Ddo_012721, Ddo_012721 (mRNA) Dugesia dorotocephala

Overview
NameDdo_012721
Unique NameDdo_012721
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1412
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_012721 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 218.779 bits (556), Expect = 2.597e-64
Identity = 121/372 (32.53%), Postives = 218/372 (58.60%), Query Frame = 3
Query:   99 EDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLY-KHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGKEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIY 1211
            +D  DKLN+ +T   + +  ++V+ K Y   P+ C++  T +    E Y ENYCWV  T  +  ++ +P N A+     ++R+I YYQWVPF+L L+ ++FY+P I+W+++ + ++G +++S ++ A D+  L  E R ++L+ I   +E+ L+ KH+     ++           N  + ++  G  +   Y ++K LY +N+VGQ+++L +FLG  N S  +G  +L++++NG+EW ++G FPRV+ C + E+KV+G  + +  QC L INM NEKI++F+  W F +   TL S+  WI   +   ++ +F+ ++L   + Y   +   + +F+  FLR DG+FL+ M   + G+L   E+   LW+ Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRL--------KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREWEESGHFPRVTLC-DFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Ddo_012721 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 207.994 bits (528), Expect = 6.377e-59
Identity = 124/396 (31.31%), Postives = 218/396 (55.05%), Query Frame = 3
Query:   99 EDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGK---EKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNFNNYKKLTDQF 1277
            +DF DKLN+ +T   L    ++V+ K Y   P+ C++  T + +  E Y ENYCWV  T  V   E +P+         ++R+I YYQWVPFIL ++ ++FY+P I+W+ + +  +G NL+  ++ A DA  +  E + +++  + R ++D +      RQG   + R    +        +H G ++ + Y  IK LY  NV+ Q ++L   LG  +N L +G+++L ++++  EW +TG+FPRV+ C + E++V+G  + +  QC L INM NEKI++F+  W    GI+T+ +   WI  M    +   F++++L +   +  K   + + + +F   FLR DG+F++ M   + G+L++SE++  LW            ++FNN  +   QF
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYS----RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQG---HSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLG--SNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLC-DFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW------------QDFNNVDRSPTQF 511          
BLAST of Ddo_012721 vs. uniprot
Match: gi|10719983|sp|Q27295|EAT5_CAEEL (RecName: Full=Innexin eat-5; AltName: Full=Abnormal pharyngeal pumping eat-5)

HSP 1 Score: 180.644 bits (457), Expect = 1.025e-49
Identity = 118/414 (28.50%), Postives = 206/414 (49.76%), Query Frame = 3
Query:   54 LNLVGQYQLSTYVGLEDFA-DKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQG-KIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGKEK--------------LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNF 1247
            +N++G         L+D   D+LN+ ++ + ++   + +T + Y   PL C++    + + +E Y E+YC+V+ T  V  N+ +P    +      S+++ YYQW PFI+ ++   FY+P I W ++   K+G N+   ++TA  A     EERKK ++ ICR I + L K R+  +  K+A  +R         +F    G ++   Y   K +Y  N   Q Y    FLG   N   +G  IL +++ G +W  +G FPR++ C + +++V+G    Y  QC L +NM NEKI++F+ +W   V  +TL         M    K  +F+++FL  +D+ +  EK              +L+++F       D I L+ M   + GD+V +EIV  +W+ +  +   L  + F
Sbjct:    1 MNMLGSMFSMVKPRLDDLGTDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKA-WEQYAEDYCFVYNTYWVKPNDKVPLTVEE----RVSQQLIYYQWAPFIMAIEAAFFYLPVIFWSMLS-TKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRRNEEETTKMAKIQR---------IFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLG--QNDPYWGMRILDDILKGTDWEHSGNFPRIAMC-DFQVRVLGNLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAKLVLQRF 396          
BLAST of Ddo_012721 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 181.03 bits (458), Expect = 1.294e-49
Identity = 126/421 (29.93%), Postives = 229/421 (54.39%), Query Frame = 3
Query:   93 GLEDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGT--IPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPP-EERKKSLERI-CRTIEDMLYKHRDYR---QGKIANFRRTIYDFCNFCVFSKHL-GTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGK-----------EKL---------LINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNFNNYKKLTD 1271
            G +D  D+LN+ +T + L +  ++++ K Y   P+ C+++   S  + E Y+E+YCW+  T  IP+  N      P D +   + ++I YYQWVPFIL  + +MF +P I W++  F ++G N+++ I  A DA  L    +R+K++E I C  ++++  +  + R   +G IA  +           FS+ L G  + + Y   K LY +NVV Q +IL + L   +  + FG+ +LS++  G+ W +TG FPRV+ C + E++ +   N Y  QCAL IN++NEK++ F+  W   + IIT  S   WI+      ++ D++ +F+ + +  + K           E+L         L++ F+++FL+ DGI ++ M   + GD++  ++V  LW     +Y++ ++R F  ++++ D
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENV-----PDDHTA-REEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSF-QSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLC-DFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLW----QEYRERNWREFEEHEEMKD 414          
BLAST of Ddo_012721 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 177.948 bits (450), Expect = 1.041e-48
Identity = 118/401 (29.43%), Postives = 191/401 (47.63%), Query Frame = 3
Query:   99 EDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGKEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDF-RNFNNYKKLTDQFPGKDDSN 1298
            +D  D+L+++ T   L    ++V+ K Y    + C+M     G  +E Y E+YC++  T  +     +P +  D     +   I YYQWVP +L +Q  MFY+P  IW  + + + G +  S I  A        E R K + ++   I D+L        G+   +R           F K LG+   + Y  IK +Y  NV  Q  IL  FLG  N + ++G+   +++  G+EW  +G+FPRV+ C +  ++ +   + Y  QC L INM NEKIY+FI  W  FV I T I+    I R+ F   R ++I+  L         EK +I  F    L+ DG+ L+     + G +VT EI     +++K   ++L   R+F++        PG ++ +
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVED----RQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG--NETFLWGFHTFADLYAGREWQDSGVFPRVTLC-DFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICE---ELFKKHGENLQHNRDFHHGHSTKSTSPGLEEGH 398          
BLAST of Ddo_012721 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 271/413 (65.62%), Postives = 333/413 (80.63%), Query Frame = 3
Query:   36 MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGKEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNFNNYKKLTDQ 1274
            MVA+EFLNL+GQ+++STYVG+EDFADKL+F+F+V  LILSMM+VTIKSY FKPLACY +T P GSNFE Y+ENYCWVHGTI  L  E +PQN  DW+  D +RRI YYQWVPFILGLQCIMFYIPKIIWQIIC+NK+GTNLES +  AN A++ PP ERK  +ERI RTIEDML++HRDYRQG  A  RR +Y+ CNFCVFSKH+GTWL+LSY  IK LY LNV+GQL+I+K FLGF+N +  FGYT+LSNMI+G+EWH+TGIFPRV+YCY   IK +G +N Y+AQCALP+NMLNEKIY+F+  W+  VGI+T ISI +W  RM FL +R+ FIK FL+M   Y+  +K +IN FI EFLR+DG+FL+ M FIN GD++T++IVN L +IYK  YK LDFRN+  Y K  D+
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDK 413          
BLAST of Ddo_012721 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 268/420 (63.81%), Postives = 337/420 (80.24%), Query Frame = 3
Query:   36 MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGKEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNFNNYKKLTDQFPGKDDS 1295
            MVAQEFL+L+ Q++LS+Y GLEDFAD+LNF+F+VV L LSM+IVT K+YFFKPL+CY++TTPSG NF+ YMENYCWVHGTIP L NE +P  P DW++WD  +RITYYQWVPFILGLQCI+FYIPK++W+IIC+NK GTNLE+ I  A D+S LPP ERK  L  I R IED+LY+HRDYRQGK+A  RR IY++CNFCVFSKHLGTWLV +YF IK LY +NV+GQLY++KSFLGF+++   FGYTIL+++I+G+ WH+T  FPRVSYCYN++IK +GA N Y+AQC LP+NMLNEKIYIF+  W+  VGIITL+SI  W+ R++FL KR+ F K+ L M   Y   E L +N FI E+LRYDG+FLI M +IN GD+V +EI+N LW+ YKNKY + DF N+NNY+KL     G+ D 
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKL---ISGRQDD 417          
BLAST of Ddo_012721 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 393.275 bits (1009), Expect = 4.179e-132
Identity = 196/402 (48.76%), Postives = 269/402 (66.92%), Query Frame = 3
Query:   36 MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDGKEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFR 1241
            MVA EF +L+ +       GLED ADK++ +F+V+ L + + IVTIKSY  KP++CY+S  PSG NF+ Y+ENYCW+HGTIP+  N+ L  N   W   +++++I YYQWVPFILGLQCIMFYIPK+IWQI CFN+ GTNL++ IK +   + +P  ER+   E I + IE+ML  HRD+R  KIAN RR++Y  C+  + SK LGT +V SYF  K LY  N +GQL++++S LGF+N    FG  +   +++G E      FPRV +CY   I+ +G  N Y+AQC LP+NMLNEKIY F+  WI  V   T ISI +WI+R+     R  +I  FL M + YD  +K LI++FI +FLR+DG+FL+ M   N GDL+ + +VN LWDIY  KY++ + R
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLR 402          
BLAST of Ddo_012721 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 389.037 bits (998), Expect = 5.224e-130
Identity = 202/425 (47.53%), Postives = 281/425 (66.12%), Query Frame = 3
Query:   36 MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKYDG--KEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNFNNYKKLTDQFPGKDDSNDR 1304
            MVA +F++ + ++Q+S Y G+EDFADK NF+FTV+ L++   IVT+K Y  KP++CY+ST  SG+N   Y+ENYCWV GTIP+  +  +P    +W+  +K  +I YYQWVPF+L LQ IMFYIP++IWQI C+N TGT++   I +AN A H   E R K +  I +TIE MLY+HRD R G++A FRR++Y  C FC+ SK  GT L+  YF IK LY  N + QLY +K FLG +   + FG+ I+ N+INGQ+W  T +FPRV YCY   +K +G +NA +AQC LP+NMLNEKI+ F+  WIF   I+  ISI IWI R    ++R  FI  FL +  +     +EK ++ +F  +FLRYDG+FL+ M  +N GD+V ++IV  LW I+K++Y +   RNF     L+D   G DD  + 
Sbjct:    1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAELNK-YKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCY-VNVKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYAN---RNF-----LSD---GSDDDENH 411          
BLAST of Ddo_012721 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 385.956 bits (990), Expect = 3.083e-129
Identity = 198/426 (46.48%), Postives = 287/426 (67.37%), Query Frame = 3
Query:   36 MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHN-NSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLWIFFVXXXXXXXXXXXXXRMMFLKKRADFIKEFLIMRDKY--DGKEKLLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLDFRNFNNYKKLTDQFPGKDDSNDR 1304
            MVA EFL+ + + Q+ST VGLED  D+LNF F+V+ L++ ++IVT+K Y FKP++CY+     GSN  +Y+EN CWV GTI + +    P    +W   +K  ++ YYQWVPF+LGLQCIMFY+PK++WQIIC+N+TGT+++  + +AN A H   E R K +  + +T+E +LY+HRD+R GK+A FRR I++   F + SK +GTWLV SY  +K  Y  N   QL I++ FLGF + N L FG  + +N+ +G +W  T IFPRVSYC+  ++  +G  N+ +AQC LP+NMLNE+IY F+  WI  V  +T++SI IWI R++ +K R  FI++FLI+ ++   D KE  L+ +F ++FLR+DGIFL+ M  +N GD++TSEIV  LW+IYK  Y +   RNF N         G D+ +D+
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEK-HKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCF-VKVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVN---RNFLN--------DGSDEDDDK 413          
BLAST of Ddo_012721 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 88.5817 bits (218), Expect = 6.511e-19
Identity = 74/293 (25.26%), Postives = 127/293 (43.34%), Query Frame = 3
Query:  114 KLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLS--------NEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLG-----FHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLW 953
            ++++  TV+ LI   ++VT + Y   P+ C +   P G      M+ YCW++ T  V          + + P   +     D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+  +   N  S +  +E K   ++I            DY  G +   R   Y F                 +F  + L F+NV+GQ+Y +  FL      + ++ L F        I+        +FP+V+ C   +    G+   +   C LP+N++NEKIY+F+  W
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN--SPIVNDECKNDRKKIL----------VDYFIGNLN--RHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPM----ARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_012721 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 88.5817 bits (218), Expect = 6.511e-19
Identity = 74/293 (25.26%), Postives = 127/293 (43.34%), Query Frame = 3
Query:  114 KLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLS--------NEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLG-----FHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLW 953
            ++++  TV+ LI   ++VT + Y   P+ C +   P G      M+ YCW++ T  V          + + P   +     D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+  +   N  S +  +E K   ++I            DY  G +   R   Y F                 +F  + L F+NV+GQ+Y +  FL      + ++ L F        I+        +FP+V+ C   +    G+   +   C LP+N++NEKIY+F+  W
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN--SPIVNDECKNDRKKIL----------VDYFIGNLN--RHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPM----ARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_012721 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 88.5817 bits (218), Expect = 6.511e-19
Identity = 74/293 (25.26%), Postives = 127/293 (43.34%), Query Frame = 3
Query:  114 KLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLS--------NEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLG-----FHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLW 953
            ++++  TV+ LI   ++VT + Y   P+ C +   P G      M+ YCW++ T  V          + + P   +     D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+  +   N  S +  +E K   ++I            DY  G +   R   Y F                 +F  + L F+NV+GQ+Y +  FL      + ++ L F        I+        +FP+V+ C   +    G+   +   C LP+N++NEKIY+F+  W
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN--SPIVNDECKNDRKKIL----------VDYFIGNLN--RHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPM----ARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_012721 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 88.5817 bits (218), Expect = 6.511e-19
Identity = 74/293 (25.26%), Postives = 127/293 (43.34%), Query Frame = 3
Query:  114 KLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLS--------NEILPQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLG-----FHNNSLIFGYTILSNMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLW 953
            ++++  TV+ LI   ++VT + Y   P+ C +   P G      M+ YCW++ T  V          + + P   +     D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+  +   N  S +  +E K   ++I            DY  G +   R   Y F                 +F  + L F+NV+GQ+Y +  FL      + ++ L F        I+        +FP+V+ C   +    G+   +   C LP+N++NEKIY+F+  W
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN--SPIVNDECKNDRKKIL----------VDYFIGNLN--RHNFYAF----------------RFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPM----ARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFW 274          
BLAST of Ddo_012721 vs. RefSeq Drosophila melanogaster
Match: gi|17864458|ref|NP_524824.1| (optic ganglion reduced, isoform A [Drosophila melanogaster])

HSP 1 Score: 86.2705 bits (212), Expect = 4.237e-18
Identity = 77/309 (24.92%), Postives = 129/309 (41.75%), Query Frame = 3
Query:   75 QLSTYVGLEDFAD-----KLNFMFTVVFLILSMMIVTIKSYFFKPLACYMSTTPSGSNFEAYMENYCWVHGTIPV-------LSNEIL-PQNPADWSVWDKSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTANDASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCVFSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILSNMINGQEWHKTG---IFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIYIFISLW 953
             L +Y+  +D        +L+  FT V L+   +I+T   Y  +P++C ++  P        +  +CW+H T  +       +  E+  P    D+   D  +  TYYQWV F+L  Q +  Y PK +W     NK    L   I    + +    EE++   +     + D L KH           R  +Y                 + Y+A + L  +N++ Q+Y++  F  F    L +G  I+      QE        +FPRV+ C   +    G+   + + C LP+N++NEK Y+FI  W
Sbjct:    7 SLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPP-----HVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLW-----NKFEGGLMRMIVMGLNITICTREEKEAKRD----ALLDYLIKHVK---------RHKLY----------------AIRYWACEFLCCINIIVQMYLMNRF--FDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
The following BLAST results are available for this feature:
BLAST of Ddo_012721 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL2.597e-6432.53RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL6.377e-5931.31RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|10719983|sp|Q27295|EAT5_CAEEL1.025e-4928.50RecName: Full=Innexin eat-5; AltName: Full=Abnorma... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.294e-4929.93RecName: Full=Innexin-19[more]
gi|12643734|sp|Q19746|INX3_CAEEL1.041e-4829.43RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of Ddo_012721 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008370.000e+065.62Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006570.000e+063.81Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150281814.179e-13248.76SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
SMU150331265.224e-13047.53SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150364823.083e-12946.48dd_smedV4_10766_0_1|m.1746|m.10467[more]
back to top
BLAST of Ddo_012721 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_012721 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|6.511e-1925.26innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|6.511e-1925.26innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|6.511e-1925.26innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|6.511e-1925.26innexin 2, isoform D [Drosophila melanogaster][more]
gi|17864458|ref|NP_524824.1|4.237e-1824.92optic ganglion reduced, isoform A [Drosophila mela... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_012721 ID=Ddo_012721|Name=Ddo_012721|organism=Dugesia dorotocephala|type=mRNA|length=1412bp
ATTGTAATATCCGTTTTATTATTTAACTGTTAGACATGGTCGCTCAAGAA
TTCCTAAATCTCGTTGGACAGTATCAACTATCAACATATGTTGGTCTTGA
AGATTTTGCAGATAAGCTCAACTTTATGTTCACTGTTGTGTTTCTTATAC
TATCCATGATGATTGTGACAATAAAATCCTACTTTTTCAAACCACTGGCT
TGTTATATGTCTACAACCCCAAGTGGGTCGAATTTCGAGGCGTATATGGA
AAATTATTGTTGGGTGCATGGAACAATTCCAGTTTTGTCTAATGAAATTT
TGCCCCAAAATCCAGCGGATTGGTCAGTATGGGATAAATCAAGAAGAATA
ACTTACTATCAATGGGTACCTTTCATTCTCGGTTTACAGTGCATCATGTT
TTACATTCCGAAAATTATTTGGCAAATCATATGTTTTAATAAGACTGGCA
CAAATTTAGAAAGTTTTATCAAAACGGCAAATGATGCCTCTCACTTGCCA
CCAGAAGAACGGAAAAAATCTTTAGAACGAATCTGTCGAACAATTGAAGA
TATGCTTTATAAACATAGAGATTATCGGCAAGGTAAAATCGCTAATTTTC
GGAGAACAATTTATGATTTCTGTAACTTTTGTGTTTTTTCGAAACACTTG
GGTACATGGCTCGTGTTATCTTACTTTGCCATAAAGGGTTTGTATTTCTT
AAACGTGGTCGGTCAATTATACATTTTAAAGAGTTTTCTCGGGTTCCATA
ATAATAGTTTGATATTTGGATATACGATTTTGAGTAACATGATTAATGGC
CAGGAATGGCATAAAACTGGAATATTCCCTCGAGTGAGTTATTGCTATAA
TTCAGAGATAAAAGTTATAGGAGCTTCAAATGCTTACATAGCTCAATGTG
CTCTACCAATCAACATGTTAAACGAAAAGATTTATATATTTATAAGTCTT
TGGATATTCTTTGTCGGTATTATTACCTTAATAAGCATTGGAATCTGGAT
ATCGCGAATGATGTTTCTTAAAAAGAGAGCCGATTTTATAAAAGAATTTT
TGATAATGCGAGACAAATATGACGGTAAAGAAAAGCTACTTATCAATCAA
TTCATCACAGAATTCCTTCGTTATGATGGGATCTTTTTGATTTACATGTT
TTTCATAAATGTTGGAGATCTGGTGACATCGGAAATCGTGAACATTCTTT
GGGATATTTACAAGAATAAGTACAAGGATTTGGATTTTAGAAACTTTAAT
AATTACAAGAAGTTAACAGACCAGTTTCCTGGGAAAGATGATTCAAATGA
TCGATTTGTTTGACTTTATTTGCTGCCAATAAGTTACAAATTGATTTTTA
TAGACCTGATTTGAAATAGAAAATGTAATTGTTCTGTTAATTAATAATAC
TAATGATTAATT

Design Primers for Ddo_012721

back to top

protein sequence

>Ddo_012721-protein ID=Ddo_012721-protein|Name=Ddo_012721|organism=Dugesia dorotocephala|type=polypeptide|length=426bp
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
back to top

coding sequence

>Ddo_012721.36.1313 ID=Ddo_012721.36.1313|Name=Ddo_012721.36.1313|organism=Dugesia dorotocephala|type=CDS|length=1278bp
ATGGTCGCTCAAGAATTCCTAAATCTCGTTGGACAGTATCAACTATCAAC
ATATGTTGGTCTTGAAGATTTTGCAGATAAGCTCAACTTTATGTTCACTG
TTGTGTTTCTTATACTATCCATGATGATTGTGACAATAAAATCCTACTTT
TTCAAACCACTGGCTTGTTATATGTCTACAACCCCAAGTGGGTCGAATTT
CGAGGCGTATATGGAAAATTATTGTTGGGTGCATGGAACAATTCCAGTTT
TGTCTAATGAAATTTTGCCCCAAAATCCAGCGGATTGGTCAGTATGGGAT
AAATCAAGAAGAATAACTTACTATCAATGGGTACCTTTCATTCTCGGTTT
ACAGTGCATCATGTTTTACATTCCGAAAATTATTTGGCAAATCATATGTT
TTAATAAGACTGGCACAAATTTAGAAAGTTTTATCAAAACGGCAAATGAT
GCCTCTCACTTGCCACCAGAAGAACGGAAAAAATCTTTAGAACGAATCTG
TCGAACAATTGAAGATATGCTTTATAAACATAGAGATTATCGGCAAGGTA
AAATCGCTAATTTTCGGAGAACAATTTATGATTTCTGTAACTTTTGTGTT
TTTTCGAAACACTTGGGTACATGGCTCGTGTTATCTTACTTTGCCATAAA
GGGTTTGTATTTCTTAAACGTGGTCGGTCAATTATACATTTTAAAGAGTT
TTCTCGGGTTCCATAATAATAGTTTGATATTTGGATATACGATTTTGAGT
AACATGATTAATGGCCAGGAATGGCATAAAACTGGAATATTCCCTCGAGT
GAGTTATTGCTATAATTCAGAGATAAAAGTTATAGGAGCTTCAAATGCTT
ACATAGCTCAATGTGCTCTACCAATCAACATGTTAAACGAAAAGATTTAT
ATATTTATAAGTCTTTGGATATTCTTTGTCGGTATTATTACCTTAATAAG
CATTGGAATCTGGATATCGCGAATGATGTTTCTTAAAAAGAGAGCCGATT
TTATAAAAGAATTTTTGATAATGCGAGACAAATATGACGGTAAAGAAAAG
CTACTTATCAATCAATTCATCACAGAATTCCTTCGTTATGATGGGATCTT
TTTGATTTACATGTTTTTCATAAATGTTGGAGATCTGGTGACATCGGAAA
TCGTGAACATTCTTTGGGATATTTACAAGAATAAGTACAAGGATTTGGAT
TTTAGAAACTTTAATAATTACAAGAAGTTAACAGACCAGTTTCCTGGGAA
AGATGATTCAAATGATCGATTTGTTTGA
back to top
Gene Groups
Ddo_012721 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.