Ddo_007492, Ddo_007492 (mRNA) Dugesia dorotocephala

Overview
NameDdo_007492
Unique NameDdo_007492
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length813
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_007492 vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 122.479 bits (306), Expect = 1.209e-30
Identity = 69/238 (28.99%), Postives = 130/238 (54.62%), Query Frame = 1
Query:  100 EDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDML-FQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHW 810
            +D  DKL++  +   I++  ++V+ K Y   P+ C+V  T +    + Y ENYCWV  T  +   D +P N   +A+ +N  +I YYQWVPF+L L+ ++FY+P I+W+L+ + ++G  ++ L+  A  +     + R   +  +A  +E+ L  +H+V    ++         + N  + ++  G  +   Y+ +K LY +N+ GQ+ ++  FLG  +    +G  VL++++NGR W
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHN---YAERENR-QIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRL--------KLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREW 242          
BLAST of Ddo_007492 vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 117.087 bits (292), Expect = 2.157e-28
Identity = 68/238 (28.57%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  100 EDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHWH 813
            +DF DKL++  +   ++   ++V+ K Y   P+ C+V  T +    + Y ENYCWV  T  +   + +P+       +  + +I YYQWVPFIL ++ ++FY+P I+W+ + Y  +G +L+ L+  A  A     + +T  V  +AR ++D +    + RQG     R    N+       +H G ++ + Y+ +K LY  NV  Q  ++   LG ND   ++G+++L ++++   W 
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHS---RSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWE 366          
BLAST of Ddo_007492 vs. uniprot
Match: gi|10719983|sp|Q27295|EAT5_CAEEL (RecName: Full=Innexin eat-5; AltName: Full=Abnormal pharyngeal pumping eat-5)

HSP 1 Score: 112.849 bits (281), Expect = 3.034e-27
Identity = 67/236 (28.39%), Postives = 118/236 (50.00%), Query Frame = 1
Query:  109 ADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQ-GKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHWH 813
             D+L++  S L I    + +T + Y   PL C+V    +   ++ Y E+YC+V+ T  + P DK+P   +E        ++ YYQW PFI+ ++   FY+P I W ++   K+G ++  L+  A KA     +ER + +D + R I + L + R   +  K+A+++R         +F    G ++   Y++ K +Y  N F Q     +FLG ND    +G  +L +++ G  W 
Sbjct:   20 TDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKA-WEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQ----QLIYYQWAPFIMAIEAAFFYLPVIFWSMLS-TKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRRNEEETTKMAKIQR---------IFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPY--WGMRILDDILKGTDWE 238          
BLAST of Ddo_007492 vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 110.153 bits (274), Expect = 2.473e-26
Identity = 67/238 (28.15%), Postives = 118/238 (49.58%), Query Frame = 1
Query:  100 EDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHWH 813
            +D  D+LS++ +   ++   ++V+ K Y    + C++     G  ++ Y E+YC++  T  I    ++P + ++  KA+    I YYQWVP +L +Q  MFY+P  IW  + Y + G D   +I+EA    +   + RT+ V+KL   I D+L        G+    R           F K +G+   + Y+ +K +Y  NVF Q  I+ +FLG  +    +G+   +++  GR W 
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG--NETFLWGFHTFADLYAGREWQ 239          
BLAST of Ddo_007492 vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 102.064 bits (253), Expect = 1.645e-23
Identity = 74/245 (30.20%), Postives = 127/245 (51.84%), Query Frame = 1
Query:   94 GVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKA-ANNSPKERTEVVDKLARTIEDMLFQH----RVYRQGKVAELRRKVYNMCNFCVFSKHM-GTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHW 810
            G +D  D+L++  + L +++  +V++ K Y   P+ C+V    S  + + Y+E+YCW+  T  I   + +P  DD  A+ +   +I YYQWVPFIL  + +MF +P I W+L C  ++G +++ LIN A  A A     +R + V+ +     D L       R+  +G +A ++           FS+ + G  + + Y   K LY +NV  Q  I+   L  ++ +  FG+ VLS++  GR W
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREEK--QIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFV-FFGFQVLSDIWAGRPW 245          
BLAST of Ddo_007492 vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 408.683 bits (1049), Expect = 3.363e-141
Identity = 182/259 (70.27%), Postives = 221/259 (85.33%), Query Frame = 1
Query:   37 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHWH 813
            MVAEEF+ L+ + K+S YVG+EDFADKLSF+ SV  + +S+MVVTIKSY FKPLACY AT P G NF+NYLENYCWVHGTI+ LPG+ +PQND +WA+AD+  RI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK+GT+LE ++N+A+ A N  P ER + ++++ARTIEDMLFQHR YRQG  A+LRRKVYN CNFCVFSKHMGTWL+L Y+L+K LY +NV GQL IMK+FLGFN++ SSFGYTVLSNMI+G+ WH
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWH 259          
BLAST of Ddo_007492 vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 372.089 bits (954), Expect = 5.698e-127
Identity = 161/259 (62.16%), Postives = 212/259 (81.85%), Query Frame = 1
Query:   37 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHWH 813
            MVA+EF+ L+D+ KLS Y G+EDFAD+L+F+ SV+ +S+S+++VT K+YFFKPL+CYVATTPSGMNFD Y+ENYCWVHGTI  L  +++P   ++WA  D D RITYYQWVPFILGLQCI+FYIP+++W++ICYNK GT+LE LI  A+ ++   P ER  V++ + R IED+L+QHR YRQGK+A+ RR++Y  CNFCVFSKH+GTWLV  Y  +KCLY INV GQL +MK FLGFN S+SSFGYT+L+++I+G+ WH
Sbjct:    1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWH 259          
BLAST of Ddo_007492 vs. Smed Unigenes AA
Match: SMU15013374 (SmedAsxldir_c86730_g1_i1|m.25397|m.18312)

HSP 1 Score: 267.314 bits (682), Expect = 5.165e-86
Identity = 123/261 (47.13%), Postives = 180/261 (68.97%), Query Frame = 1
Query:   37 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSI--SSFGYTVLSNMINGRHWH 813
            MVA EF+  + K +++ Y G+EDFADK +F  +V+ + +S +VVT+K Y  KP++CY++T   G+N  NYLENYCW+ GTI I    K+P  + E    + D +I YYQWVPF LGLQCIMFY PR+IWQL+CYN TGTD++ L+  A++A ++S + R ++V  LA++I    +QHR YR+  +A  R+ VY  CNF + SK MGT + + Y+L+K LY  N F QL +M+RFLGF+D+   S FG  +++N+++G+ W 
Sbjct:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFTVIVLLLSTLVVTVKQYVLKPISCYMSTDVGGLNLLNYLENYCWIQGTIPISYNGKIPATEQELEILE-DKKILYYQWVPFALGLQCIMFYFPRLIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQHREYRKDALANFRKTVYRFCNFFIVSKRMGTRITIYYILLKFLYLTNSFLQLYLMQRFLGFSDNQNNSLFGLNIINNILSGKDWQ 260          
BLAST of Ddo_007492 vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 266.159 bits (679), Expect = 2.232e-85
Identity = 126/258 (48.84%), Postives = 178/258 (68.99%), Query Frame = 1
Query:   37 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNMINGRHW 810
            MVA +FI  + K ++S Y GVEDFADK +F+ +V+ + +   +VT+K Y  KP++CY++T  SG N   Y+ENYCWV GTI I    K+P  ++EWA+  N  +I YYQWVPF+L LQ IMFYIPR+IWQ+ CYN TGTD+  LI  A++A ++S + RT++V+ +A+TIE ML+QHR  R G++A  RR +Y +C FC+ SK  GT L+  Y ++K LY  N   QL  MK FLG N++   FG+ ++ N+ING+ W
Sbjct:    1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAEL-NKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDW 256          
BLAST of Ddo_007492 vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 265.388 bits (677), Expect = 3.439e-85
Identity = 120/259 (46.33%), Postives = 185/259 (71.43%), Query Frame = 1
Query:   37 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFND-SISSFGYTVLSNMINGRHW 810
            MVA EF+  + KL++S  VG+ED  D+L+F  SV+ + + I++VT+K Y FKP++CY+     G N  +Y+EN CWV GTI++    K P  D+EW   +   ++ YYQWVPF+LGLQCIMFY+P+++WQ+ICYN+TGTD++ L+  A++A ++S + R+++V  L++T+E +L+QHR +R GK+A+ RRK++N   F + SK +GTWLV  Y+L+K  Y  N F QL IM++FLGF+D ++ +FG  V +N+ +G  W
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKH-KMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDW 258          
BLAST of Ddo_007492 vs. RefSeq Drosophila melanogaster
Match: gi|18858897|ref|NP_572375.1| (innexin 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 56.6102 bits (135), Expect = 6.632e-9
Identity = 54/231 (23.38%), Postives = 100/231 (43.29%), Query Frame = 1
Query:  115 KLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISI---LPG----DKLPQNDDEWAKADNDLRI-TYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVL 783
            ++ +  +V+ +    ++VT + Y   P+ C V   P G+     ++ YCW++ T ++   L G    D +        + +++++   YYQWV F+L  Q I+FY+PR +W+    +  G  L+ L+ +      NSP    E  +   + + D            +  L R      NF  F           + + + L  +NV GQ+  +  FL  +   S++G  VL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDL-----NSPIVNDECKNDRKKILVDYF----------IGNLNRH-----NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVL 214          
BLAST of Ddo_007492 vs. RefSeq Drosophila melanogaster
Match: gi|24640280|ref|NP_727150.1| (innexin 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 56.6102 bits (135), Expect = 6.632e-9
Identity = 54/231 (23.38%), Postives = 100/231 (43.29%), Query Frame = 1
Query:  115 KLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISI---LPG----DKLPQNDDEWAKADNDLRI-TYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVL 783
            ++ +  +V+ +    ++VT + Y   P+ C V   P G+     ++ YCW++ T ++   L G    D +        + +++++   YYQWV F+L  Q I+FY+PR +W+    +  G  L+ L+ +      NSP    E  +   + + D            +  L R      NF  F           + + + L  +NV GQ+  +  FL  +   S++G  VL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDL-----NSPIVNDECKNDRKKILVDYF----------IGNLNRH-----NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVL 214          
BLAST of Ddo_007492 vs. RefSeq Drosophila melanogaster
Match: gi|281359964|ref|NP_001162684.1| (innexin 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 56.6102 bits (135), Expect = 6.632e-9
Identity = 54/231 (23.38%), Postives = 100/231 (43.29%), Query Frame = 1
Query:  115 KLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISI---LPG----DKLPQNDDEWAKADNDLRI-TYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVL 783
            ++ +  +V+ +    ++VT + Y   P+ C V   P G+     ++ YCW++ T ++   L G    D +        + +++++   YYQWV F+L  Q I+FY+PR +W+    +  G  L+ L+ +      NSP    E  +   + + D            +  L R      NF  F           + + + L  +NV GQ+  +  FL  +   S++G  VL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDL-----NSPIVNDECKNDRKKILVDYF----------IGNLNRH-----NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVL 214          
BLAST of Ddo_007492 vs. RefSeq Drosophila melanogaster
Match: gi|442615370|ref|NP_001259301.1| (innexin 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 56.6102 bits (135), Expect = 6.632e-9
Identity = 54/231 (23.38%), Postives = 100/231 (43.29%), Query Frame = 1
Query:  115 KLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISI---LPG----DKLPQNDDEWAKADNDLRI-TYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVL 783
            ++ +  +V+ +    ++VT + Y   P+ C V   P G+     ++ YCW++ T ++   L G    D +        + +++++   YYQWV F+L  Q I+FY+PR +W+    +  G  L+ L+ +      NSP    E  +   + + D            +  L R      NF  F           + + + L  +NV GQ+  +  FL  +   S++G  VL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDL-----NSPIVNDECKNDRKKILVDYF----------IGNLNRH-----NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVL 214          
BLAST of Ddo_007492 vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 55.4546 bits (132), Expect = 1.690e-8
Identity = 55/229 (24.02%), Postives = 92/229 (40.17%), Query Frame = 1
Query:  136 VLFISMSIMVVTIKSYFFKPLAC-YVATTPSGMNFDNYLENYCWVHGTISIL------PGDKLPQNDDEWAKADNDLRIT---YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLSNM 792
            +L I+ SI  VT + Y   P+ C +    P     ++ L  YCW+H T +++       G ++P      ++    L I    YYQWV F L  Q I+FY PR +W+    +  G  +  LI +      +  +++ +    L    E++ + +                              W    Y + + L  INV GQ+ +M RF  F+    +FG  V+  M
Sbjct:   37 ILLITFSI-AVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHN------------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYM 223          
The following BLAST results are available for this feature:
BLAST of Ddo_007492 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL1.209e-3028.99RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL2.157e-2828.57RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|10719983|sp|Q27295|EAT5_CAEEL3.034e-2728.39RecName: Full=Innexin eat-5; AltName: Full=Abnorma... [more]
gi|12643734|sp|Q19746|INX3_CAEEL2.473e-2628.15RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR1.645e-2330.20RecName: Full=Innexin-19[more]
back to top
BLAST of Ddo_007492 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008373.363e-14170.27Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006575.698e-12762.16Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150133745.165e-8647.13SmedAsxldir_c86730_g1_i1|m.25397|m.18312[more]
SMU150331262.232e-8548.84SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
SMU150364823.439e-8546.33dd_smedV4_10766_0_1|m.1746|m.10467[more]
back to top
BLAST of Ddo_007492 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ddo_007492 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18858897|ref|NP_572375.1|6.632e-923.38innexin 2, isoform A [Drosophila melanogaster][more]
gi|24640280|ref|NP_727150.1|6.632e-923.38innexin 2, isoform B [Drosophila melanogaster][more]
gi|281359964|ref|NP_001162684.1|6.632e-923.38innexin 2, isoform C [Drosophila melanogaster][more]
gi|442615370|ref|NP_001259301.1|6.632e-923.38innexin 2, isoform D [Drosophila melanogaster][more]
gi|386764824|ref|NP_001245787.1|1.690e-824.02shaking B, isoform G [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_007492 ID=Ddo_007492|Name=Ddo_007492|organism=Dugesia dorotocephala|type=mRNA|length=813bp
TAAAGTTACGGCAACGATTATCACTCTCGGTTAACAATGGTCGCGGAAGA
ATTCATTGGACTTGTGGACAAGTTGAAGTTGTCCAAGTATGTGGGGGTTG
AGGACTTTGCAGATAAGCTTAGCTTCATGATGAGCGTGCTGTTCATCAGT
ATGTCCATTATGGTGGTCACCATCAAGTCGTACTTCTTCAAGCCTCTGGC
CTGCTATGTGGCCACAACCCCCAGCGGCATGAACTTCGATAACTACCTGG
AGAACTATTGCTGGGTGCACGGCACCATCTCCATCCTGCCTGGTGACAAG
CTGCCACAGAACGATGATGAATGGGCCAAGGCGGACAACGACCTCAGAAT
AACGTACTACCAATGGGTGCCATTCATCCTCGGCCTCCAGTGCATCATGT
TCTACATCCCGAGGATCATCTGGCAACTGATCTGCTACAATAAGACAGGA
ACCGACCTCGAGTTCCTCATCAACGAGGCCAGCAAGGCTGCCAACAACTC
ACCGAAGGAGCGCACGGAGGTCGTTGACAAATTGGCGCGCACCATCGAGG
ACATGCTCTTCCAGCACCGAGTCTACCGGCAGGGCAAGGTCGCGGAACTG
CGCCGCAAGGTGTACAACATGTGCAACTTCTGCGTGTTCTCAAAGCACAT
GGGCACGTGGCTAGTGCTGTGCTACATGCTGATGAAGTGTCTGTATTGCA
TCAACGTATTTGGTCAGCTGACCATCATGAAACGGTTTCTGGGCTTCAAC
GATTCCATCTCATCCTTTGGGTACACGGTGCTATCAAATATGATCAATGG
GCGCCACTGGCAC

Design Primers for Ddo_007492

back to top

protein sequence

>Ddo_007492-protein ID=Ddo_007492-protein|Name=Ddo_007492|organism=Dugesia dorotocephala|type=polypeptide|length=259bp
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
back to top

coding sequence

>Ddo_007492.37.813 ID=Ddo_007492.37.813|Name=Ddo_007492.37.813|organism=Dugesia dorotocephala|type=CDS|length=777bp
ATGGTCGCGGAAGAATTCATTGGACTTGTGGACAAGTTGAAGTTGTCCAA
GTATGTGGGGGTTGAGGACTTTGCAGATAAGCTTAGCTTCATGATGAGCG
TGCTGTTCATCAGTATGTCCATTATGGTGGTCACCATCAAGTCGTACTTC
TTCAAGCCTCTGGCCTGCTATGTGGCCACAACCCCCAGCGGCATGAACTT
CGATAACTACCTGGAGAACTATTGCTGGGTGCACGGCACCATCTCCATCC
TGCCTGGTGACAAGCTGCCACAGAACGATGATGAATGGGCCAAGGCGGAC
AACGACCTCAGAATAACGTACTACCAATGGGTGCCATTCATCCTCGGCCT
CCAGTGCATCATGTTCTACATCCCGAGGATCATCTGGCAACTGATCTGCT
ACAATAAGACAGGAACCGACCTCGAGTTCCTCATCAACGAGGCCAGCAAG
GCTGCCAACAACTCACCGAAGGAGCGCACGGAGGTCGTTGACAAATTGGC
GCGCACCATCGAGGACATGCTCTTCCAGCACCGAGTCTACCGGCAGGGCA
AGGTCGCGGAACTGCGCCGCAAGGTGTACAACATGTGCAACTTCTGCGTG
TTCTCAAAGCACATGGGCACGTGGCTAGTGCTGTGCTACATGCTGATGAA
GTGTCTGTATTGCATCAACGTATTTGGTCAGCTGACCATCATGAAACGGT
TTCTGGGCTTCAACGATTCCATCTCATCCTTTGGGTACACGGTGCTATCA
AATATGATCAATGGGCGCCACTGGCAC
back to top
Gene Groups
Ddo_007492 is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.