Ddo_009563, Ddo_009563 (mRNA) Dugesia dorotocephala

Overview
NameDdo_009563
Unique NameDdo_009563
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length774
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_009563 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 162.54 bits (410), Expect = 1.539e-45
Identity = 87/258 (33.72%), Postives = 144/258 (55.81%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            YCWV  T  +   + IP   ++     +N++I YYQWVPF+L L+ ++FYVP ++W+L+ +   G +++SL   A  +       R   ++ I   +E+ L        G       N  K+ N  + ++  G  +   YI +K +Y +N++GQ+FL+  FLG  S    +G  +L+++ +G+EW ++G FPRVT C   E+K LG  +++  QC L INM NEKI++FLWFW F++   T  S+  W +   + SR+
Sbjct:   72 YCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSG-------NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKW--YGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQ 314          
BLAST of Ddo_009563 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 154.066 bits (388), Expect = 1.435e-41
Identity = 91/257 (35.41%), Postives = 139/257 (54.09%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSR 771
            YCWV  T  +   E+IP+         +N++I YYQWVPFIL ++ ++FYVP ++W+ + Y   G NL+ L   A  A       +   +  + R ++D +      RQG       NL    N C   +H G ++ + YI +K +Y  NV+ Q FL+   LG N    ++G+++L ++    EW QTG+FPRVT C   E++ LG  +++  QC L INM NEKI++FLWFW    GI+T  +   W   + I S+
Sbjct:  190 YCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQ 436          
BLAST of Ddo_009563 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 142.124 bits (357), Expect = 1.142e-37
Identity = 90/254 (35.43%), Postives = 140/254 (55.12%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDA-DAASHSPPAERKDKIERIV-RTIEDMLFQHRDYR---QGKMADIRRNLFKMCNFCVFSKHM-GTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLW 744
            YCW+  T  I   EN+P    D     + K+I YYQWVPFIL  + +MF +P + W+L C  + G N+++L   A DA +    ++R+  +E I    ++++  Q  + R   +G +A I+           FS+ + G  + + Y   K +Y +NV+ Q F++   L  +S    FG+ +LS+I  G+ W +TG FPRVT C   E+++L   N+Y  QCAL IN++NEK++ FLW W  I+ IIT  S   W
Sbjct:   72 YCWIQNTYWIPMYENVP----DDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYW 307          
BLAST of Ddo_009563 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 141.354 bits (355), Expect = 2.166e-37
Identity = 85/258 (32.95%), Postives = 127/258 (49.22%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            YC++  T  I     IP    D     Q   I YYQWVP +L +Q  MFY+P  IW  + Y + G +  S+  +A+A        R   + ++V  I D+L        G+    R           F K +G+   + YI +K MY  NV  Q  ++ KFLG  + +  +G+   +++  G+EW  +G+FPRVT C    ++ L   ++Y  QC L INM NEKIY+F+WFW   V I T I+     +R++  S R
Sbjct:   72 YCFIQNTFFIPERSEIPGDVED----RQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFL--WGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSR 310          
BLAST of Ddo_009563 vs. uniprot
Match: gi|67460980|sp|O01634|INX12_CAEEL (RecName: Full=Innexin-12; AltName: Full=Protein opu-12)

HSP 1 Score: 137.502 bits (345), Expect = 5.040e-36
Identity = 87/263 (33.08%), Postives = 137/263 (52.09%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDW----------AIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIA 759
            YC+V  T  +   E+  +   +W            + Q  +I YYQWVPFIL LQ ++FY P VIW+L  Y   G N+ SL  +   A+      RK  I  I   I     +HR+    +++  +            ++  G+ ++ SY+ MK ++ INV+ Q  L+K+ LG +S    +G  + S++  G EW +TG FPRVT C   E+++L   +K+  QC L INM NEKI+V LW+W+  + ++T  +   WF+R +
Sbjct:   68 YCYVQNTFFVPFSEDKAERSYNWEQLVADKQNTTSLKQTNQIGYYQWVPFILALQAMLFYFPVVIWRLF-YGMAGQNVTSLC-NTCTATEGNEESRKGTITTIAGYISQK--RHRNLIVKQLSGFQ------------NRANGSAVITSYLFMKALFLINVLFQFVLLKRMLGVDSYF--WGAEVTSDLWSGNEWPETGNFPRVTMCEY-EVRNLDNIHKHSVQCVLMINMFNEKIFVALWWWLCFLTVVTITNTIYWFWRAS 311          
BLAST of Ddo_009563 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 449.514 bits (1155), Expect = 1.496e-157
Identity = 196/258 (75.97%), Postives = 230/258 (89.15%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            YCWVHGTI+ LPGE+IPQ D DWA  D  +RI YYQWVPFILGLQCIMFY+P++IWQ+ICYNK GTNLES+  DA+AA+++PP ERKDKIERI RTIEDMLFQHRDYRQG  A +RR ++  CNFCVFSKHMGTWL+LSYIL+KF+YG+NVIGQLF+MKKFLGFN++ SSFGYT+LSN+  GKEWHQTGIFPRVTYCY+  IKH+G +NKY+ QCALP+NMLNEKIYVFLWFW+ +VGI+TAISIPLWF+R+A LSRR
Sbjct:   74 YCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRR 331          
BLAST of Ddo_009563 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 385.571 bits (989), Expect = 1.617e-132
Identity = 173/258 (67.05%), Postives = 207/258 (80.23%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            YCWVHGTI  L  E IP    DWAI D +KRITYYQWVPFILGLQCI+FY+P+++W++ICYNK+GTNLE+L   A  +S  PP+ERK  +  IVR IED+L+QHRDYRQGKMA  RR +++ CNFCVFSKH+GTWLV +Y  +K +YGINVIGQL+LMK FLGFNSSMSSFGYTIL++I  GK WH+T  FPRV+YCY  +IKHLGA N Y+ QC LP+NMLNEKIY+FLWFWV +VGIIT +SI  W  RI  LS+R
Sbjct:   74 YCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKR 331          
BLAST of Ddo_009563 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 277.33 bits (708), Expect = 9.166e-90
Identity = 127/258 (49.22%), Postives = 174/258 (67.44%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            YCWV GTI I     IP T+ +WA +++ K I YYQWVPF+L LQ IMFY+PR+IWQ+ CYN  GT++  L + A+ A HS    R   +  I +TIE ML+QHRD R G++A  RR+L+K+C FC+ SK  GT L+  Y ++KF+Y  N I QL+ MK FLG N +   FG+ I+ NI +G++W  T +FPRV YCY+  +K++G +N  + QC LP+NMLNEKI+ FLW W+F   I+  ISI +W FR ++  RR
Sbjct:   73 YCWVEGTIPISYDGKIPSTNEEWAELNKYK-ILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRR 328          
BLAST of Ddo_009563 vs. Smed Unigenes AA
Match: SMU15031907 (SmedSxlregen_c71685_g2_i2|m.13384|m.29837)

HSP 1 Score: 264.618 bits (675), Expect = 2.553e-86
Identity = 117/225 (52.00%), Postives = 159/225 (70.67%), Query Frame = 1
Query:  100 YYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            YYQWVPF+L LQCIMFY+PR+IWQ+ CYN+ GT+++ L   A+ A HS    RK  +  + +++E +LFQHRD+R  K+A+ RR ++K CNF V SK +G WLV SY ++K +Y  N IGQL LM+ FLG +S+ S FG  +  NI  G++W  T IFPRV YCY+ +I  LG+ N  + QC LP+NMLNE+IY+FLW+WV +V ++T ISIP WF RI +   R
Sbjct:    2 YYQWVPFVLSLQCIMFYIPRIIWQMFCYNRTGTDIQHLITSANHAVHSSEEARKKMVIHLAKSLEQLLFQHRDFRNDKIANFRRKVYKHCNFLVISKRLGNWLVFSYFVLKIIYLSNAIGQLVLMQHFLGLDSNYSFFGIEVARNILRGQDWQTTLIFPRVGYCYV-KIDMLGSKNAVVAQCVLPVNMLNERIYLFLWYWVVVVILLTGISIPTWFIRIMLQKSR 225          
BLAST of Ddo_009563 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 266.159 bits (679), Expect = 9.070e-86
Identity = 121/258 (46.90%), Postives = 175/258 (67.83%), Query Frame = 1
Query:    4 CWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNS-SMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILSRR 774
            CWV GTI++      P TD +W  ++++K + YYQWVPF+LGLQCIMFYVP+++WQ+ICYN+ GT+++ L + A+ A HS    R   +  + +T+E +L+QHRD+R GK+A  RR +     F + SK +GTWLV SY+L+K  Y  N   QL +M+KFLGF+  ++ +FG  + +NI  G +W  T IFPRV+YC++ ++ HLG  N  + QC LP+NMLNE+IY FLW W+ IV  +T +SIP+W  RI  +  R
Sbjct:   75 CWVQGTIALSNQAKFPSTDEEWKNLEKHKML-YYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYR 330          
BLAST of Ddo_009563 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 98.9821 bits (245), Expect = 1.357e-23
Identity = 77/267 (28.84%), Postives = 127/267 (47.57%), Query Frame = 1
Query:    1 YCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIA---DGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 768
            YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   67 YCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Ddo_009563 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 98.9821 bits (245), Expect = 1.357e-23
Identity = 77/267 (28.84%), Postives = 127/267 (47.57%), Query Frame = 1
Query:    1 YCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIA---DGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 768
            YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   67 YCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Ddo_009563 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 98.9821 bits (245), Expect = 1.357e-23
Identity = 77/267 (28.84%), Postives = 127/267 (47.57%), Query Frame = 1
Query:    1 YCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIA---DGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 768
            YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   67 YCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Ddo_009563 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 98.9821 bits (245), Expect = 1.357e-23
Identity = 77/267 (28.84%), Postives = 127/267 (47.57%), Query Frame = 1
Query:    1 YCWVHGTISI------LPGENI--PQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIA---DGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFFRIAILS 768
            YCW++ T ++      + G ++  P   S     D+ K   YYQWV F+L  Q I+FYVPR +W+    +  G  L+ L +D +    SP    + K +R    +        DY  G +   R N +                   + + + +  +NVIGQ++ +  FL  +   S++G  +L       D +      +FP+VT C   +    G+   + G C LP+N++NEKIYVFLWFW  I+ I++ IS+    +RIA+++
Sbjct:   67 YCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNLN--RHNFY----------------AFRFFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Ddo_009563 vs. RefSeq Drosophila melanogaster
Match: gi|17864322|ref|NP_524730.1| (innexin 3, isoform A [Drosophila melanogaster])

HSP 1 Score: 94.3597 bits (233), Expect = 5.912e-22
Identity = 77/255 (30.20%), Postives = 119/255 (46.67%), Query Frame = 1
Query:    1 YCWVHGTISILPGENIPQTDSDWA------IVDQNKRI-TYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTIL--SNIADGKEWH-QTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISI 735
            +CW+  T +I PG+   Q  +D A         Q KR  +YYQWVPF+L  Q +MFYVP  +W+ +   K+    + L          P   R+D+ +RI++   + L  H  Y                               +Y   + +  INVI  +F++ KFLG   +  S+G  +L  SN+   K +     IFPR+T C   +    G+  K+   C L +N+LNEKIY+FLWFW  I+  I+ +++
Sbjct:   74 FCWITYTYTI-PGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNMEDGKIRMITDGLR----GMVSVPDDYRRDRQDRILKYFVNSLNTHNGYS-----------------------------FAYFFCELLNFINVIVNIFMVDKFLG--GAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAV 292          
The following BLAST results are available for this feature:
BLAST of Ddo_009563 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL1.539e-4533.72RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL1.435e-4135.41RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.142e-3735.43RecName: Full=Innexin-19[more]
gi|12643734|sp|Q19746|INX3_CAEEL2.166e-3732.95RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|67460980|sp|O01634|INX12_CAEEL5.040e-3633.08RecName: Full=Innexin-12; AltName: Full=Protein op... [more]
back to top
BLAST of Ddo_009563 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008371.496e-15775.97Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006571.617e-13267.05Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150331269.166e-9049.22SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150319072.553e-8652.00SmedSxlregen_c71685_g2_i2|m.13384|m.29837[more]
SMU150364829.070e-8646.90dd_smedV4_10766_0_1|m.1746|m.10467[more]
back to top
BLAST of Ddo_009563 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_009563 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|1.357e-2328.84innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|1.357e-2328.84innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|1.357e-2328.84innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|1.357e-2328.84innexin 2, isoform D [Drosophila melanogaster][more]
gi|17864322|ref|NP_524730.1|5.912e-2230.20innexin 3, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_009563 ID=Ddo_009563|Name=Ddo_009563|organism=Dugesia dorotocephala|type=mRNA|length=774bp
TATTGCTGGGTTCATGGAACAATATCAATATTACCAGGAGAAAATATTCC
TCAAACTGATTCGGATTGGGCAATTGTCGATCAAAACAAAAGAATAACAT
ACTATCAATGGGTTCCATTTATTCTCGGTCTCCAATGTATAATGTTTTAT
GTTCCCAGAGTGATTTGGCAGTTAATTTGCTATAATAAAGTTGGCACTAA
TCTCGAAAGTCTTGCAATTGATGCTGATGCTGCGAGTCACAGTCCTCCTG
CCGAAAGAAAAGATAAAATCGAAAGAATTGTCAGAACAATTGAAGATATG
TTATTCCAACATCGAGATTATCGTCAAGGTAAAATGGCAGATATTCGTAG
AAATTTATTTAAAATGTGCAACTTTTGTGTATTTTCAAAACATATGGGAA
CTTGGTTAGTTCTGTCGTACATTTTAATGAAATTTATGTATGGAATAAAT
GTTATTGGACAATTATTTCTGATGAAGAAATTTTTGGGCTTCAATTCTTC
CATGTCCTCATTCGGCTACACGATATTAAGCAATATTGCAGATGGCAAAG
AATGGCACCAAACTGGAATATTTCCTCGGGTGACATACTGTTATATTGGA
GAAATTAAACATCTCGGTGCCAGTAACAAATATATAGGACAATGTGCGTT
ACCAATTAATATGTTGAATGAAAAAATCTACGTTTTCTTATGGTTCTGGG
TATTTATAGTGGGAATAATTACCGCTATAAGTATTCCATTGTGGTTTTTT
AGAATTGCAATACTTAGTCGGCGA

Design Primers for Ddo_009563

back to top

protein sequence

>Ddo_009563-protein ID=Ddo_009563-protein|Name=Ddo_009563|organism=Dugesia dorotocephala|type=polypeptide|length=258bp
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
back to top

coding sequence

>Ddo_009563.1.774 ID=Ddo_009563.1.774|Name=Ddo_009563.1.774|organism=Dugesia dorotocephala|type=CDS|length=774bp
TATTGCTGGGTTCATGGAACAATATCAATATTACCAGGAGAAAATATTCC
TCAAACTGATTCGGATTGGGCAATTGTCGATCAAAACAAAAGAATAACAT
ACTATCAATGGGTTCCATTTATTCTCGGTCTCCAATGTATAATGTTTTAT
GTTCCCAGAGTGATTTGGCAGTTAATTTGCTATAATAAAGTTGGCACTAA
TCTCGAAAGTCTTGCAATTGATGCTGATGCTGCGAGTCACAGTCCTCCTG
CCGAAAGAAAAGATAAAATCGAAAGAATTGTCAGAACAATTGAAGATATG
TTATTCCAACATCGAGATTATCGTCAAGGTAAAATGGCAGATATTCGTAG
AAATTTATTTAAAATGTGCAACTTTTGTGTATTTTCAAAACATATGGGAA
CTTGGTTAGTTCTGTCGTACATTTTAATGAAATTTATGTATGGAATAAAT
GTTATTGGACAATTATTTCTGATGAAGAAATTTTTGGGCTTCAATTCTTC
CATGTCCTCATTCGGCTACACGATATTAAGCAATATTGCAGATGGCAAAG
AATGGCACCAAACTGGAATATTTCCTCGGGTGACATACTGTTATATTGGA
GAAATTAAACATCTCGGTGCCAGTAACAAATATATAGGACAATGTGCGTT
ACCAATTAATATGTTGAATGAAAAAATCTACGTTTTCTTATGGTTCTGGG
TATTTATAGTGGGAATAATTACCGCTATAAGTATTCCATTGTGGTTTTTT
AGAATTGCAATACTTAGTCGGCGA
back to top
Gene Groups
Ddo_009563 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.