Ddo_008154, Ddo_008154 (mRNA) Dugesia dorotocephala

Overview
NameDdo_008154
Unique NameDdo_008154
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1914
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_008154 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 211.075 bits (536), Expect = 5.863e-60
Identity = 128/374 (34.22%), Postives = 215/374 (57.49%), Query Frame = 2
Query:  218 EDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKEN 1339
            +D  DKL++ ++  I+ +  ++V+ K Y   P+ C++    +    E Y ENYCWV  T  +   + IP N          R+I YYQWVPF+L L+ ++FY+P I+W+L+ +   G ++++LV  A  +  +  E R   ++ IA  +E+ L+     +H  ++  R +L    N  + ++  G  +   Y+ +K LY +N++GQ++++ +FLG  S  K +G  VL++++ G+EW ESG FPRVT C   E++ LG  +++  QC L INM NEKI++FLWFW  L+   T  S+  W +  V  SR+ +F+ K+L   E Y   + Q +  F+  FLR DGVFL+RM+  +AG++   ++   L+  Y +N
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALH----VKHQVMSGNRLKLL---NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRS--KWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Ddo_008154 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 192.586 bits (488), Expect = 5.653e-52
Identity = 122/374 (32.62%), Postives = 208/374 (55.61%), Query Frame = 2
Query:  218 EDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYR--HGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLM---HETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFE 1324
            +DF DKL++ ++  IL    ++V+ K Y   P+ C++    + +  E Y ENYCWV  T  +   E IP+   +       R+I YYQWVPFIL ++ ++FY+P I+W+ + Y   G NL+ LV  A  A  +  E +   V  +AR ++D +      R  H +      QL   C      +H G ++ + Y+ +K LY+ N++ Q +++   LG N     +G+++L +++   EW ++G+FPRVT C   E+R LG  +++  QC L INM NEKI++FLWFW L   ++T  +   W   +   S+  SF++K+L +   H     ++   +  F   FLR DGVF++RMI  +AG++++++++  L++
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYS----RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANC-----GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Ddo_008154 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 182.57 bits (462), Expect = 3.428e-49
Identity = 135/437 (30.89%), Postives = 226/437 (51.72%), Query Frame = 2
Query:  212 GVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPP-EERKAKVEGIARTIEDMLYQH----RDYRHGKIADMRRQLFDKCNFCVFSKHL-GTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQ--------------------IMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRNFTAYSKPMSVGTALRRNPNISGSDESI 1444
            G +D  D+L++ ++ +IL +  ++++ K Y   P+ C++    S  + E Y+E+YCW+  T  I   E +P +  A       ++I YYQWVPFIL  + +MF +P I W+L C  + G N++TL+  A  A  +    +R+  VE I     D L       R    G IA ++           FS+ L G  + + Y   K LY++N++ Q +I+ + L  +S    FG+ VL +I  G+ W E+G FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W +++ +IT  S   W       S +  ++ KF+ + E+ +    Q                    ++++F+ +FL+ DG+ ++RMI  +AGD+I   +V  L++ Y+E     ++R F  + +   V   +RR   I G+ E I
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTA----REEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER----NWREFEEHEEMKDV--EMRR---IQGTRERI 427          
BLAST of Ddo_008154 vs. uniprot
Match: gi|10720052|sp|Q23157|INX11_CAEEL (RecName: Full=Innexin-11; AltName: Full=Protein opu-11)

HSP 1 Score: 178.718 bits (452), Expect = 1.297e-47
Identity = 125/419 (29.83%), Postives = 213/419 (50.84%), Query Frame = 2
Query:  218 EDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIP--QNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLG--TWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLM------HETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIY--KENYKDIDFRNFTAYSKPMSVG--TALRRNPNISGS 1432
            +D++D+L++L +  IL+   ++++ K +  +P+ C       GS +E Y ENYCW   T  + P + +   + +E +T     R+++YYQWVPF L LQ   F  P  +W+    N  G  +  +V  A  +  +  E R+  +  + R +   L    +    K+     Q+     F  F    G  +W+   Y+  K LY +N+  QLY+M  FLG N     +G+ V+ +IVQG+ W  SG FPR   C   E+R +    +Y  QC L IN+ NEKI++ LWFW +++ L + +S+  WF  +VF      F+K+ L +      ++   R     ++ F+ ++L  DGVF++RM+  +AG I   D+V  L+E Y  ++  KD+     +   + +S G  +++R+     GS
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGS-WEQYAENYCWSQDTYFVEPTQDVSLLKKEERYT---PDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKV-----QVHKTVTFLNFQYSSGFISWI---YLFTKVLYFLNVFAQLYLMNYFLGTNRH-HWYGFGVVQDIVQGEPWERSGYFPRAAVCDF-EVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDLQTISTGAESSIRQRKTRKGS 423          
BLAST of Ddo_008154 vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 177.178 bits (448), Expect = 3.477e-47
Identity = 134/441 (30.39%), Postives = 226/441 (51.25%), Query Frame = 2
Query:  212 GVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEI-PPEERKAKVEGIARTIEDML-YQHRDYR---HGKIADMRRQLFDKCNFCVFSKHL-GTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQ--------------------IMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRNFTAYSKPMSVGTALRRNPNISGSDESIKKQP 1456
            G +D  D+L++ ++ +IL +  ++++ K Y   P+ C++    S  + E Y+E+YCW+  T  I   E +P +  A       ++I YYQWVPFIL  + +MF +P I W+L C  + G N++TL+  A     +    +R+  VE I     D L  Q  + R    G IA ++           FS+ L G  L + +   K LY++N++ Q  I+ + L  +S    FG+ VL++I  G+ W E+G FPRVT C   E+R+L   N+Y  QCAL IN++NEK++ FLW W +++ +IT  S   W       S +  ++ KF+ + E+ +    Q                    +++ F+ +FL+ DGV ++RMI  +AGD+I   +V  L++ ++E     ++R F  + +   V   +RR   I G +  +   P
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTA----REEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER----NWREFEEHEEMKDV--EMRR---IHGGERIVISNP 447          
BLAST of Ddo_008154 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 321/440 (72.95%), Postives = 389/440 (88.41%), Query Frame = 2
Query:  155 MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV* 1474
            MVAEEFL+LIGQFK+STYVG+EDFADKLSFLFSV +LI+SMM+VT+KSY FKPLACY AT P GSNFENYLENYCWVHGTIT LPGE IPQND  W   D+TRRI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK GTNLE++V +AN+AN  PP ERK K+E IARTIEDML+QHRDYR G  A +RR++++ CNFCVFSKH+GTWL+LSY+L+KFLY +N+IGQL+IMK FLGFN++  +FGYTVL N++ GKEWH++GIFPRVTYC++  I+H+G +NKY+AQCALP+NMLNEKIY+FLWFW++LV ++TAISIP+WF+R+ FLSRRS FIK+FL+MH+ Y+RS+K ++NNFI EFLRHDGVFL+RM+FINAGDIITADIV+RL EIYKENYK +DFRN+TAY+K +     L RN N+S SD+SIKK+P+ENFV*
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV* 440          
BLAST of Ddo_008154 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 265/412 (64.32%), Postives = 338/412 (82.04%), Query Frame = 2
Query:  155 MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRNFTAYSKPMS 1390
            MVA+EFLSLI QFKLS+Y G+EDFAD+L+F+FSVVIL +SM+IVT K+YFFKPL+CY+AT PSG NF+ Y+ENYCWVHGTI  L  E+IP   E W + D  +RITYYQWVPFILGLQCI+FYIP+++W++ICYNK+GTNLETL+T A  ++++PP ERK+ +  I R IED+LYQHRDYR GK+A  RR++++ CNFCVFSKHLGTWLV +Y  +K LY IN+IGQLY+MKSFLGFNSSM +FGYT+L++I+ GK WHE+  FPRV+YC+  +I+HLGA N Y+AQC LP+NMLNEKIYIFLWFWVLLV +IT +SI  W  RIVFLS+RS F KK L MH++Y RS    +N+FI+E+LR+DG+FLIRMI+IN+GDI+ A+I++ L+E YK  Y + DF N+  Y K +S
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLIS 412          
BLAST of Ddo_008154 vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 395.201 bits (1014), Expect = 1.509e-130
Identity = 211/443 (47.63%), Postives = 294/443 (66.37%), Query Frame = 2
Query:  155 MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRNFTAYSKPMSVGTALRR---NPNISGSDESIKKQPLENFV* 1474
            MVA EF SLI +       G+ED ADK+S +FSV+IL + + IVT+KSY  KP++CY++  PSG NF++Y+ENYCW+HGTI + P +K+  N   W  L+ T++I YYQWVPFILGLQCIMFYIP++IWQ+ C+N+ GTNL+T++  +    EIP  ER+ + E IA+ IE+ML  HRD+R  KIA++RR ++ KC+  + SK LGT +V SY + K LY  N IGQL++++S LGF + + TFG  +   IV G E      FPRV +C++  IRH+G  N Y+AQC LP+NMLNEKIY FLW W+LLV   T ISIP+W  R+     R  +I  FL M  +YD   K +++ FI +FLRHDG+FL+RMI  NAGD+I A +V+ L++IY + Y++ + R         SV   L+    N + S S    +  P+ N++*
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLR-----KDIFSVSNHLKEDEANNSTSNSQNLNQCSPIMNYL* 438          
BLAST of Ddo_008154 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 379.793 bits (974), Expect = 1.877e-124
Identity = 197/406 (48.52%), Postives = 283/406 (69.70%), Query Frame = 2
Query:  155 MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNS-SMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHE--TYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRN 1363
            MVA EFL  + + ++ST VG+ED  D+L+F FSV++L++ ++IVTVK Y FKP++CY+     GSN  +Y+EN CWV GTI +    K P  DE W  L+   ++ YYQWVPF+LGLQCIMFY+P+++WQ+ICYN+ GT+++ LV +AN A     E R   V  +++T+E +LYQHRD+R GK+A  RR++ +   F + SK +GTWLV SY+L+K  Y  N   QL IM+ FLGF+  ++ TFG  V +NI  G +W  + IFPRV+YC + ++ HLG  N  +AQC LP+NMLNE+IY FLW W+L+V  +T +SIP+W  RI+ +  R  FI++FL++ E  T D+    ++  F  +FLRHDG+FL++MI +NAGDIIT++IV +L+ IYK NY + +F N
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEK-HKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLN 404          
BLAST of Ddo_008154 vs. Smed Unigenes AA
Match: SMU15018264 (SmedSxldir_c107242_g1_i1|m.71544|m.38668)

HSP 1 Score: 379.022 bits (972), Expect = 2.120e-124
Identity = 207/439 (47.15%), Postives = 291/439 (66.29%), Query Frame = 2
Query:  155 MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFXXXXXXXXXXXXXXKSYFFKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGF--NSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYIXXXXXXXXXXXITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNKQIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDIDFRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLEN 1465
            MVA   L LI   K++ Y G+ED  DK+SF  SV+I II   IVT K+Y  KPL+CY A  P+GSNF+ YL NYCW+ GT+  +PG+K PQ  +   L D+ ++I YYQWVPF+L LQCIMFY+PR+ WQL+ YNK+G +LE +  +A+SA+      RK K +GIA+ + ++ + HRDY++G  A+ RR++F   +F + SK LGTWL   Y +MK ++  N +GQLY+++ FLGF  N+  +T      D++V G +W  S +FPRVT C I  I+ LG  N YI QC L  NMLNEKIY+FLWFW+ +V ++T I+I +W  +I+FL  R+ FIKKFL  HE Y +S +  ++NFI+ FLRHDG F+I M+ +N GD+IT+ +V  L+EIY+  Y + D    T+  K   +   L+  PNIS SD S   +P++N
Sbjct:    1 MVANTLLDLIKSHKVTDYQGLEDIGDKISFQISVIIYIICGFIVTSKTYILKPLSCYTAISPTGSNFDGYLRNYCWITGTVPWVPGDKFPQVGDDMKLDDSLKKINYYQWVPFVLALQCIMFYLPRLFWQLMSYNKIGIDLELIFKDASSASNDDEAARKKKAKGIAKNLANVFFFHRDYKYGTWANFRRKIFKFASFFMMSKRLGTWLTYWYFVMKLMFLANAVGQLYLIQRFLGFHGNNIFET-SRVFFDSLVNGVQWTTSRLFPRVTVCSIDNIKLLGVENNYITQCVLSQNMLNEKIYMFLWFWLHIVIVVTLITIGLWCKKIIFLGSRAEFIKKFLKNHEVYRKSKRDSLDNFIQTFLRHDGSFIIMMMTMNCGDLITSHVVSELWEIYQSEYANSD----TSSEKDPQL---LKIYPNIS-SDFS---EPMKN 427          
BLAST of Ddo_008154 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 87.8113 bits (216), Expect = 2.617e-18
Identity = 74/269 (27.51%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  293 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITIL------PGEKIP----QNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYI 1057
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +    L   +   YYQWV F L  Q I+FY PR +W+    +  G  +  L+ + +    I  E   A+ +   + + D L+++  Y +                         W    Y + + L  IN+IGQ+++M  F  F+    TFG  V+D +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIYI
Sbjct:   49 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIG--ICSE---AEKKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYI 275          
BLAST of Ddo_008154 vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 87.8113 bits (216), Expect = 2.617e-18
Identity = 74/269 (27.51%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  293 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITIL------PGEKIP----QNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYI 1057
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +    L   +   YYQWV F L  Q I+FY PR +W+    +  G  +  L+ + +    I  E   A+ +   + + D L+++  Y +                         W    Y + + L  IN+IGQ+++M  F  F+    TFG  V+D +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIYI
Sbjct:   49 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIG--ICSE---AEKKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYI 275          
BLAST of Ddo_008154 vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 87.8113 bits (216), Expect = 2.617e-18
Identity = 74/269 (27.51%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  293 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITIL------PGEKIP----QNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYI 1057
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +    L   +   YYQWV F L  Q I+FY PR +W+    +  G  +  L+ + +    I  E   A+ +   + + D L+++  Y +                         W    Y + + L  IN+IGQ+++M  F  F+    TFG  V+D +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIYI
Sbjct:   49 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIG--ICSE---AEKKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYI 275          
BLAST of Ddo_008154 vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 87.4261 bits (215), Expect = 2.798e-18
Identity = 74/269 (27.51%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  293 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITILP------GEKIP----QNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYI 1057
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +    L   +   YYQWV F L  Q I+FY PR +W+    +  G  +  L+ + +    I  E   A+ +   + + D L+++  Y +                         W    Y + + L  IN+IGQ+++M  F  F+    TFG  V+D +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIYI
Sbjct:   33 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIG--ICSE---AEKKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYI 259          
BLAST of Ddo_008154 vs. RefSeq Drosophila melanogaster
Match: gi|161077972|ref|NP_608410.2| (shaking B, isoform D [Drosophila melanogaster])

HSP 1 Score: 87.4261 bits (215), Expect = 8.800e-18
Identity = 74/269 (27.51%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  293 KSYFFKPLAC-YIATVPSGSNFENYLENYCWVHGTITIL------PGEKIP----QNDEAWTLLDNTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANSANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCVFSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESG---IFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIYI 1057
            + Y   P+ C +   +P     E+ L  YCW+H T T++       G ++P     N +    L   +   YYQWV F L  Q I+FY PR +W+    +  G  +  L+ + +    I  E   A+ +   + + D L+++  Y +                         W    Y + + L  IN+IGQ+++M  F  F+    TFG  V+D +   +E        IFPR+T C   +    G   K+ A C LP+N++NEKIYI
Sbjct:  204 RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPL-TIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIG--ICSE---AEKKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYI 430          
The following BLAST results are available for this feature:
BLAST of Ddo_008154 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL5.863e-6034.22RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL5.653e-5232.62RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR3.428e-4930.89RecName: Full=Innexin-19[more]
gi|10720052|sp|Q23157|INX11_CAEEL1.297e-4729.83RecName: Full=Innexin-11; AltName: Full=Protein op... [more]
gi|74959869|sp|O61715|INX19_CAEEL3.477e-4730.39RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
back to top
BLAST of Ddo_008154 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008370.000e+072.95Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006570.000e+064.32Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150281811.509e-13047.63SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
SMU150364821.877e-12448.52dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150182642.120e-12447.15SmedSxldir_c107242_g1_i1|m.71544|m.38668[more]
back to top
BLAST of Ddo_008154 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_008154 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|386764824|ref|NP_001245787.1|2.617e-1827.51shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|2.617e-1827.51shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|2.617e-1827.51shaking B, isoform I [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|2.798e-1827.51shaking B, isoform C [Drosophila melanogaster][more]
gi|161077972|ref|NP_608410.2|8.800e-1827.51shaking B, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_008154 ID=Ddo_008154|Name=Ddo_008154|organism=Dugesia dorotocephala|type=mRNA|length=1914bp
CCACTATGTAACTAAATCAGTGAATATTGTTTACATATCGAAGGTTTTTA
TATAAACTTATCGAAATGAACGGAAACGCAAGAACTATAAATGAATTTAT
AATCCAATTTGAACCTGTTTGTCATTAATTTTTGTGTGAATTTTAAGAAT
TTCAATGGTCGCAGAAGAATTTCTATCCTTAATTGGACAATTTAAATTGT
CGACCTATGTAGGGGTTGAAGATTTTGCAGATAAACTGAGCTTTTTGTTC
AGCGTTGTCATCTTGATAATATCAATGATGATAGTCACAGTCAAGTCTTA
TTTCTTTAAACCTCTCGCATGTTATATAGCTACTGTTCCAAGCGGTTCTA
ATTTTGAAAACTATTTGGAAAATTATTGCTGGGTTCATGGAACAATTACC
ATTTTACCAGGTGAAAAAATCCCTCAAAATGATGAAGCATGGACATTGTT
GGATAATACGAGAAGAATAACGTATTATCAATGGGTTCCATTCATTCTTG
GTTTACAATGCATCATGTTTTATATTCCTCGAATCATATGGCAACTCATA
TGTTATAATAAAGTTGGTACAAATTTGGAAACTCTAGTAACTAACGCCAA
CTCTGCCAATGAGATTCCACCTGAAGAAAGGAAAGCTAAAGTTGAAGGAA
TTGCTCGAACGATTGAGGATATGCTGTATCAACATAGGGATTATCGCCAC
GGTAAAATAGCTGACATGAGAAGACAATTATTTGATAAATGTAACTTTTG
TGTTTTCTCAAAACATCTTGGTACCTGGCTAGTATTGTCATACATGTTAA
TGAAGTTTCTGTACGCAATTAATCTAATCGGTCAGCTGTATATAATGAAA
AGTTTCTTGGGTTTTAACAGTTCAATGAAGACGTTTGGTTACACAGTGCT
GGACAATATAGTTCAAGGAAAGGAATGGCATGAAAGTGGAATATTTCCTC
GAGTGACCTATTGTCACATTGGCGAAATCAGACATTTGGGGGCAAGTAAC
AAATACATTGCTCAATGTGCTCTACCAATAAATATGTTAAATGAAAAGAT
ATATATATTCCTTTGGTTTTGGGTATTATTGGTTTTCCTAATAACTGCCA
TAAGTATTCCGATGTGGTTCTTTCGAATCGTGTTCCTCAGCCGACGAAGC
AGTTTTATTAAGAAATTTTTGTTAATGCACGAAACGTATGACAGATCAAA
CAAGCAAATAATGAATAATTTCATTCGCGAATTCTTACGACATGACGGAG
TATTCTTGATTCGAATGATCTTCATCAACGCAGGAGATATAATCACAGCG
GACATCGTTCACAGGTTGTTTGAGATATACAAAGAGAACTACAAGGACAT
TGACTTCCGTAACTTTACGGCTTATTCCAAACCGATGAGCGTGGGGACGG
CTCTTCGACGGAACCCAAATATTTCCGGATCAGATGAGTCCATAAAAAAG
CAGCCTCTTGAAAATTTTGTTTAACAATTTTAGTACGGATTTTGAAACTT
TTTATTGTCATTTTAATTTTTACATTTGATTTTAACGTTTTTTATGATTT
TATGCCACATGTGATTTTGATGTTCATTTTGAAGCTCAACGTTTGATTAA
TTTTCATGTTGTAATTTATAAAGAGACCCTTGTTAAGAATTGTTTTTATT
TATCTCTAACATTTTTGGAAATATTTACAAAAATCAATGTCTTCAATATG
GTCTTCTTTGTTAATACTTTTTCTAGATATGCTTCTGGTCTTTGACAAAG
GTTTTGATCAAATGAGCTCCAACCTAAAATATGTCGCTTCGTTTGAAGAT
TTGTCTTAACAAATATTTTTAAATTTAAATTCATTTTCGGAAAGGATTTT
TGCTTTGTCTGCTTCAAAATCGCCATTTCGTACCTCTTTATATTATTATT
ATTATTATTATTAT

Design Primers for Ddo_008154

back to top

protein sequence

>Ddo_008154-protein ID=Ddo_008154-protein|Name=Ddo_008154|organism=Dugesia dorotocephala|type=polypeptide|length=440bp
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
back to top

coding sequence

>Ddo_008154.155.1474 ID=Ddo_008154.155.1474|Name=Ddo_008154.155.1474|organism=Dugesia dorotocephala|type=CDS|length=1320bp
ATGGTCGCAGAAGAATTTCTATCCTTAATTGGACAATTTAAATTGTCGAC
CTATGTAGGGGTTGAAGATTTTGCAGATAAACTGAGCTTTTTGTTCAGCG
TTGTCATCTTGATAATATCAATGATGATAGTCACAGTCAAGTCTTATTTC
TTTAAACCTCTCGCATGTTATATAGCTACTGTTCCAAGCGGTTCTAATTT
TGAAAACTATTTGGAAAATTATTGCTGGGTTCATGGAACAATTACCATTT
TACCAGGTGAAAAAATCCCTCAAAATGATGAAGCATGGACATTGTTGGAT
AATACGAGAAGAATAACGTATTATCAATGGGTTCCATTCATTCTTGGTTT
ACAATGCATCATGTTTTATATTCCTCGAATCATATGGCAACTCATATGTT
ATAATAAAGTTGGTACAAATTTGGAAACTCTAGTAACTAACGCCAACTCT
GCCAATGAGATTCCACCTGAAGAAAGGAAAGCTAAAGTTGAAGGAATTGC
TCGAACGATTGAGGATATGCTGTATCAACATAGGGATTATCGCCACGGTA
AAATAGCTGACATGAGAAGACAATTATTTGATAAATGTAACTTTTGTGTT
TTCTCAAAACATCTTGGTACCTGGCTAGTATTGTCATACATGTTAATGAA
GTTTCTGTACGCAATTAATCTAATCGGTCAGCTGTATATAATGAAAAGTT
TCTTGGGTTTTAACAGTTCAATGAAGACGTTTGGTTACACAGTGCTGGAC
AATATAGTTCAAGGAAAGGAATGGCATGAAAGTGGAATATTTCCTCGAGT
GACCTATTGTCACATTGGCGAAATCAGACATTTGGGGGCAAGTAACAAAT
ACATTGCTCAATGTGCTCTACCAATAAATATGTTAAATGAAAAGATATAT
ATATTCCTTTGGTTTTGGGTATTATTGGTTTTCCTAATAACTGCCATAAG
TATTCCGATGTGGTTCTTTCGAATCGTGTTCCTCAGCCGACGAAGCAGTT
TTATTAAGAAATTTTTGTTAATGCACGAAACGTATGACAGATCAAACAAG
CAAATAATGAATAATTTCATTCGCGAATTCTTACGACATGACGGAGTATT
CTTGATTCGAATGATCTTCATCAACGCAGGAGATATAATCACAGCGGACA
TCGTTCACAGGTTGTTTGAGATATACAAAGAGAACTACAAGGACATTGAC
TTCCGTAACTTTACGGCTTATTCCAAACCGATGAGCGTGGGGACGGCTCT
TCGACGGAACCCAAATATTTCCGGATCAGATGAGTCCATAAAAAAGCAGC
CTCTTGAAAATTTTGTTTAA
back to top
Gene Groups
Ddo_008154 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.