Ddo_002056, Ddo_002056 (mRNA) Dugesia dorotocephala

Overview
NameDdo_002056
Unique NameDdo_002056
TypemRNA
OrganismDugesia dorotocephala (D. dorotocephala)
Sequence length1132
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Dugesia dorotocephala Transcriptome2016-03-03
Dugesia dorotocephala BLASTX Human2016-03-08
Dugesia dorotocephala BLASTX Drosophila melanogaster2016-03-08
Dugesia dorotocephala BLASTX Swissprot Uniprot2016-03-07
Dugesia dorotocephala BLASTX Schmidtea mediterranea2016-03-08
Dugesia dorotocephala CDS2016-04-26
Homology
BLAST of Ddo_002056 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 317/377 (84.08%), Postives = 344/377 (91.25%), Query Frame = 3
Query:    3 KLELLYSVASTKADNQPFCFDGRRLFTPSQWHK-EDIETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD 1130
            KLELL + A++K + QPFCFDGRRLFT S+WH  ED E   IKD E+SIR L TF++N+EEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI+EGPSFFKM+NFKILGGYSTTITRGTNE+GTASTLLYLERINRVLNEN+V++VYRRDQIDQLIGRDIITKYNNKTYRISDIKEM +NDE++L   KISY NYFKQRYNI LKNDKQPFVISR+KRSM  RPKEK+ENEPEGP ETDQSLSIPGELCYLCGFSDSERSNINLQK+LG VLKREPRER+NDI+DFCKWTG GKSKDYMK+W M IEEQPITIRGREL PVDI SN+VKIN K PDDWKFGE+KFDVPKG  HRFGVLVVDRNPSHFNNFI+D
Sbjct:   78 KLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMV-RPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIED 453          
BLAST of Ddo_002056 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 422.165 bits (1084), Expect = 7.887e-139
Identity = 206/382 (53.93%), Postives = 274/382 (71.73%), Query Frame = 3
Query:    3 KLELLYSVASTKADNQP--FCFDGRRLFTPSQWHK-EDIETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKE--GPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKDYMKT-WNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD 1130
            KL+L   V   K  N P  FC+DGRRLFT   W +  DI+ F I +++VS+R ++TF+ +TEEYYQMIN++ NN+QI MGQEKIG+ +FLGSN     + +  GP+FF+  NFK+LGG+ TT+ RGT  +G  +TLLY+ERINRVLN+NSV+  Y R  IDQLIGRDI+TKYNNKTYRIS+IKEM IN+  E+ G  +SY  YFK+RYNI L  ++QPFV++R+K+ +  R K K  NE E P++ D +L+I GELC+LCGFSD E+SNI+LQK+LG VLKR PRER++DI  FC W     +   M   W + I+  P+ I GRELP  D++S   +IN K  DDWKFG+V+F+V KG+ H   V++VDRN S + NF++D
Sbjct:   80 KLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKK-IARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLND 460          
BLAST of Ddo_002056 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 388.267 bits (996), Expect = 1.161e-125
Identity = 192/386 (49.74%), Postives = 264/386 (68.39%), Query Frame = 3
Query:    3 KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKE-DIETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--KEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR------PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKDYM-KTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD 1130
            KL+ +  V         FCFDGRRLFT  +WH E DI+ F+  ++++++R ++T +  TEEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+  +FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+NSV+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM ++++ E+ G  +SY  YFK+RYNI L    QPFV++R+K+ M            + E E E P+E D +L+IPGELC+LCGFSD E+SN++LQK+LG VLKREPRER++DI  +C W     +   M   W + I+ +P+ I GRELPP D++S   KIN K  DDWKFG V+FD+ +   H   V++VDRN   + NF++D
Sbjct:   89 KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMND 474          
BLAST of Ddo_002056 vs. uniprot
Match: gi|46577084|sp|Q8UVX0|PIWL1_DANRE (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.614e-20
Identity = 82/321 (25.55%), Postives = 141/321 (43.93%), Query Frame = 3
Query:   60 FDGRRLFTPSQWHKEDI----ETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV---YRRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDI-KDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELP 968
            FDG  LF P++    +     ET N +  E+++        ++    Q  NI+F  I   +  ++IGR ++           + P         I  G+ TTI +       +S +L  +  ++VL   +V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  +   T+IS+ NYFK +Y + + +  Q  ++S +KR                      ++ +P E CYL G +D  R++ N+ K L    +  P +R   I +        G  ++ + TW ++ E + +++ GR LP
Sbjct:  161 FDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY---------NPDDPFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP-----------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLP 455          
BLAST of Ddo_002056 vs. uniprot
Match: gi|33112431|sp|Q9VKM1|PIWI_DROME (RecName: Full=Protein piwi)

HSP 1 Score: 93.5893 bits (231), Expect = 2.228e-19
Identity = 94/380 (24.74%), Postives = 174/380 (45.79%), Query Frame = 3
Query:   54 FCFDGRRLFTPSQWHKEDIETFNIKDE-----EVSIRFLATFIENTE-EYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRD----------IITKYNNKTYRISDIKEMGINDE--IELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDF-CKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWK--FGEVK-FDVPKGITHRFGVLVVDRNPSHFNNFID 1127
            + FDG +LFT  ++ +E I   + K +     ++SI+F+  FI   E  + Q++N++       +  E +GR  F         I+E    FKME   +  GY T+I +   +      LL  E  ++V+   ++  + RR   +    +D          ++T YNN+TYRI+D+ + G   +      G  IS+  Y+  +YNI +++  QP +IS+      +R K    N  E        + IP ELC + G +   RSN  L +++    +  P++R + ++ F  +     +S   ++ WNM +++    ++GR +   +I+ ++ K+ A    DW+  F + +    P     R+ V+   RN       +D
Sbjct:  146 YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF--DPRAKIEIRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDV-DFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTNASE------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLD 495          
BLAST of Ddo_002056 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 317/377 (84.08%), Postives = 344/377 (91.25%), Query Frame = 3
Query:    3 KLELLYSVASTKADNQPFCFDGRRLFTPSQWHK-EDIETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD 1130
            KLELL + A++K + QPFCFDGRRLFT S+WH  ED E   IKD E+SIR L TF++N+EEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI+EGPSFFKM+NFKILGGYSTTITRGTNE+GTASTLLYLERINRVLNEN+V++VYRRDQIDQLIGRDIITKYNNKTYRISDIKEM +NDE++L   KISY NYFKQRYNI LKNDKQPFVISR+KRSM  RPKEK+ENEPEGP ETDQSLSIPGELCYLCGFSDSERSNINLQK+LG VLKREPRER+NDI+DFCKWTG GKSKDYMK+W M IEEQPITIRGREL PVDI SN+VKIN K PDDWKFGE+KFDVPKG  HRFGVLVVDRNPSHFNNFI+D
Sbjct:  121 KLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMV-RPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIED 496          
BLAST of Ddo_002056 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 387.111 bits (993), Expect = 2.901e-126
Identity = 192/390 (49.23%), Postives = 266/390 (68.21%), Query Frame = 3
Query:    3 KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKE-DIETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--KEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR----------PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKDYM-KTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD 1130
            KL+ +  V         FCFDGRRLFT  +WH E DI+ F+  ++++++R ++T +  TEEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+  +FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+NSV+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM ++++ E+ G  +SY  YFK+RYNI L    QPFV++R+K+ M              +++ E E E P+E D +L+IPGELC+LCGFSD E+SN++LQK+LG VLKREPRER++DI  +C W     +   M   W + I+ +P+ I GRELPP D++S   KIN K  DDWKFG V+FD+ +   H   V++VDRN   + NF++D
Sbjct:   89 KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMND 478          
BLAST of Ddo_002056 vs. Smed Unigenes AA
Match: SMU15015027 (SmedAsxldir_c97534_g1_i3|m.40524|m.26292)

HSP 1 Score: 110.923 bits (276), Expect = 1.348e-29
Identity = 55/74 (74.32%), Postives = 61/74 (82.43%), Query Frame = 3
Query:  540 MGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCY 761
            M +NDE++L   KISY NYFKQRYNI LKND+QPFVISR+KRS+  R KEK ENEPEGP ETDQSLSI GEL Y
Sbjct:    1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSVV-RQKEKIENEPEGPTETDQSLSISGELGY 73          
BLAST of Ddo_002056 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 88.5817 bits (218), Expect = 6.982e-19
Identity = 95/358 (26.54%), Postives = 156/358 (43.58%), Query Frame = 3
Query:   57 CFDGRRLFTPSQW-HKEDIETFNIKDEEVSIRFLATFIENT--EEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY-------------RRDQIDQLIGRDIITKYNNKTYRISDIK-EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRI-KRSMTHRPKEKSENEPEGPKETDQSLS--IPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFC-KWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI-MSNDVKINAKTPDDWKFGEVKFDVPKGI 1064
             FDG  L+ P    +KE I   N   ++  +     F  N    E   + N++F  I+  +   KIGR +F           E          +I  GY T+I    N DG    LL  +  ++V+  +SV  +              +   I+QL+G+ ++T +NN+ YRI+DI        E +  G KISY +YFK  Y + +++ +QP ++S+   RS  +R        P+G KE D  L   IP ELC L G +D    +  L + L    +  P++R   + +F        ++K  +  W +TIE+  + I   ++ P  I   N+  ++A    ++K       V  GI
Sbjct:  265 AFDGMNLYIPQLLKNKETIIKVNKPTDKTVVDVKVVFTNNVNFSECPMVYNVLFKRIENSLRMVKIGRDYFY---------PEKKIVLDRRRMEIWPGYVTSIQ---NFDG--GLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSKSNSRSGKNR-------GPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGI 600          
BLAST of Ddo_002056 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 88.5817 bits (218), Expect = 3.615e-18
Identity = 77/324 (23.77%), Postives = 145/324 (44.75%), Query Frame = 3
Query:   57 CFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDI--KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGREL 965
             FDG  LF P +  ++  E F    N +D  ++I         +    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL   +V+              ++     +LIG  ++TKYNNKTYR+ DI   +   +   + +G+++S+  Y++++YN  + + KQP ++S+ KR               GP  T    ++ IP ELCYL G +D  R++ N+ K L    +  P +R  ++     +     + +  ++ W ++ +   ++  GR L
Sbjct:  162 AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL 457          
BLAST of Ddo_002056 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 88.5817 bits (218), Expect = 3.615e-18
Identity = 77/324 (23.77%), Postives = 145/324 (44.75%), Query Frame = 3
Query:   57 CFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDI--KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGREL 965
             FDG  LF P +  ++  E F    N +D  ++I         +    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL   +V+              ++     +LIG  ++TKYNNKTYR+ DI   +   +   + +G+++S+  Y++++YN  + + KQP ++S+ KR               GP  T    ++ IP ELCYL G +D  R++ N+ K L    +  P +R  ++     +     + +  ++ W ++ +   ++  GR L
Sbjct:  162 AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL 457          
BLAST of Ddo_002056 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 88.5817 bits (218), Expect = 3.615e-18
Identity = 77/324 (23.77%), Postives = 145/324 (44.75%), Query Frame = 3
Query:   57 CFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDI--KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGREL 965
             FDG  LF P +  ++  E F    N +D  ++I         +    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL   +V+              ++     +LIG  ++TKYNNKTYR+ DI   +   +   + +G+++S+  Y++++YN  + + KQP ++S+ KR               GP  T    ++ IP ELCYL G +D  R++ N+ K L    +  P +R  ++     +     + +  ++ W ++ +   ++  GR L
Sbjct:  162 AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL 457          
BLAST of Ddo_002056 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 88.5817 bits (218), Expect = 3.615e-18
Identity = 77/324 (23.77%), Postives = 145/324 (44.75%), Query Frame = 3
Query:   57 CFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDI--KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGREL 965
             FDG  LF P +  ++  E F    N +D  ++I         +    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL   +V+              ++     +LIG  ++TKYNNKTYR+ DI   +   +   + +G+++S+  Y++++YN  + + KQP ++S+ KR               GP  T    ++ IP ELCYL G +D  R++ N+ K L    +  P +R  ++     +     + +  ++ W ++ +   ++  GR L
Sbjct:  162 AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL 457          
BLAST of Ddo_002056 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 88.5817 bits (218), Expect = 3.615e-18
Identity = 77/324 (23.77%), Postives = 145/324 (44.75%), Query Frame = 3
Query:   57 CFDGRRLFTPSQWHKEDIETF----NIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV------------YRRDQIDQLIGRDIITKYNNKTYRISDI--KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKET--DQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKS-KDYMKTWNMTIEEQPITIRGREL 965
             FDG  LF P +  ++  E F    N +D  ++I         +    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL   +V+              ++     +LIG  ++TKYNNKTYR+ DI   +   +   + +G+++S+  Y++++YN  + + KQP ++S+ KR               GP  T    ++ IP ELCYL G +D  R++ N+ K L    +  P +R  ++     +     + +  ++ W ++ +   ++  GR L
Sbjct:  162 AFDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRR-------------RGPGGTLPGPAMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRIL 457          
BLAST of Ddo_002056 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 93.5893 bits (231), Expect = 2.572e-20
Identity = 94/380 (24.74%), Postives = 174/380 (45.79%), Query Frame = 3
Query:   54 FCFDGRRLFTPSQWHKEDIETFNIKDE-----EVSIRFLATFIENTE-EYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRD----------IITKYNNKTYRISDIKEMGINDE--IELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDF-CKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWK--FGEVK-FDVPKGITHRFGVLVVDRNPSHFNNFID 1127
            + FDG +LFT  ++ +E I   + K +     ++SI+F+  FI   E  + Q++N++       +  E +GR  F         I+E    FKME   +  GY T+I +   +      LL  E  ++V+   ++  + RR   +    +D          ++T YNN+TYRI+D+ + G   +      G  IS+  Y+  +YNI +++  QP +IS+      +R K    N  E        + IP ELC + G +   RSN  L +++    +  P++R + ++ F  +     +S   ++ WNM +++    ++GR +   +I+ ++ K+ A    DW+  F + +    P     R+ V+   RN       +D
Sbjct:  146 YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF--DPRAKIEIRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDV-DFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTNASE------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLD 495          
BLAST of Ddo_002056 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 93.5893 bits (231), Expect = 2.572e-20
Identity = 94/380 (24.74%), Postives = 174/380 (45.79%), Query Frame = 3
Query:   54 FCFDGRRLFTPSQWHKEDIETFNIKDE-----EVSIRFLATFIENTE-EYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRD----------IITKYNNKTYRISDIKEMGINDE--IELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDF-CKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWK--FGEVK-FDVPKGITHRFGVLVVDRNPSHFNNFID 1127
            + FDG +LFT  ++ +E I   + K +     ++SI+F+  FI   E  + Q++N++       +  E +GR  F         I+E    FKME   +  GY T+I +   +      LL  E  ++V+   ++  + RR   +    +D          ++T YNN+TYRI+D+ + G   +      G  IS+  Y+  +YNI +++  QP +IS+      +R K    N  E        + IP ELC + G +   RSN  L +++    +  P++R + ++ F  +     +S   ++ WNM +++    ++GR +   +I+ ++ K+ A    DW+  F + +    P     R+ V+   RN       +D
Sbjct:  146 YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVG-FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF--DPRAKIEIRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDV-DFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK------NRDKALKTNASE------LVVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLD 495          
BLAST of Ddo_002056 vs. RefSeq Drosophila melanogaster
Match: gi|17136494|ref|NP_476734.1| (aubergine, isoform A [Drosophila melanogaster])

HSP 1 Score: 91.6633 bits (226), Expect = 8.765e-20
Identity = 82/336 (24.40%), Postives = 156/336 (46.43%), Query Frame = 3
Query:   54 FCFDGRRLFTPSQWHKEDIETFNIK---------DEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFK--ILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQID-------QLIGRDIITKYNNKTYRISDIKEMGIN-DEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGK-SKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKI 1001
            + FDG  +F  +Q+       + ++         + E+ I+ + +      E +Q++N++       +  + + R ++           +  +   +ENF+  +  GY T+I +  N+    S + +  ++ R     ++++   RD  D        ++G  I+T YNNKTYRI D+        + + N  +ISY +Y+K+RYNI +++ KQP V+S        RP +K  N   G    DQ++ I  EL    G +D+ R++    +++    +  P  RI  ++ F K     K S + +K+WN+ ++   + I  R LPP  I+  + KI
Sbjct:  159 YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMS--------RPTDK--NIRGG---NDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKI 468          
BLAST of Ddo_002056 vs. RefSeq Drosophila melanogaster
Match: gi|161076864|ref|NP_001097144.1| (aubergine, isoform C [Drosophila melanogaster])

HSP 1 Score: 91.6633 bits (226), Expect = 1.060e-19
Identity = 82/336 (24.40%), Postives = 156/336 (46.43%), Query Frame = 3
Query:   54 FCFDGRRLFTPSQWHKEDIETFNIK---------DEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFK--ILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVYRRDQID-------QLIGRDIITKYNNKTYRISDIKEMGIN-DEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGK-SKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKI 1001
            + FDG  +F  +Q+       + ++         + E+ I+ + +      E +Q++N++       +  + + R ++           +  +   +ENF+  +  GY T+I +  N+    S + +  ++ R     ++++   RD  D        ++G  I+T YNNKTYRI D+        + + N  +ISY +Y+K+RYNI +++ KQP V+S        RP +K  N   G    DQ++ I  EL    G +D+ R++    +++    +  P  RI  ++ F K     K S + +K+WN+ ++   + I  R LPP  I+  + KI
Sbjct:   88 YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMS--------RPTDK--NIRGG---NDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKI 397          
BLAST of Ddo_002056 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 87.0409 bits (214), Expect = 3.774e-18
Identity = 78/330 (23.64%), Postives = 143/330 (43.33%), Query Frame = 3
Query:   60 FDGRRLFTPSQW-HKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCK-WTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINA 1007
            FDG  L+ P    +K  +     +D E+ IR L    E      Q+ NI+F+ +   +   K  R+ F  S          P    +   ++  GY T +     ++     +L  +  +R+L + +V+ +           Y+      L+G  ++T+YNN+TY+I+DI  +     + E+     SY  Y+KQ +NI +K+  QP + S           +KS   P   +E  Q   IP ELCYL G  D  RS+  L + +    +  P +R   +  F +  +    +++ + +W +++      I GR++    I  + + ++A
Sbjct:  179 FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS----------IKKSRGIP-AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSA 482          
The following BLAST results are available for this feature:
BLAST of Ddo_002056 vs. uniprot
Analysis Date: 2016-03-07 (Dugesia dorotocephala BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD0.000e+084.08RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA7.887e-13953.93RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD1.161e-12549.74RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|46577084|sp|Q8UVX0|PIWL1_DANRE4.614e-2025.55RecName: Full=Piwi-like protein 1[more]
gi|33112431|sp|Q9VKM1|PIWI_DROME2.228e-1924.74RecName: Full=Protein piwi[more]
back to top
BLAST of Ddo_002056 vs. Smed Unigenes AA
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150261770.000e+084.08SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159472.901e-12649.23SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150150271.348e-2974.32SmedAsxldir_c97534_g1_i3|m.40524|m.26292[more]
SMU150001116.982e-1926.54Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
back to top
BLAST of Ddo_002056 vs. RefSeq Human
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|3.615e-1823.77piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|3.615e-1823.77PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|3.615e-1823.77PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|3.615e-1823.77PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|3.615e-1823.77PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of Ddo_002056 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-08 (Dugesia dorotocephala BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|2.572e-2024.74piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|2.572e-2024.74piwi, isoform B [Drosophila melanogaster][more]
gi|17136494|ref|NP_476734.1|8.765e-2024.40aubergine, isoform A [Drosophila melanogaster][more]
gi|161076864|ref|NP_001097144.1|1.060e-1924.40aubergine, isoform C [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|3.774e-1823.64argonaute 3, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ddo_002056 ID=Ddo_002056|Name=Ddo_002056|organism=Dugesia dorotocephala|type=mRNA|length=1132bp
GTAAGTTGGAATTATTATACAGTGTGGCGTCCACAAAGGCTGATAATCAA
CCTTTTTGTTTTGATGGCCGTCGCCTTTTTACACCCTCACAATGGCATAA
AGAAGACATTGAAACGTTTAACATTAAAGACGAAGAGGTATCAATTAGAT
TTTTGGCTACTTTTATAGAAAATACAGAAGAATATTATCAAATGATTAAT
ATTGTGTTTAATAATATTCAAATTTTTATGGGACAAGAGAAAATTGGGCG
ACAATTTTTTTTGGGTTCGAATTGTGAGAGTGGTGGAATAAAAGAGGGTC
CGAGTTTTTTCAAAATGGAGAATTTTAAAATTTTGGGCGGTTATTCAACT
ACCATTACCAGGGGTACTAATGAAGATGGAACAGCTTCAACTTTATTATA
CTTAGAAAGAATAAATCGTGTTCTTAATGAAAATTCGGTAATCGCTGTTT
ATAGAAGAGATCAAATCGATCAATTAATAGGGCGAGACATCATTACCAAA
TACAATAATAAAACATACAGAATATCCGATATTAAAGAAATGGGTATTAA
TGACGAAATTGAATTGAATGGCACTAAAATTTCGTATTACAATTACTTTA
AACAGCGTTATAATATTACTTTGAAAAACGACAAGCAGCCATTTGTTATT
TCTAGAATCAAAAGATCAATGACTCATCGGCCTAAGGAAAAAAGTGAAAA
TGAACCAGAAGGTCCAAAGGAAACGGATCAAAGTTTATCCATTCCAGGTG
AATTGTGTTATTTATGCGGATTTTCTGATAGTGAAAGAAGCAATATAAAT
CTACAAAAAAGTTTAGGTGGTGTGCTAAAAAGAGAGCCCCGTGAAAGAAT
AAACGATATAAAAGATTTTTGCAAATGGACAGGTGGGGGCAAATCCAAAG
ATTATATGAAAACCTGGAATATGACTATTGAGGAACAGCCTATTACGATA
CGAGGTCGTGAATTACCTCCGGTAGATATTATGTCCAACGATGTTAAAAT
TAATGCTAAAACTCCAGATGATTGGAAATTTGGTGAAGTAAAATTTGATG
TTCCTAAAGGTATAACGCATAGATTTGGCGTTTTAGTTGTAGATCGTAAT
CCTAGTCATTTTAATAATTTTATCGATGATGT

Design Primers for Ddo_002056

back to top

protein sequence

>Ddo_002056-protein ID=Ddo_002056-protein|Name=Ddo_002056|organism=Dugesia dorotocephala|type=polypeptide|length=376bp
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
back to top

coding sequence

>Ddo_002056.3.1130 ID=Ddo_002056.3.1130|Name=Ddo_002056.3.1130|organism=Dugesia dorotocephala|type=CDS|length=1128bp
AAGTTGGAATTATTATACAGTGTGGCGTCCACAAAGGCTGATAATCAACC
TTTTTGTTTTGATGGCCGTCGCCTTTTTACACCCTCACAATGGCATAAAG
AAGACATTGAAACGTTTAACATTAAAGACGAAGAGGTATCAATTAGATTT
TTGGCTACTTTTATAGAAAATACAGAAGAATATTATCAAATGATTAATAT
TGTGTTTAATAATATTCAAATTTTTATGGGACAAGAGAAAATTGGGCGAC
AATTTTTTTTGGGTTCGAATTGTGAGAGTGGTGGAATAAAAGAGGGTCCG
AGTTTTTTCAAAATGGAGAATTTTAAAATTTTGGGCGGTTATTCAACTAC
CATTACCAGGGGTACTAATGAAGATGGAACAGCTTCAACTTTATTATACT
TAGAAAGAATAAATCGTGTTCTTAATGAAAATTCGGTAATCGCTGTTTAT
AGAAGAGATCAAATCGATCAATTAATAGGGCGAGACATCATTACCAAATA
CAATAATAAAACATACAGAATATCCGATATTAAAGAAATGGGTATTAATG
ACGAAATTGAATTGAATGGCACTAAAATTTCGTATTACAATTACTTTAAA
CAGCGTTATAATATTACTTTGAAAAACGACAAGCAGCCATTTGTTATTTC
TAGAATCAAAAGATCAATGACTCATCGGCCTAAGGAAAAAAGTGAAAATG
AACCAGAAGGTCCAAAGGAAACGGATCAAAGTTTATCCATTCCAGGTGAA
TTGTGTTATTTATGCGGATTTTCTGATAGTGAAAGAAGCAATATAAATCT
ACAAAAAAGTTTAGGTGGTGTGCTAAAAAGAGAGCCCCGTGAAAGAATAA
ACGATATAAAAGATTTTTGCAAATGGACAGGTGGGGGCAAATCCAAAGAT
TATATGAAAACCTGGAATATGACTATTGAGGAACAGCCTATTACGATACG
AGGTCGTGAATTACCTCCGGTAGATATTATGTCCAACGATGTTAAAATTA
ATGCTAAAACTCCAGATGATTGGAAATTTGGTGAAGTAAAATTTGATGTT
CCTAAAGGTATAACGCATAGATTTGGCGTTTTAGTTGTAGATCGTAATCC
TAGTCATTTTAATAATTTTATCGATGAT
back to top
Gene Groups
Ddo_002056 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.