Y+ CNFCVFSKHLGTWLV +Y  +K LYG+NVIGQL+LMK FLGFNSS++SFGYT+L++++ GK W ET  FPRV+YCY  +I+HLGA N YVAQC LP+NMLNEKIY+FLWFWVL
Sbjct:   23 DFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVL 308          

HSP 2 Score: 435.261 bits (1118), Expect = 4.028e-147
Identity = 191/286 (66.78%), Postives = 240/286 (83.92%), Query Frame = -1
Query:  861 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 1718
            DFAD+LNF+FSVVIL++S++IVT K+YFF+PL+CY+ATTPSG NF+ Y+ENYCWVHGTI  L  ++IP     W   D+ KRITYYQW+PFILGLQCI+FYIP+++W++ICYNK+GTNLE+L+  A  +S+ PP ERK  +  I R IED+LYQHRDYRQGK+A  RR++Y+ CNFCVFSKHLGTWLV +Y  +K LYG+NVIGQL+LMK FLGFNSS++SFGYT+L++++ GK W ET  FPRV+YCY  +I+HLGA N YVAQC LP+NMLNEKIY+FLWFWVL
Sbjct:   23 DFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVL 308          
BLAST of Ddo_013304 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 323.168 bits (827), Expect = 1.795e-103
Identity = 141/286 (49.30%), Postives = 204/286 (71.33%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 858
            D ADK++ +FSV+IL++ + IVT+KSY  +P++CY++  PSG NF  Y+ENYCW+HGTI + P QK+  +   W E++  ++I YYQW+PFILGLQCIMFYIP+++WQ+ C+N+ GTNL++++  +   ++ P  ER+ + E IA+ IE+ML  HRD+R  K+A+ RR +Y  C+  + SK LGT +V SY + K+LY  N IGQLF+++  LGF + + +FG  L   ++ G E +    FPRV +CY+  IRH+G  N YVAQC LP+NMLNEKIY FLW W+L
Sbjct:   23 DLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWIL 308          

HSP 2 Score: 323.168 bits (827), Expect = 1.795e-103
Identity = 141/286 (49.30%), Postives = 204/286 (71.33%), Query Frame = -1
Query:  861 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVL 1718
            D ADK++ +FSV+IL++ + IVT+KSY  +P++CY++  PSG NF  Y+ENYCW+HGTI + P QK+  +   W E++  ++I YYQW+PFILGLQCIMFYIP+++WQ+ C+N+ GTNL++++  +   ++ P  ER+ + E IA+ IE+ML  HRD+R  K+A+ RR +Y  C+  + SK LGT +V SY + K+LY  N IGQLF+++  LGF + + +FG  L   ++ G E +    FPRV +CY+  IRH+G  N YVAQC LP+NMLNEKIY FLW W+L
Sbjct:   23 DLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWIL 308          
BLAST of Ddo_013304 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 316.235 bits (809), Expect = 1.035e-100
Identity = 150/313 (47.92%), Postives = 212/313 (67.73%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNS-SINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSFNIFIGRAHCATY 936
            D  D+LNF FSV++L + ++IVTVK Y F+P++CY+     GSN  SY+EN CWV GTIA+    K P  D  W  ++  K + YYQW+PF+LGLQCIMFY+P++VWQ+ICYN+ GT+++ LVV A+ A  +  + R   V  +++ +E +LYQHRD+R GK+A FRRK++ S  F + SK +GTWLV SY+L+K+ Y  N   QL +M+ FLGF+  ++ +FG  + +N+  G +W+ T IFPRV+YC+V ++ HLG  N  VAQC LP+NMLNE+IY FLW W+L       +  I S  I+I R  C  Y
Sbjct:   23 DLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKML-YYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILI----VLSLTILSIPIWILRILCIKY 329          

HSP 2 Score: 316.235 bits (809), Expect = 1.035e-100
Identity = 150/313 (47.92%), Postives = 212/313 (67.73%), Query Frame = -1
Query:  783 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNS-SINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSFNIFIGRAHCATY 1718
            D  D+LNF FSV++L + ++IVTVK Y F+P++CY+     GSN  SY+EN CWV GTIA+    K P  D  W  ++  K + YYQW+PF+LGLQCIMFY+P++VWQ+ICYN+ GT+++ LVV A+ A  +  + R   V  +++ +E +LYQHRD+R GK+A FRRK++ S  F + SK +GTWLV SY+L+K+ Y  N   QL +M+ FLGF+  ++ +FG  + +N+  G +W+ T IFPRV+YC+V ++ HLG  N  VAQC LP+NMLNE+IY FLW W+L       +  I S  I+I R  C  Y
Sbjct:   23 DLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKML-YYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILI----VLSLTILSIPIWILRILCIKY 329          
BLAST of Ddo_013304 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 311.997 bits (798), Expect = 8.082e-99
Identity = 146/285 (51.23%), Postives = 196/285 (68.77%), Query Frame = 1
Query:    1 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWV 855
            DFADK NFLF+V++L I   IVT+K Y  +P++CY++T  SG+N   Y+ENYCWV GTI I    KIP  +  W E++  K I YYQW+PF+L LQ IMFYIPR++WQ+ CYN  GT++  L+V A+ A  +  + R   V  IA+ IE MLYQHRD R G++A FRR LYK C FC+ SK  GT L+  Y ++K LY  N I QL+ MK FLG N +   FG+ ++ N++ G++W+ T +FPRV YCYV  ++++G  N  VAQC LP+NMLNEKI+ FLW W+
Sbjct:   23 DFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAELNKYK-ILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWI 304          

HSP 2 Score: 311.997 bits (798), Expect = 8.082e-99
Identity = 146/285 (51.23%), Postives = 196/285 (68.77%), Query Frame = -1
Query:  864 DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWV 1718
            DFADK NFLF+V++L I   IVT+K Y  +P++CY++T  SG+N   Y+ENYCWV GTI I    KIP  +  W E++  K I YYQW+PF+L LQ IMFYIPR++WQ+ CYN  GT++  L+V A+ A  +  + R   V  IA+ IE MLYQHRD R G++A FRR LYK C FC+ SK  GT L+  Y ++K LY  N I QL+ MK FLG N +   FG+ ++ N++ G++W+ T +FPRV YCYV  ++++G  N  VAQC LP+NMLNEKI+ FLW W+
Sbjct:   23 DFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAELNKYK-ILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWI 304          
BLAST of Ddo_013304 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = 1
Query:   13 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          

HSP 2 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = -1
Query:  867 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1706
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_013304 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = 1
Query:   13 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          

HSP 2 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = -1
Query:  867 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1706
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_013304 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = 1
Query:   13 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          

HSP 2 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = -1
Query:  867 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1706
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_013304 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = 1
Query:   13 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          

HSP 2 Score: 105.916 bits (263), Expect = 2.319e-24
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = -1
Query:  867 KLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAI------LPGQKI--PQDDAHWTEMDSAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLS-NMLEGKEWQE--TGIFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1706
            ++++  +V+IL    ++VT + Y   P+ C +   P G      ++ YCW++ T  +      + G+ +  P   +H    D  K   YYQW+ F+L  Q I+FY+PR +W+    +  G  L+ LV+D +S   N   E K+  ++I            DY  G +           NF  F           + + + L  VNVIGQ++ +  FL  +   +++G  +L    LE  E  +    +FP+VT C   +    G+   +   C LP+N++NEKIYVFLWFW
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN--DECKNDRKKIL----------VDYFIGNL--------NRHNFYAF----------RFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_013304 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 102.449 bits (254), Expect = 3.074e-23
Identity = 79/287 (27.53%), Postives = 129/287 (44.95%), Query Frame = 1
Query:   31 SVVILTISLMI-VTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILP------GQKIPQDDAHWTEMD---SAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETG---IFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 852
            + VIL I+  I VT + Y   P+ C           N+Y    CW+H T  ++       G ++P    H ++     + K   YYQW+ F L  Q I+FY PR +W+    +  G  + +L++D D    +  ++++ K   +    E++ Y +                              W    Y + ++L  +NVIGQ+FLM  F  F+    +FG  ++  M   +E +      IFPR+T C   +    G   ++ A C LP+N++NEKIY+FLWFW
Sbjct:   18 ATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264          

HSP 2 Score: 102.449 bits (254), Expect = 3.074e-23
Identity = 79/287 (27.53%), Postives = 129/287 (44.95%), Query Frame = -1
Query:  867 SVVILTISLMI-VTVKSYFFQPLACYMATTPSGSNFNSYLENYCWVHGTIAILP------GQKIPQDDAHWTEMD---SAKRITYYQWIPFILGLQCIMFYIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIEDMLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGVNVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETG---IFPRVTYCYVGEIRHLGANNRYVAQCALPINMLNEKIYVFLWFW 1688
            + VIL I+  I VT + Y   P+ C           N+Y    CW+H T  ++       G ++P    H ++     + K   YYQW+ F L  Q I+FY PR +W+    +  G  + +L++D D    +  ++++ K   +    E++ Y +                              W    Y + ++L  +NVIGQ+FLM  F  F+    +FG  ++  M   +E +      IFPR+T C   +    G   ++ A C LP+N++NEKIY+FLWFW
Sbjct:   18 ATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDVLNTY----CWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264          
The following BLAST results are available for this feature:
BLAST of Ddo_013304 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL1.515e-5035.56RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.663e-5036.71RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR2.810e-4234.48RecName: Full=Innexin-19[more]
gi|12643734|sp|Q19746|INX3_CAEEL6.286e-4230.66RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|74959869|sp|O61715|INX19_CAEEL1.894e-4033.45RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
back to top
BLAST of Ddo_013304 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008371.001e-16272.03Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006574.028e-14766.78Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150281811.795e-10349.30SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
SMU150364821.035e-10047.92dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150331268.082e-9951.23SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
back to top
BLAST of Ddo_013304 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_013304 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|2.319e-2428.52innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|2.319e-2428.52innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|2.319e-2428.52innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|2.319e-2428.52innexin 2, isoform D [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|3.074e-2327.53shaking B, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_013304 ID=Ddo_013304|Name=Ddo_013304|organism=Dugesia dorotocephala|type=mRNA|length=1718bp
GATTTTGCAGATAAGCTCAACTTTTTGTTCAGCGTCGTCATTCTGACCAT
CTCGTTGATGATTGTGACTGTTAAATCGTATTTCTTTCAACCGCTCGCAT
GTTATATGGCCACAACGCCGAGTGGTTCCAATTTCAACAGTTATTTGGAA
AATTACTGTTGGGTTCATGGGACGATAGCTATTTTACCTGGACAAAAAAT
ACCACAGGATGACGCTCACTGGACGGAAATGGACTCTGCAAAAAGAATAA
CATATTATCAATGGATTCCGTTCATTCTCGGTCTGCAATGTATAATGTTT
TACATTCCTCGGGTCGTATGGCAACTTATTTGTTACAATAAAATCGGAAC
AAATCTTGAAAGTCTTGTGGTTGATGCTGATTCTGCAAGTCAAAATCCTC
CTCAAGAAAGAAAAGATAAGGTAGAGCGTATAGCAAGAAAAATTGAAGAT
ATGCTGTATCAACATAGAGATTATCGACAAGGAAAAGTAGCAGATTTTAG
ACGAAAATTGTACAAATCGTGCAATTTCTGTGTCTTTTCTAAACATCTTG
GCACATGGCTCGTGTTGTCGTATATGTTGATGAAGGTTTTATATGGTGTT
AATGTTATCGGTCAACTGTTTTTAATGAAACACTTTCTGGGTTTTAATAG
TTCAATTAATTCGTTTGGCTATACGTTATTAAGTAATATGCTTGAAGGGA
AAGAGTGGCAAGAGACCGGAATATTTCCTCGAGTAACATATTGTTATGTT
GGAGAAATCAGACACTTGGGAGCCAATAATAGATATGTTGCACAATGTGC
TCTTCCAATAAATATGTTGAACGAGAAGATATATGTATTCCTTTGGTTTT
GGGTATTATATAATACCCAAAACCAAAGGAATACATATATCTTCTCGTTC
AACATATTTATTGGAAGAGCACATTGTGCAACATATCTATTATTGGCTCC
CAAGTGTCTGATTTCTCCAACATAACAATATGTTACTCGAGGAAATATTC
CGGTCTCTTGCCACTCTTTCCCTTCAAGCATATTACTTAATAACGTATAG
CCAAACGAATTAATTGAACTATTAAAACCCAGAAAGTGTTTCATTAAAAA
CAGTTGACCGATAACATTAACACCATATAAAACCTTCATCAACATATACG
ACAACACGAGCCATGTGCCAAGATGTTTAGAAAAGACACAGAAATTGCAC
GATTTGTACAATTTTCGTCTAAAATCTGCTACTTTTCCTTGTCGATAATC
TCTATGTTGATACAGCATATCTTCAATTTTTCTTGCTATACGCTCTACCT
TATCTTTTCTTTCTTGAGGAGGATTTTGACTTGCAGAATCAGCATCAACC
ACAAGACTTTCAAGATTTGTTCCGATTTTATTGTAACAAATAAGTTGCCA
TACGACCCGAGGAATGTAAAACATTATACATTGCAGACCGAGAATGAACG
GAATCCATTGATAATATGTTATTCTTTTTGCAGAGTCCATTTCCGTCCAG
TGAGCGTCATCCTGTGGTATTTTTTGTCCAGGTAAAATAGCTATCGTCCC
ATGAACCCAACAGTAATTTTCCAAATAACTGTTGAAATTGGAACCACTCG
GCGTTGTGGCCATATAACATGCGAGCGGTTGAAAGAAATACGATTTAACA
GTCACAATCATCAACGAGATGGTCAGAATGACGACGCTGAACAAAAAGTT
GAGCTTATCTGCAAAATC

Design Primers for Ddo_013304

back to top

protein sequence

>Ddo_013304-protein ID=Ddo_013304-protein|Name=Ddo_013304|organism=Dugesia dorotocephala|type=polypeptide|length=325bp
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
back to top

coding sequence

>Ddo_013304.1.975 ID=Ddo_013304.1.975|Name=Ddo_013304.1.975|organism=Dugesia dorotocephala|type=CDS|length=975bp
GATTTTGCAGATAAGCTCAACTTTTTGTTCAGCGTCGTCATTCTGACCAT
CTCGTTGATGATTGTGACTGTTAAATCGTATTTCTTTCAACCGCTCGCAT
GTTATATGGCCACAACGCCGAGTGGTTCCAATTTCAACAGTTATTTGGAA
AATTACTGTTGGGTTCATGGGACGATAGCTATTTTACCTGGACAAAAAAT
ACCACAGGATGACGCTCACTGGACGGAAATGGACTCTGCAAAAAGAATAA
CATATTATCAATGGATTCCGTTCATTCTCGGTCTGCAATGTATAATGTTT
TACATTCCTCGGGTCGTATGGCAACTTATTTGTTACAATAAAATCGGAAC
AAATCTTGAAAGTCTTGTGGTTGATGCTGATTCTGCAAGTCAAAATCCTC
CTCAAGAAAGAAAAGATAAGGTAGAGCGTATAGCAAGAAAAATTGAAGAT
ATGCTGTATCAACATAGAGATTATCGACAAGGAAAAGTAGCAGATTTTAG
ACGAAAATTGTACAAATCGTGCAATTTCTGTGTCTTTTCTAAACATCTTG
GCACATGGCTCGTGTTGTCGTATATGTTGATGAAGGTTTTATATGGTGTT
AATGTTATCGGTCAACTGTTTTTAATGAAACACTTTCTGGGTTTTAATAG
TTCAATTAATTCGTTTGGCTATACGTTATTAAGTAATATGCTTGAAGGGA
AAGAGTGGCAAGAGACCGGAATATTTCCTCGAGTAACATATTGTTATGTT
GGAGAAATCAGACACTTGGGAGCCAATAATAGATATGTTGCACAATGTGC
TCTTCCAATAAATATGTTGAACGAGAAGATATATGTATTCCTTTGGTTTT
GGGTATTATATAATACCCAAAACCAAAGGAATACATATATCTTCTCGTTC
AACATATTTATTGGAAGAGCACATTGTGCAACATATCTATTATTGGCTCC
CAAGTGTCTGATTTCTCCAACATAA
back to top
Gene Groups
Ddo_013304 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.