Ddo_012914, Ddo_012914 (mRNA) Dugesia dorotocephala

Overview
NameDdo_012914
Unique NameDdo_012914
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length2755
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_012914 vs. uniprot
Match: gi|82082176|sp|Q5ZKK5|ODFP2_CHICK (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 259.225 bits (661), Expect = 6.788e-72
Identity = 246/852 (28.87%), Postives = 421/852 (49.41%), Query Frame = 2
Query:  485 RNRPASP-VHLYVDKSTPVHVYVENGERDESMVDMDARAPGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSSFGSFW----------------------------NEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDL--------DSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS------------KSHADLE-------------------------DGNDELLSK-----------------------PLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRE-------------NENLRSIADQCESRLKDVEKEMKILRKT---MSEDNDD-QNTDKINR-LSKIL-----------EKLEASEKSNQASQ-------TRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNS 2641
            +NR +SP +H++VD++TPVHV+++ G++           P +       K++     G+ V+ R   RAV     +V++ +P W+PP GKTS    S++   W                            +E++A   +   YE++I+ L+N VG L+ + K++KQ ++ + +   L  Q+ ++ E+ QE+   E EN +LR ++++ R   DL          E E L+  L EAE      A ++  +  +++ +  E H ++  D++ L+        +L  F+  +  LR++L+E  +RE      LEK    L+KM  + D    +L++ L DK+K I++L  Q+  + ++    +   +SLESV+GHLQ QL+ K  + NR++ QIR LE   A+ + + E + + LK  + +   D+DALK+A R QK+RA + EE   +L   LAEK+ ++ + L +            K  +DLE                         +  D L+ K                       P+ E  +Q  +  ++ + ++R+ +D++E     + ++L +  E   +A K E             N+ L     Q +S+L ++EK  +ILR T   ++E  D  Q+ +K N  LS ++           +K+E + +  Q++Q        + EELE+K+     QN+E    I  ++ S+   + + ++  RE SSL RQLE A+ D++R  +  RE+   ++R  QS++ D E+QL++ + E N+ RRN E+ ER+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVF D  L   L  P  S
Sbjct:    2 KNRSSSPPLHVHVDENTPVHVHIKKGQKT---------TPAKCQQKHKQKMK-----GNTVNVR---RAV-----QVKTKAP-WMPP-GKTS-VLDSTYK--WEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQMTKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERLNVEKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERERDVQKILEK-QGVLMKMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLKELRQKADRDKDALKRALRAQKERAERSEECAGQLAVQLAEKDSYVAEALSTLESWRSRYNKVVKDKSDLELEMVTVNSRIADLLEQQATLEDKMREDRDALMDKLHQQTTETTSFRMENERLKASVVPMEEKLNQAHVEVQQLKSSVRNYEDLIE---TYKSQVLKTRMEAADVAAKLEKCDNEKKALKDEMNKELELARKQFQSQLAELEKLPEILRITETQLAECQDQLQSYEKKNMDLSVMIADLRQRIELQGDKMEMTRERYQSAQEEKKQLTLKAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSAL---LGSPGRS 818          
BLAST of Ddo_012914 vs. uniprot
Match: gi|82179654|sp|Q5PQ23|ODFP2_XENLA (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2 [Xenopus laevis])

HSP 1 Score: 150.599 bits (379), Expect = 1.847e-36
Identity = 131/434 (30.18%), Postives = 221/434 (50.92%), Query Frame = 2
Query:  485 RNR-PASPVHLYVDKSTPVHVYVENGERDESMVDMDAR----APGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQR-------EQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTR--------SNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKES--QQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQEL 1720
            +NR P+ P+H++VD+STPVHV+++   R  +     A+      G    S   K + P  P  + S R          HR+  ++PP         R S  S     +E+E   S+   YE++I  L++E+G L+ +L+++K+        EQL  S   L  Q+ ++ E+ QE+   E EN  L+ SLD+ +            L  E   L+  L+EAE      A Q+  + D+++ + K   ++T  D++ L+        +L  F+  +  LR +L+E   Q+ E YR   L +    L+K  ++ D     L+L+L ++++ ++DL  QL ++ D +   +   +S+ES K HLQ QL+ +  + NR+SVQIR LE   A ++ +   LME L   K +   +++ALKK+ R QKQRA + EET++ L
Sbjct:    2 KNRSPSPPLHVHVDESTPVHVHIKKSSRPPAKTQQGAKLKKKGMGNLRRSATVKTKVPWIPPGKSSLRDAGLKWEGLTHRL-DITPPDTERMFSALRMSDLST----DEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQRL-KHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLREQHRQETETYR---LMEQKEMLLKKLSDADTEKMHLQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLERNEAHQKEEIVKLMEQLTELKQKVDSEKEALKKSVRAQKQRAERSEETLEML 426          
BLAST of Ddo_012914 vs. uniprot
Match: gi|158564320|sp|Q6AYX5|ODFP2_RAT (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 132.494 bits (332), Expect = 2.699e-30
Identity = 125/459 (27.23%), Postives = 232/459 (50.54%), Query Frame = 2
Query:  503 PVHLYVDKSTPVHVYVENGERDESMVDMDARAPGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSSFGSFWN----------------------------EDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            P+H++VD++TPVHV+++             + P  + AS     +R  K G  V+ R   R+V     RV++   PW+PP   ++R+     G  W                             +D++   +  RY+++I+ L+N VG L+ ++K++K   Q+  +   L  ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  + K   ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D++ LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:    9 PLHVHVDENTPVHVHIK-------------KLPKPSAASSQKSHKRGMK-GDTVNVR---RSV-----RVKT-KVPWMPPGKSSARH----VGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKL-KTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 435          

HSP 2 Score: 123.25 bits (308), Expect = 1.828e-27
Identity = 74/179 (41.34%), Postives = 115/179 (64.25%), Query Frame = 2
Query: 2120 EKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL--SCPNNSFVP 2650
            EK +AS+K N+    +++ELE+K+     QN+E    I  ++ ++   + + ++  RE  SL RQLE+A+ D+RR  +  +E+ + K+R  QS+I D E+QL++ + E  + RR  ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P ++    S P  S  P
Sbjct:  645 EKHQASQKENKQLSQKVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSPIRSRSP 823          
BLAST of Ddo_012914 vs. uniprot
Match: gi|75041498|sp|Q5R829|ODFP2_PONAB (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 126.716 bits (317), Expect = 1.193e-28
Identity = 120/441 (27.21%), Postives = 228/441 (51.70%), Query Frame = 2
Query:  503 PVHLYVDKSTPVHVYVENGERDESMVDMDARAPG----RTDASRAGKIRR--PRKPGSRVSARPLARAVPSAVHRVRSMSPPW---VPPPGKTSRNSKSSFGSFWNEDE-ADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            P+H++VD++TPVHV+++   +  +     +   G      +  R+ +++   P  P  + SARP+           +  +PP    + PP      S         ED+ +   +  RY+++I+ L+N VG L+ ++K++K   Q+  +   L  ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F   +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D+++LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:    9 PLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVG---------CKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTE-KQMTCTDINTLTRQKELLLQKLSTFGETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLRDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 435          
BLAST of Ddo_012914 vs. uniprot
Match: gi|158513400|sp|A3KGV1|ODFP2_MOUSE (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 124.405 bits (311), Expect = 9.151e-28
Identity = 74/179 (41.34%), Postives = 115/179 (64.25%), Query Frame = 2
Query: 2120 EKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL--SCPNNSFVP 2650
            EK +AS+K N+    +++ELE+K+     QN+E    I  ++ ++   + + ++  RE  SL RQLE+A+ D+RR  +  +E+ + K+R  QS+I D E+QL++ + E  + RR  ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P ++    S P  S  P
Sbjct:  650 EKHQASQKENKQLSQKVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSPIRSRSP 828          

HSP 2 Score: 115.931 bits (289), Expect = 3.772e-25
Identity = 104/384 (27.08%), Postives = 196/384 (51.04%), Query Frame = 2
Query:  728 PWVPPPGKTSRNSKSSFGSFWN----------------------------EDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            PW+PP   ++R+     G  W                             +D++   +  RY+++I+ L+N VG L+ ++K++K   Q+  +   L  ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D++ LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:   66 PWMPPGKSSARH----VGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTE-KQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGTLLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 440          
BLAST of Ddo_012914 vs. Smed Unigenes AA
Match: SMU15005577 (SmedAsxldir_c106665_g2_i7|m.77472|m.45171)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 510/777 (65.64%), Postives = 633/777 (81.47%), Query Frame = 2
Query:  455 MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKS----------HAD-------LEDGNDEL-LSKPLTELCD-----------------QCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF* 2680
            MS K  K + R+RP+SPVHL+VDK TPVHVY++ G+RD    D +A    ++ + ++ K++RPRKPGS V   P +R + S   RVRSMSPPWVPPPGKT++  KS  GS+WNEDEAD SQ++RY QQI +L NEVGEL+EQLK EKQ +QLR++ +A+  Q+ K+EELKQEIDV+EKENH+LRDSL+KTRSNL+L+S+SE+L+Q LIE ELA ERCAHQMQHVFD L+NI+ EGHKV+ RD+DR+STLFHDTESRLFDFKS+SN LRD+LK  Q RE+   +S EK+N FL K+R+ELD+NISKLELEL +K+K+IDDL+KQL +KNDE+INFASTHESLE++KGHLQQQLKQKSGDCNR+SVQIRTLE+ELAKERLDKEHL+E+LK  KDR YDDR  LKKAAR QKQRALK EET+Q+LT+IL  KERHIEQL+ SK+          H D           ND+L +      LC                  QC++NS+E Q+ LRH++DI +EN+ L ++M N++QEEII +LK+ENENLRSIADQCESRL+DVE+EMK +R+TM+E+NDD++ +++N+LSKILEKLE SEKSNQ+SQ RIE+LE+K++NLE QN EMKN +Q KDSS IDN+CKA++L REN+SLMRQLEAALTDS+RN+DN R+KNVG+DRQLQSRIH+ ESQLA Q+AE+NKW RNCEETERK ++KLQD+KIQLEQ+EITNRS+QTYVQFLKKSYANVFGD+PLSNGLSCPN S++ Q SL+F GF*
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNA---PKSHSIKSTKMKRPRKPGSNV---PTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHCPEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQ-SLSFNGF* 770          
BLAST of Ddo_012914 vs. Smed Unigenes AA
Match: SMU15005576 (SmedAsxldir_c106665_g2_i15|m.77482|m.8142)

HSP 1 Score: 990.719 bits (2560), Expect = 0.000e+0
Identity = 506/763 (66.32%), Postives = 629/763 (82.44%), Query Frame = 2
Query:  455 MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSS------------------FGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGNDELL---SKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF* 2680
            MS K  K + R+RP+SPVHL+VDK TPVHVY++ G+RD    D +A    ++ + ++ K++RPRKPGS V   P +R + S   RVRSMSPPWVPPPGKT+++ KS+                   GS+WNEDEAD SQ++RY QQI +L NEVGEL+EQLK EKQ +QLR++ +A+  Q+ K+EELKQEIDV+EKENH+LRDSL+KTRSNL+L+S+SE+L+Q LIE ELA ERCAHQMQHVFD L+NI+ EGHKV+ RD+DR+STLFHDTESRLFDFKS+SN LRD+LK  Q RE+   +S EK+N FL K+R+ELD+NISKLELEL +K+K+IDDL+KQL +KNDE+INFASTHESLE++KGHLQQQLKQKSGDCNR+SVQIRTLE+ELAKERLDKEHL+E+LK  KDR YDDR  LKKAAR QKQRALK EET+Q+LT+IL  KERHIEQL+  +        ND  L   SK       QC++NS+E Q+ LRH++DI +EN+ L ++M N++QEEII +LK+ENENLRSIADQCESRL+DVE+EMK +R+TM+E+NDD++ +++N+LSKILEKLE SEKSNQ+SQ RIE+LE+K++NLE QN EMKN +Q KDSS IDN+CKA++L REN+SLMRQLEAALTDS+RN+DN R+KNVG+DRQLQSRIH+ ESQLA Q+AE+NKW RNCEETERK ++KLQD+KIQLEQ+EITNRS+QTYVQFLKKSYANVFGD+PLSNGLSCPN S++ Q SL+F GF*
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNA---PKSHSIKSTKMKRPRKPGSNV---PTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMLCQ--------NDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQ-SLSFNGF* 748          
BLAST of Ddo_012914 vs. Smed Unigenes AA
Match: SMU15005578 (SmedAsxldir_c106665_g2_i9|m.77475|m.37289)

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 506/797 (63.49%), Postives = 628/797 (78.80%), Query Frame = 2
Query:  455 MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKS---HADLEDGNDELLSKPLTELCDQCK----------------------------------------------------LNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF* 2680
            MS K  K + R+RP+SPVHL+VDK TPVHVY++ G+RD    D +A    ++ + ++ K++RPRKPGS V   P +R + S   RVRSMSPPWVPPPGKT++  KS  GS+WNEDEAD SQ++RY QQI +L NEVGEL+EQLK EKQ +QLR++ +A+  Q+ K+EELKQEIDV+EKENH+LRDSL+KTRSNL+L+S+SE+L+Q LIE ELA ERCAHQMQHVFD L+NI+ EGHKV+ RD+DR+STLFHDTESRLFDFKS+SN LRD+LK  Q RE+   +S EK+N FL K+R+ELD+NISKLELEL +K+K+IDDL+KQL +KNDE+INFASTHESLE++KGHLQQQLKQKSGDCNR+SVQIRTLE+ELAKERLDKEHL+E+LK  KDR YDDR  LKKAAR QKQRALK EET+Q+LT+IL  KERHIEQL+ SK+   HA             ++  CD C                                                     +NS+E Q+ LRH++DI +EN+ L ++M N++QEEII +LK+ENENLRSIADQCESRL+DVE+EMK +R+TM+E+NDD++ +++N+LSKILEKLE SEKSNQ+SQ RIE+LE+K++NLE QN EMKN +Q KDSS IDN+CKA++L REN+SLMRQLEAALTDS+RN+DN R+KNVG+DRQLQSRIH+ ESQLA Q+AE+NKW RNCEETERK ++KLQD+KIQLEQ+EITNRS+QTYVQFLKKSYANVFGD+PLSNGLSCPN S++ Q SL+F GF*
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNA---PKSHSIKSTKMKRPRKPGSNV---PTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHA-----------SAVSNHCDHCPEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSFSNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQ-SLSFNGF* 779          
BLAST of Ddo_012914 vs. Smed Unigenes AA
Match: SMU15001741 (Asxlregen_comp65555_c0_seq4|m.19436|m.7732)

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 499/760 (65.66%), Postives = 620/760 (81.58%), Query Frame = 2
Query:  455 MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPGRTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKTSRNSKSS------------------FGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGNDELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF* 2680
            MS K  K + R+RP+SPVHL+VDK TPVHVY++ G+RD    D +A    ++ + ++ K++RPRKPGS V   P +R + S   RVRSMSPPWVPPPGKT+++ KS+                   GS+WNEDEAD SQ++RY QQI +L NEVGEL+EQLK EKQ +QLR++ +A+  Q+ K+EELKQEIDV+EKENH+LRDSL+KTRSNL+L+S+SE+L+Q LIE ELA ERCAHQMQHVFD L+NI+ EGHKV+ RD+DR+STLFHDTESRLFDFKS+SN LRD+LK  Q RE+   +S EK+N FL K+R+ELD+NISKLELEL +K+K+IDDL+KQL +KNDE+INFASTHESLE++KGHLQQQLKQKSGDCNR+SVQIRTLE+ELAKERLDKEHL+E+LK  KDR YDDR  LKKAAR QKQRALK EET+Q+LT+IL  KERHIEQL+                            +NS+E Q+ LRH++DI +EN+ L ++M N++QEEII +LK+ENENLRSIADQCESRL+DVE+EMK +R+TM+E+NDD++ +++N+LSKILEKLE SEKSNQ+SQ RIE+LE+K++NLE QN EMKN +Q KDSS IDN+CKA++L REN+SLMRQLEAALTDS+RN+DN R+KNVG+DRQLQSRIH+ ESQLA Q+AE+NKW RNCEETERK ++KLQD+KIQLEQ+EITNRS+QTYVQFLKKSYANVFGD+PLSNGLSCPN S++ Q SL+F GF*
Sbjct:    1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNA---PKSHSIKSTKMKRPRKPGSNV---PTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLM----------------------------INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQ-SLSFNGF* 725          
BLAST of Ddo_012914 vs. RefSeq Human
Match: gi|334278913|ref|NP_001229281.1| (outer dense fiber protein 2 isoform 11 [Homo sapiens])

HSP 1 Score: 136.732 bits (343), Expect = 5.000e-32
Identity = 120/441 (27.21%), Postives = 229/441 (51.93%), Query Frame = 2
Query:  503 PVHLYVDKSTPVHVYVENGERDESMVDMDARAPG----RTDASRAGKIRR--PRKPGSRVSARPLARAVPSAVHRVRSMSPPW---VPPPGKTSRNSKSSFGSFWNEDE-ADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            P+H++VD++TPVHV+++   +  +     +   G      +  R+ +++   P  P  + SARP+           +  +PP    + PP      S         ED+ +   +  RY+++I+ L+N VG L+ ++K++K   Q+  +   L  ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D+++LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:    9 PLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVG---------CKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEK-QMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 435          

HSP 2 Score: 124.405 bits (311), Expect = 3.473e-28
Identity = 74/178 (41.57%), Postives = 117/178 (65.73%), Query Frame = 2
Query: 2120 EKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL-SCPNNSFVP 2650
            EK +AS+K N+    +++ELE+K+     QN+E    I  ++ ++  ++ + ++  RE  +L RQLE+A+ D+RR  +  +E  + K+R  Q++I D E+QL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P S  L S P  S  P
Sbjct:  645 EKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSP 822          
BLAST of Ddo_012914 vs. RefSeq Human
Match: gi|767957560|ref|XP_011517032.1| (PREDICTED: outer dense fiber protein 2 isoform X8 [Homo sapiens])

HSP 1 Score: 136.732 bits (343), Expect = 5.505e-32
Identity = 122/454 (26.87%), Postives = 236/454 (51.98%), Query Frame = 2
Query:  467 LVKSVQRNRPASP-VHLYVDKSTPVHVYVENGERDESMVDMDARAPG----RTDASRAGKIRR--PRKPGSRVSARPLARAVPSAVHRVRSMSPPW---VPPPGKTSRNSKSSFGSFWNEDE-ADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            + K   ++R ++P +H++VD++TPVHV+++   +  +     +   G      +  R+ +++   P  P  + SARP+           +  +PP    + PP      S         ED+ +   +  RY+++I+ L+N VG L+ ++K++K   Q+  +   L  ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D+++LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:   84 VTKPTMKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVG---------CKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQM--AKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTE-KQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 523          

HSP 2 Score: 123.635 bits (309), Expect = 7.521e-28
Identity = 74/178 (41.57%), Postives = 117/178 (65.73%), Query Frame = 2
Query: 2120 EKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL-SCPNNSFVP 2650
            EK +AS+K N+    +++ELE+K+     QN+E    I  ++ ++  ++ + ++  RE  +L RQLE+A+ D+RR  +  +E  + K+R  Q++I D E+QL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P S  L S P  S  P
Sbjct:  733 EKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSP 910          
BLAST of Ddo_012914 vs. RefSeq Human
Match: gi|767957548|ref|XP_011517026.1| (PREDICTED: outer dense fiber protein 2 isoform X5 [Homo sapiens])

HSP 1 Score: 136.346 bits (342), Expect = 6.695e-32
Identity = 121/454 (26.65%), Postives = 234/454 (51.54%), Query Frame = 2
Query:  467 LVKSVQRNRPASP-VHLYVDKSTPVHVYVENGERDESMVDMDARAPG----RTDASRAGKIRR--PRKPGSRVSARPLARAVPSAVHRVRSMSPPW---VPPPGKTSRNSKSSFGSFWNEDE-ADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            + K   ++R ++P +H++VD++TPVHV+++   +  +     +   G      +  R+ +++   P  P  + SARP+           +  +PP    + PP      S         ED+ +   +  RY+++I+ L+N VG L+ ++K++K   Q+         ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D+++LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:   40 VTKPTMKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVG---------CKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLE--ERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTE-KQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 479          

HSP 2 Score: 118.627 bits (296), Expect = 2.337e-26
Identity = 72/179 (40.22%), Postives = 114/179 (63.69%), Query Frame = 2
Query: 2117 LEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL-SCPNNSFVP 2650
            +E LEA E + Q S+ ++   + K+     QN+E    I  ++ ++  ++ + ++  RE  +L RQLE+A+ D+RR  +  +E  + K+R  Q++I D E+QL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P S  L S P  S  P
Sbjct:  740 VEGLEALEGTRQTSEEKLLPFQWKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSP 918          
BLAST of Ddo_012914 vs. RefSeq Human
Match: gi|767957550|ref|XP_011517027.1| (PREDICTED: outer dense fiber protein 2 isoform X5 [Homo sapiens])

HSP 1 Score: 136.346 bits (342), Expect = 6.695e-32
Identity = 121/454 (26.65%), Postives = 234/454 (51.54%), Query Frame = 2
Query:  467 LVKSVQRNRPASP-VHLYVDKSTPVHVYVENGERDESMVDMDARAPG----RTDASRAGKIRR--PRKPGSRVSARPLARAVPSAVHRVRSMSPPW---VPPPGKTSRNSKSSFGSFWNEDE-ADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            + K   ++R ++P +H++VD++TPVHV+++   +  +     +   G      +  R+ +++   P  P  + SARP+           +  +PP    + PP      S         ED+ +   +  RY+++I+ L+N VG L+ ++K++K   Q+         ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D+++LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:   40 VTKPTMKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVG---------CKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLE--ERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTE-KQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 479          

HSP 2 Score: 118.627 bits (296), Expect = 2.337e-26
Identity = 72/179 (40.22%), Postives = 114/179 (63.69%), Query Frame = 2
Query: 2117 LEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL-SCPNNSFVP 2650
            +E LEA E + Q S+ ++   + K+     QN+E    I  ++ ++  ++ + ++  RE  +L RQLE+A+ D+RR  +  +E  + K+R  Q++I D E+QL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P S  L S P  S  P
Sbjct:  740 VEGLEALEGTRQTSEEKLLPFQWKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSP 918          
BLAST of Ddo_012914 vs. RefSeq Human
Match: gi|767957552|ref|XP_011517028.1| (PREDICTED: outer dense fiber protein 2 isoform X5 [Homo sapiens])

HSP 1 Score: 136.346 bits (342), Expect = 6.695e-32
Identity = 121/454 (26.65%), Postives = 234/454 (51.54%), Query Frame = 2
Query:  467 LVKSVQRNRPASP-VHLYVDKSTPVHVYVENGERDESMVDMDARAPG----RTDASRAGKIRR--PRKPGSRVSARPLARAVPSAVHRVRSMSPPW---VPPPGKTSRNSKSSFGSFWNEDE-ADFSQQERYEQQINDLLNEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLD--------LDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQS 1771
            + K   ++R ++P +H++VD++TPVHV+++   +  +     +   G      +  R+ +++   P  P  + SARP+           +  +PP    + PP      S         ED+ +   +  RY+++I+ L+N VG L+ ++K++K   Q+         ++ ++EE+  E+   E EN +LR ++++ +   D        L  E E L+  L+EAE+     A Q+  + D++  +  E  ++T  D++ L+        +L  F+  +  LRD+L+E   +E   ++ L +    L+K   E D   ++L L L DKDK +++L +++  +  +    +   +S+ES++GHLQ QL+ K  + +R+ +QI+ LE    + + + E +ME LK  K +   D+++LKKA R QK+RA K EE  ++L   LA+K+ ++ + L +
Sbjct:   40 VTKPTMKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKVPWMPPGKSSARPVG---------CKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLE--ERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTE-KQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHVQLADKDLYVAEALST 479          

HSP 2 Score: 118.627 bits (296), Expect = 2.337e-26
Identity = 72/179 (40.22%), Postives = 114/179 (63.69%), Query Frame = 2
Query: 2117 LEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGL-SCPNNSFVP 2650
            +E LEA E + Q S+ ++   + K+     QN+E    I  ++ ++  ++ + ++  RE  +L RQLE+A+ D+RR  +  +E  + K+R  Q++I D E+QL++ + E ++ RR+ ++ +R+  S+LQDLK +LEQ+E TNRS+Q YVQFLK SYANVFGD P S  L S P  S  P
Sbjct:  740 VEGLEALEGTRQTSEEKLLPFQWKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSP 918          
The following BLAST results are available for this feature:
BLAST of Ddo_012914 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|82082176|sp|Q5ZKK5|ODFP2_CHICK6.788e-7228.87RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82179654|sp|Q5PQ23|ODFP2_XENLA1.847e-3630.18RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158564320|sp|Q6AYX5|ODFP2_RAT2.699e-3027.23RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|75041498|sp|Q5R829|ODFP2_PONAB1.193e-2827.21RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158513400|sp|A3KGV1|ODFP2_MOUSE9.151e-2841.34RecName: Full=Outer dense fiber protein 2; AltName... [more]
back to top
BLAST of Ddo_012914 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150055770.000e+065.64SmedAsxldir_c106665_g2_i7|m.77472|m.45171[more]
SMU150055760.000e+066.32SmedAsxldir_c106665_g2_i15|m.77482|m.8142[more]
SMU150055780.000e+063.49SmedAsxldir_c106665_g2_i9|m.77475|m.37289[more]
SMU150017410.000e+065.66Asxlregen_comp65555_c0_seq4|m.19436|m.7732[more]
back to top
BLAST of Ddo_012914 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|334278913|ref|NP_001229281.1|5.000e-3227.21outer dense fiber protein 2 isoform 11 [Homo sapie... [more]
gi|767957560|ref|XP_011517032.1|5.505e-3226.87PREDICTED: outer dense fiber protein 2 isoform X8 ... [more]
gi|767957548|ref|XP_011517026.1|6.695e-3226.65PREDICTED: outer dense fiber protein 2 isoform X5 ... [more]
gi|767957550|ref|XP_011517027.1|6.695e-3226.65PREDICTED: outer dense fiber protein 2 isoform X5 ... [more]
gi|767957552|ref|XP_011517028.1|6.695e-3226.65PREDICTED: outer dense fiber protein 2 isoform X5 ... [more]
back to top
BLAST of Ddo_012914 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_012914 ID=Ddo_012914|Name=Ddo_012914|organism=Dugesia dorotocephala|type=mRNA|length=2755bp
GCACCTTTTGCATCTCGATCATTTTATAAAAATCGTGTAACGTATTCTCC
AAAGGACTTTTTCTCGTTGATTGTGCTTCGTGCATATTTTAATTAAAAAA
TGATGATATTATTAATCGGAATATTACTAAATCAAAATCTCAGAGTGATC
GGATGAAAATAGAGAATTCTTTGCTAATAAAATACAGAAGATGATTTATC
AGATCAATTCACAAATCAAACAAAGAACGCACGAGTTGAGTGTTGAAATT
CGTCAGTGAAATTATTCACACACACACTAATACATACACACACACGAATT
GAAACACACAATCAACCAATAAAATTCATCTAATCTATTCTCAGTTTGTT
TTCTCGTTAGCAACCTCAGCTTCTCTAGTTACAATATTGAATACATTAAT
TCAATTATCGATTATTTGATAATATTAATTGAAAAGTGGAATTAATCGAC
GAAAATGTCACACAAGCTCGTTAAAAGTGTTCAGAGAAATCGACCGGCGA
GTCCGGTTCATTTGTACGTGGACAAGAGCACTCCGGTGCATGTGTACGTG
GAGAATGGGGAGAGAGACGAGTCGATGGTAGATATGGATGCGCGTGCGCC
TGGTAGGACCGATGCCAGTCGGGCCGGCAAGATCAGAAGGCCCAGGAAGC
CAGGCTCACGCGTATCTGCAAGGCCGCTGGCGCGTGCCGTGCCTTCCGCG
GTCCACAGAGTGCGCTCGATGTCGCCTCCGTGGGTGCCGCCGCCCGGCAA
GACCTCCAGAAACTCTAAATCCTCATTCGGTTCATTTTGGAATGAAGATG
AGGCTGACTTTAGTCAACAAGAACGTTACGAACAACAAATTAATGATCTA
TTAAATGAAGTTGGAGAGCTTCAAGAACAGCTAAAAATCGAAAAACAGCG
TGAGCAGTTGCGCAACAGTCATGAAGCTCTTCACTATCAAGAGGGAAAAA
TTGAAGAACTGAAACAAGAAATTGATGTCATAGAAAAGGAAAACCATATT
TTACGGGACAGTTTGGATAAAACTCGGTCCAATTTGGATCTAGATTCTGA
ATCTGAGAAGCTTATTCAGACATTAATAGAAGCAGAGTTGGCTAGTGAAC
GCTGTGCTCACCAGATGCAACACGTTTTCGATTCATTGAAGAATATTGTA
AAAGAAGGTCATAAAGTAACGGGTCGTGATGTTGACAGACTTTCTACGTT
ATTTCATGACACTGAATCTCGGCTTTTTGACTTCAAATCTATTAGTAATG
TTTTAAGAGACATGCTAAAGGAATCGCAACAAAGAGAAATGTATAGAAAT
GATTCTCTTGAAAAAGACAATAATTTTTTGATAAAAATGCGCAATGAATT
GGATGAAAATATTTCTAAACTGGAATTAGAATTGAGCGATAAAGATAAAG
TTATTGACGATCTTCGAAAGCAGTTGGTGTCTAAGAATGATGAAACAATT
AATTTCGCGAGTACCCATGAATCTCTAGAGAGTGTTAAAGGTCACTTGCA
GCAGCAATTGAAGCAGAAATCTGGGGATTGTAATCGTATGTCTGTTCAAA
TACGGACCTTGGAAAATGAACTTGCCAAAGAAAGATTGGACAAAGAACAT
CTGATGGAAATGTTAAAAGGTTCTAAAGATCGTACTTATGATGACAGAGA
CGCTTTGAAAAAAGCAGCTCGTTTACAGAAGCAGAGAGCTTTGAAAGGAG
AAGAAACAATTCAAGAACTAACAGCTATTCTTGCAGAAAAAGAGCGACAC
ATTGAGCAATTATTACAATCTAAATCACATGCGGATTTAGAGGATGGTAA
TGATGAGTTGCTGAGTAAACCGCTCACAGAACTATGTGACCAATGTAAAT
TGAATAGTCGAGAGTATCAACAGAATCTGAGACACATAGACGATATTGTG
GAAGAAAACGAACAATTACGAAGAAAAATGCTCAACAGCAATCAAGAAGA
GATTATTATTGCCTTAAAAAGAGAAAATGAAAATCTCCGCTCAATTGCTG
ATCAATGTGAATCCAGATTGAAGGATGTTGAAAAGGAAATGAAAATATTA
CGGAAAACAATGTCGGAAGACAATGACGACCAAAATACTGACAAAATTAA
TAGATTATCTAAAATTCTAGAAAAGCTAGAAGCATCAGAGAAATCCAACC
AAGCTAGTCAAACGCGAATAGAGGAATTGGAAAAGAAAATACGGAACTTA
GAAGGTCAAAATTTAGAAATGAAAAACACAATTCAATTGAAAGACAGTAG
CGTTATTGATAACAGATGTAAAGCTGACGATCTGATGAGGGAGAACTCAT
CTTTGATGCGCCAATTAGAAGCCGCTTTGACCGACTCAAGGAGAAACGCT
GACAATGTCCGAGAAAAAAATGTCGGCAAAGATCGTCAGTTGCAATCTCG
AATCCATGACGCTGAATCTCAACTGGCGCAACAGCGCGCAGAGACGAATA
AATGGCGCAGAAACTGTGAAGAAACGGAGAGAAAGAACAGCAGTAAATTA
CAGGACCTCAAAATCCAACTGGAACAAGCTGAAATAACGAATCGAAGCTT
GCAAACCTATGTTCAGTTTTTGAAGAAATCGTATGCCAATGTGTTCGGAG
ATCTGCCCCTTTCAAACGGCCTCAGTTGTCCGAACAACTCATTCGTGCCC
CAATCATCGCTGAATTTCGGGGGCTTCTAAACACTCATCGACTATCCAAT
ACAATTTTGATATTTATTTTATTTGTATTCAACGAGAATGAAATAGAAAT
TATTC

Design Primers for Ddo_012914

back to top

protein sequence

>Ddo_012914-protein ID=Ddo_012914-protein|Name=Ddo_012914|organism=Dugesia dorotocephala|type=polypeptide|length=742bp
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGND
ELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEI
IIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINR
LSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSV
IDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRI
HDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQ
TYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
back to top

coding sequence

>Ddo_012914.455.2680 ID=Ddo_012914.455.2680|Name=Ddo_012914.455.2680|organism=Dugesia dorotocephala|type=CDS|length=2226bp
ATGTCACACAAGCTCGTTAAAAGTGTTCAGAGAAATCGACCGGCGAGTCC
GGTTCATTTGTACGTGGACAAGAGCACTCCGGTGCATGTGTACGTGGAGA
ATGGGGAGAGAGACGAGTCGATGGTAGATATGGATGCGCGTGCGCCTGGT
AGGACCGATGCCAGTCGGGCCGGCAAGATCAGAAGGCCCAGGAAGCCAGG
CTCACGCGTATCTGCAAGGCCGCTGGCGCGTGCCGTGCCTTCCGCGGTCC
ACAGAGTGCGCTCGATGTCGCCTCCGTGGGTGCCGCCGCCCGGCAAGACC
TCCAGAAACTCTAAATCCTCATTCGGTTCATTTTGGAATGAAGATGAGGC
TGACTTTAGTCAACAAGAACGTTACGAACAACAAATTAATGATCTATTAA
ATGAAGTTGGAGAGCTTCAAGAACAGCTAAAAATCGAAAAACAGCGTGAG
CAGTTGCGCAACAGTCATGAAGCTCTTCACTATCAAGAGGGAAAAATTGA
AGAACTGAAACAAGAAATTGATGTCATAGAAAAGGAAAACCATATTTTAC
GGGACAGTTTGGATAAAACTCGGTCCAATTTGGATCTAGATTCTGAATCT
GAGAAGCTTATTCAGACATTAATAGAAGCAGAGTTGGCTAGTGAACGCTG
TGCTCACCAGATGCAACACGTTTTCGATTCATTGAAGAATATTGTAAAAG
AAGGTCATAAAGTAACGGGTCGTGATGTTGACAGACTTTCTACGTTATTT
CATGACACTGAATCTCGGCTTTTTGACTTCAAATCTATTAGTAATGTTTT
AAGAGACATGCTAAAGGAATCGCAACAAAGAGAAATGTATAGAAATGATT
CTCTTGAAAAAGACAATAATTTTTTGATAAAAATGCGCAATGAATTGGAT
GAAAATATTTCTAAACTGGAATTAGAATTGAGCGATAAAGATAAAGTTAT
TGACGATCTTCGAAAGCAGTTGGTGTCTAAGAATGATGAAACAATTAATT
TCGCGAGTACCCATGAATCTCTAGAGAGTGTTAAAGGTCACTTGCAGCAG
CAATTGAAGCAGAAATCTGGGGATTGTAATCGTATGTCTGTTCAAATACG
GACCTTGGAAAATGAACTTGCCAAAGAAAGATTGGACAAAGAACATCTGA
TGGAAATGTTAAAAGGTTCTAAAGATCGTACTTATGATGACAGAGACGCT
TTGAAAAAAGCAGCTCGTTTACAGAAGCAGAGAGCTTTGAAAGGAGAAGA
AACAATTCAAGAACTAACAGCTATTCTTGCAGAAAAAGAGCGACACATTG
AGCAATTATTACAATCTAAATCACATGCGGATTTAGAGGATGGTAATGAT
GAGTTGCTGAGTAAACCGCTCACAGAACTATGTGACCAATGTAAATTGAA
TAGTCGAGAGTATCAACAGAATCTGAGACACATAGACGATATTGTGGAAG
AAAACGAACAATTACGAAGAAAAATGCTCAACAGCAATCAAGAAGAGATT
ATTATTGCCTTAAAAAGAGAAAATGAAAATCTCCGCTCAATTGCTGATCA
ATGTGAATCCAGATTGAAGGATGTTGAAAAGGAAATGAAAATATTACGGA
AAACAATGTCGGAAGACAATGACGACCAAAATACTGACAAAATTAATAGA
TTATCTAAAATTCTAGAAAAGCTAGAAGCATCAGAGAAATCCAACCAAGC
TAGTCAAACGCGAATAGAGGAATTGGAAAAGAAAATACGGAACTTAGAAG
GTCAAAATTTAGAAATGAAAAACACAATTCAATTGAAAGACAGTAGCGTT
ATTGATAACAGATGTAAAGCTGACGATCTGATGAGGGAGAACTCATCTTT
GATGCGCCAATTAGAAGCCGCTTTGACCGACTCAAGGAGAAACGCTGACA
ATGTCCGAGAAAAAAATGTCGGCAAAGATCGTCAGTTGCAATCTCGAATC
CATGACGCTGAATCTCAACTGGCGCAACAGCGCGCAGAGACGAATAAATG
GCGCAGAAACTGTGAAGAAACGGAGAGAAAGAACAGCAGTAAATTACAGG
ACCTCAAAATCCAACTGGAACAAGCTGAAATAACGAATCGAAGCTTGCAA
ACCTATGTTCAGTTTTTGAAGAAATCGTATGCCAATGTGTTCGGAGATCT
GCCCCTTTCAAACGGCCTCAGTTGTCCGAACAACTCATTCGTGCCCCAAT
CATCGCTGAATTTCGGGGGCTTCTAA
back to top
Gene Groups
Ddo_012914 is similar in sequence to the genes of this group: GG437
Gene NameGene ID
SMU15001741SMU15001741
SMU15005576SMU15005576
SMU15005577SMU15005577
SMU15005578SMU15005578
Ddo_003032Ddo_003032
Ddo_005045Ddo_005045
Ddo_009916Ddo_009916
Ddo_012914Ddo_012914
Gsp_000977Gsp_000977
Gsp_002888Gsp_002888
Gsp_019027Gsp_019027
Gsp_023053Gsp_023053
Pgr_024273Pgr_024273
Pmo_012872Pmo_012872
odf2Pmo_015154

Gene Group Protein Sequences

>SMU15001741

MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMI
NSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIAD
QCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQ
SSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENAS
LMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNK
WHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGD
MPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005576
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML
CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMA
NNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDK
SEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVL
QQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRD
RQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSE
ITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005577
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQED
QEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESR
LRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIR
IEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQL
EAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNC
EETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSN
GLSCPNPSYMGQSLSFNGF*
>SMU15005578
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSF
SNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLR
SIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSE
KSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELAR
ENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKA
ESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYAN
VFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>Ddo_003032 Ddo_003032
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLQSKSHADLEDGNDELLSKPLTELCDQCKLNSREYQQNLRHIDDIVE
ENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILR
KTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLE
GQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNAD
NVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQ
DLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQ
SSLNFGGF*
>Ddo_005045 Ddo_005045
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENL
RSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEAS
EKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLM
RENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQR
AETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYA
NVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Ddo_009916 Ddo_009916
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLLNSREYQQNLRHI
DDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKE
MKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKK
IRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDS
RRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKN
SSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNN
SFVPQSSLNFGGF*
>Ddo_012914 Ddo_012914
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGND
ELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEI
IIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINR
LSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSV
IDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRI
HDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQ
TYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Gsp_000977 Gsp_000977
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLIMNSREDQDNLRRMDEIIDE
NQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRR
TMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLEN
QNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADN
SREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQD
LKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQS
LSFGGF*
>Gsp_002888 Gsp_002888
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLISNQNQNETKSDSIPVIKSF
NNQYVQCEMNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRE
NDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEK
LETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKT
EELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQL
AQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLK
KSYANVFGDIPLSNGLSCPNPPYIGQSLSFGGF*
>Gsp_019027 Gsp_019027
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIS
NQNQNETKSDSIPVIKSFNNQYVQCEMNSREDQDNLRRMDEIIDENQHLH
RQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEE
NDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEM
KTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKT
VGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQL
EQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQSLSFGG
F*
>Gsp_023053 Gsp_023053
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIM
NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIAD
QCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQ
TSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENAS
LTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANK
WRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGD
IPLSNGLSCPNPPYIGQSLSFGGF*
>Pgr_024273 Pgr_024273
MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDG
LQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTR
GSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDEL
RRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLDESDHL
IQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDT
ESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLN
DTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLK
QKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSLKK
AARLQKQRAQKAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHC
AHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESV
IISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKL
SLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVI
DNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIH
DLEAQLAQQRAEAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHT
YVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF*
>Pmo_012872 Pmo_012872
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMSEFGVPNHISEPNRHCS
HCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHS
LKRENENLRSIADQCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQI
LQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNR
CKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDLE
AQLAQQRAEAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQ
FLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF*
>Pmo_015154 odf2
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMMESRENQEQLGQMNRIA
EENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESL
RHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCE
NQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNAD
NAREKINSKDRSLQSRIHDLEAQLAQQRAEAMKWRRSCEENDRKCSGKLQ
DIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGG
PICF*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.