laminin, Pmo_031777 (mRNA) Phagocata morgani

Overview
Namelaminin
Unique NamePmo_031777
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length3827
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani CDS2016-05-06
Homology
BLAST of laminin vs. uniprot
Match: gi|317373536|sp|P98160|PGBM_HUMAN (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; AltName: Full=Perlecan; Short=PLC; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 169.859 bits (429), Expect = 5.95623e-41
Identity = 139/492 (28.25%), Postives = 205/492 (41.67%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APD--YSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYV------INKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTY--KLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
C + C+N CI + C+G DC D SDE D C PN C NG C +K W+CDG DC + DE NCP K ++ G + ++C + IP ++ CD E+DC DE GC PQV+ P + S + T+ C G P P I WR NWG++P H V + TL I ++ G YTCE + R ++ PD + +G FY + C+ C+C +T C S + D I + D ++K PA+ T S + + D + D F G+ ++ YG L Y + ++ + + P VV+ G Y + P N R + + ++ W + + V R+E ++VL+ + VL + Y TK +S I M V H VE+C CP GYSGLSCE
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NG-----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPS---HPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQSTRRF---RDQIRLRFDQPD----DFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAG----YRLLSRGHTPTQPGALNQ----RQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCE 743
BLAST of laminin vs. uniprot
Match: gi|30179887|sp|Q06561|UNC52_CAEEL (RecName: Full=Basement membrane proteoglycan; AltName: Full=Perlecan homolog; AltName: Full=Uncoordinated protein 52; Short=Protein unc-52; Flags: Precursor)

HSP 1 Score: 146.747 bits (369), Expect = 6.83203e-34
Identity = 171/644 (26.55%), Postives = 257/644 (39.91%), Query Frame = 2
Query: 1985 LTVNPKEITVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGG-------DSNSVLEIKQATTADDGT---VYECNFNKLTEFVTLWV--------------KDECALNQRKCQNETCIDENKFCNGVNDCGDNSDED--PKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVK-NKDKCLGSHYQCGN-DTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGI-AKRRVMA-PDYSVTV----------------------TKGSI-----------------------CKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRI-----PAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
+TV P E V+ G F C+ R D + + +R+GG DS L I +D GT V + N N + TL V +C +++ C N C+ + C+G DC D SDE P C PN C+ +CV K W CDG DDCG+N DELNC K + C + +QC + +P ++ CDG DC DE GC P V++P +T+ L V +T + C+ P P I WR NWG + + + TL I++ P G YTCE I K RV+A PD V V T+G++ CK ++ E C++C+C V++DC S+ G+ D + A I + + + +F L + D K FLG + YG + +++ SG S H S P+VV+ G+ + ++ + + P + + YE N +EQ ++ A + TR + + VL D+ L R + QT + ++ + AV VE+C CP GY G SCE
Sbjct: 47 ITVFPSEKEVRDGRDVSFECRA---------RTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNN-------NKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTN-LQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEP-----PRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSS-GHYRTKDRLMFAGDAEGVTISDIEERT-IDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFLGDK-------VTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQ----LNGA---AATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCE 646
BLAST of laminin vs. uniprot
Match: gi|1172451|sp|Q05793|PGBM_MOUSE (RecName: Full=Basement membrane-specific heparan sulfate proteoglycan core protein; Short=HSPG; Contains: RecName: Full=Endorepellin; Contains: RecName: Full=LG3 peptide; Flags: Precursor)

HSP 1 Score: 142.51 bits (358), Expect = 1.29149e-32
Identity = 88/268 (32.84%), Postives = 122/268 (45.52%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE----DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APD--YSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSA 3019
C + C + CI + C+G DC D SDE P C PN C+ NG C +K W+CDG DC + DE NC VK + G +H+QC + IP ++ CD E+DC DE GC PQV+ P + S + T+ C +G P P I WR NWG++P V TL I ++ G YTCE + R ++ PD + +G FY D+ C+ C+C VT+ C S+
Sbjct: 285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCASPP---PCEPNEFACE--NG-----HCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQS-IQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAH-----PRVTMTSEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDS---ASCLPCFCFGVTNVCQSS 533
BLAST of laminin vs. uniprot
Match: gi|160409939|sp|A2ARV4|LRP2_MOUSE (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 88.1965 bits (217), Expect = 4.42897e-16
Identity = 52/144 (36.11%), Postives = 72/144 (50.00%), Query Frame = 2
Query: 2240 DECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNE---CTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDEL-NCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLS 2659
+ C+ NQ C N CI + C+G NDCGD SDED + E C+ C +N P +RC+ +HW CDG DC + DEL NC ++ C + C N I +++ CD DC DE GC+ P P + Q +
Sbjct: 2906 NSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTC--INSRPPNRRCIPQHWVCDGDADCADALDELQNCTMR---ACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP----PCRDDQFT 3040

HSP 2 Score: 84.3445 bits (207), Expect = 6.72785e-15
Identity = 45/117 (38.46%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 2264 KCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
+C N CI C+G++DCGDNSDE+ ECT + C ++C+ W CD +DCG+N DE +C +K C H+QC + +P+A CDG ADC DE C
Sbjct: 3728 RCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 3 Score: 76.6406 bits (187), Expect = 1.474e-12
Identity = 51/137 (37.23%), Postives = 70/137 (51.09%), Query Frame = 2
Query: 2243 ECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRC--NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDT---------LIPRAYWCDGEADCKSMEDEEGCTS 2620
C N+ +C N+ CI E C+ V+DC DNSDEDP C C P C+ NG RC+ + W+CD +DCG+ DE P+ +C+ + Y C N T IP+ C+G DC+ DE+GC S
Sbjct: 3595 RCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCN--NG-----RCIPQSWKCDVDNDCGDYSDE---PIH---ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCES 3718

HSP 4 Score: 75.485 bits (184), Expect = 3.09224e-12
Identity = 48/133 (36.09%), Postives = 64/133 (48.12%), Query Frame = 2
Query: 2243 ECALNQRKCQNET---------CIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
EC C N T CI + CNG +DC DNSDE C P+ DF G++ C+ W+CDG+DDCG+N DE +C + +C S ++C + IP + CD E DC DE C
Sbjct: 3672 ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DFRCGNH---HCIPLRWKCDGIDDCGDNSDEESCVPR---ECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795

HSP 5 Score: 73.9442 bits (180), Expect = 1.03942e-11
Identity = 55/191 (28.80%), Postives = 76/191 (39.79%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNEC---TPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDEL--NCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQ---VIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNC 2794
C +C+N CI C+G NDC D SDE+ C +P CD RC+ H C+GVDDCG+ DE +C C + Y+C N + + Y CD DC + DE GC + E + + + N + C RP G+ P LD N + C
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCDN-------SRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTCAEKICEQNCTQLSNGGFICSC----RP----------GFKPSTLDKNSCQDINEC 4013

HSP 6 Score: 73.1738 bits (178), Expect = 1.50544e-11
Identity = 43/122 (35.25%), Postives = 59/122 (48.36%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRC--NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDE 2605
C L Q +C++ C CN DC D SDED C + C N C KRC+ ++WQCD VDDC +N DE ++ C ++C N IP+++ CD + DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDEDPSHCASR-TCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 7 Score: 72.4034 bits (176), Expect = 3.1579e-11
Identity = 49/140 (35.00%), Postives = 61/140 (43.57%), Query Frame = 2
Query: 2234 VKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVK--NKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE-------GCTSPQ 2626
V EC ++ +C ++ CI C+ NDCGDNSDE C P C CV K CDG DC + DE CP + N C + ++C N I + CDGE DC DEE C SPQ
Sbjct: 3757 VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQ 3889

HSP 8 Score: 71.2478 bits (173), Expect = 6.24496e-11
Identity = 47/132 (35.61%), Postives = 62/132 (46.97%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEP 2638
C Q +C + CI C+G DC D SDE N CT + C +GS+ C+ ++CDGV DC +N DE CP + C +QC G+ T IP + CDG DC DE P+ P
Sbjct: 1150 CHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLN-CTSSQFKC--ADGSS----CINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKTCSP 1274

HSP 9 Score: 70.8626 bits (172), Expect = 7.77287e-11
Identity = 43/139 (30.94%), Postives = 69/139 (49.64%), Query Frame = 2
Query: 2243 ECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRC----NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKN-KDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVK 2644
+C + C N C+ C+GV+DC DNSDE +C N C+ ++ C ++G +C+ W+CD +DC + DE NCP ++ C + + C N IP+ + CD + DC DE+ C + P +
Sbjct: 1024 QCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDE--HQCGALNNTCSSSAFTC--VHGG----QCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQ 1154

HSP 10 Score: 70.0922 bits (170), Expect = 1.5764e-10
Identity = 43/124 (34.68%), Postives = 62/124 (50.00%), Query Frame = 2
Query: 2246 CALNQRKCQNET-CIDENKFCNGVNDCGDNSDEDPKRC--NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE 2608
C + KCQ C+ C+G NDCGD SDE+P C + C N C +P RC+ +W CDG DC ++ DE + + + C + + C N I ++ CDG+ DC M DE+
Sbjct: 2823 CQPDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSP-HRCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDED 2940

HSP 11 Score: 66.6254 bits (161), Expect = 1.49169e-09
Identity = 44/124 (35.48%), Postives = 63/124 (50.81%), Query Frame = 2
Query: 2255 NQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQ 2626
+Q C N C + ++ C+ DC D+SDE CT +F GS C+++ + CD +DC +N DE NC N D C G + C N I + + CDG+ DC+ DE+GC S Q
Sbjct: 148 DQLTCANGACYNTSQKCDHKVDCRDSSDE-----ANCTTLCSQKEFQCGSG---ECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 12 Score: 66.2402 bits (160), Expect = 1.8881e-09
Identity = 48/127 (37.80%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 2246 CALNQRKCQN-ETCIDENKFCNGVNDCGDNSDED--PKRC-NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
C +Q KC + +CI+ C+GV DC DNSDE P R C P+ C +G+ C+ W+CDG DC DE N V C SH+ C N I ++ CDG+ DC+ M DE+ C
Sbjct: 1188 CTSSQFKCADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQG-DGT-----CIPNTWECDGHPDCIQGSDEHNGCVPKT--CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDC 1306

HSP 13 Score: 65.855 bits (159), Expect = 2.55629e-09
Identity = 50/148 (33.78%), Postives = 70/148 (47.30%), Query Frame = 2
Query: 2177 DGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCK--SMEDEEGC 2614
+G+ Y N NK + + C Q C N CI ++ C+ NDCGD SDE P C T S NG RCV H++CD +DCG+N DE C ++ + + + C N IP +Y C+G +C DE+ C
Sbjct: 2681 EGSWYLANDNK---YCVVDTGARCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCANG-----RCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNC 2818

HSP 14 Score: 59.3066 bits (142), Expect = 2.4053e-07
Identity = 40/105 (38.10%), Postives = 52/105 (49.52%), Query Frame = 2
Query: 2216 EFVTLWVKDECALNQR-KCQNETCIDENKFCNGVNDCGDNSDEDPKRCNE-----CTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKC 2512
E + L C QR +C N CI ++ CNGV+DCGD SDE + C + CT C NG+ CV +H+ CD VDDCG+ DE C + C
Sbjct: 3875 EEIHLCFNVPCESPQRFRCDNSRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCS--NGN-----CVSQHYVCDNVDDCGDLSDETGCNLGENRTC 3972

HSP 15 Score: 55.0694 bits (131), Expect = 5.31938e-06
Identity = 42/127 (33.07%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDK-CLGSHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTS 2620
C+ + +C + CI C+ NDC DNSDE + C + C NG +C+ ++W CDG DDC ++ DE C + C + C G+ I CDG DC EDE TS
Sbjct: 183 CSQKEFQCGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCS--NG-----QCINQNWVCDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGEDENNATS 302

HSP 16 Score: 54.6842 bits (130), Expect = 6.96276e-06
Identity = 42/129 (32.56%), Postives = 52/129 (40.31%), Query Frame = 2
Query: 2243 ECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIK-RCVIKHWQCDGVDDCGNNFDE-LNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSP 2623
EC +C N CI + C+G DC D++DE C P S F P + C+ W CD DC + DE NCP C C N +P Y CD +DC DE C P
Sbjct: 27 ECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDE-----IGCPPRSCGSGFF--LCPAEGTCIPSSWVCDQDKDCSDGADEQQNCP---GTTCSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145
BLAST of laminin vs. uniprot
Match: gi|1708867|sp|P98158|LRP2_RAT (RecName: Full=Low-density lipoprotein receptor-related protein 2; Short=LRP-2; AltName: Full=Glycoprotein 330; Short=gp330; AltName: Full=Megalin; Flags: Precursor)

HSP 1 Score: 83.9593 bits (206), Expect = 8.80898e-15
Identity = 48/130 (36.92%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNE---CTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDEL-NCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSP 2623
C +Q +C N CI N C+G NDCGD SDED + E C+ C +N P +RC+ ++W CDG DC + DEL NC ++ C + C N + +++ CD DC DE GC+ P
Sbjct: 2908 CRASQFQCDNGRCISGNWVCDGDNDCGDMSDEDQRHHCELQNCSSTQFTC--VNSRPPNRRCIPQYWVCDGDADCSDALDELQNCTMRT---CSAGEFSCANGRCVRQSFRCDRRNDCGDYSDERGCSYP 3032

HSP 2 Score: 81.2629 bits (199), Expect = 5.71347e-14
Identity = 44/117 (37.61%), Postives = 61/117 (52.14%), Query Frame = 2
Query: 2264 KCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
+C N CI C+G +DCGDNSDE+ EC+ + C ++C+ W CD +DCG+N DE +C +K C H+QC + +P+A CDG ADC DE C
Sbjct: 3728 RCANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC 3834

HSP 3 Score: 75.0998 bits (183), Expect = 4.29413e-12
Identity = 49/134 (36.57%), Postives = 63/134 (47.01%), Query Frame = 2
Query: 2240 DECALNQRKCQNET---------CIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
DEC C N T CI + CNG +DC DNSDE C P+ DF ++ C+ W+CDG DDCG+N DE NC + +C S ++C + IP + CD E DC DE C
Sbjct: 3671 DECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DFRCANH---HCIPLRWKCDGTDDCGDNSDEENCVPR---ECSESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795

HSP 4 Score: 73.9442 bits (180), Expect = 8.49257e-12
Identity = 51/137 (37.23%), Postives = 70/137 (51.09%), Query Frame = 2
Query: 2243 ECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRC--NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDT---------LIPRAYWCDGEADCKSMEDEEGCTS 2620
C N+ +C N+ CI ++ C+ VNDC DNSDED C C P C+ NG RC+ + W+CD +DCG+ DE P+ D+C + Y C N T IP+ C+G DC+ DE+GC S
Sbjct: 3595 RCESNEWQCANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRTCRPGQFKCN--NG-----RCIPQSWKCDVDNDCGDYSDE---PI---DECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCES 3718

HSP 5 Score: 72.7886 bits (177), Expect = 2.03837e-11
Identity = 46/128 (35.94%), Postives = 58/128 (45.31%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNEC---TPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDEL--NCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
C +C+N CI C+G NDC D SDE+ C +P CD RCV H C+GVDDCG+ DE +C C + Y+C N I + Y CD DC + DE GC
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPQRFRCDN-------SRCVYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLSDETGC 3964

HSP 6 Score: 72.7886 bits (177), Expect = 2.31273e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 2
Query: 2246 CALNQRKCQN-ETCIDENKFCNGVNDCGDNSDEDPKRC--NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE 2608
C + KCQ C+ C+G NDCGD SDE+P C + C N C +P +RC+ +W CDG DC + DE + + + C S +QC N I + CDG+ DC M DE+
Sbjct: 2823 CPPDFTKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----LSP-QRCIPSYWFCDGEADCADGSDEPDTCGHSVNTCRASQFQCDNGRCISGNWVCDGDNDCGDMSDED 2940

HSP 7 Score: 72.4034 bits (176), Expect = 2.85447e-11
Identity = 49/140 (35.00%), Postives = 62/140 (44.29%), Query Frame = 2
Query: 2234 VKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVK--NKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE-------GCTSPQ 2626
V EC+ ++ +C ++ CI C+ NDCGDNSDE C P C CV K CDG DC + DE CP + N C + ++C N I + CDGE DC DEE C SPQ
Sbjct: 3757 VPRECSESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNIPCESPQ 3889

HSP 8 Score: 71.633 bits (174), Expect = 4.27576e-11
Identity = 44/139 (31.65%), Postives = 66/139 (47.48%), Query Frame = 2
Query: 2243 ECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRC----NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVK-NKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVK 2644
+C C N C+ C+GV+DC DNSDE +C N C+P++ C + G +C+ W CD +DC + DE NCP C + + C N IP+ + CD + DC DE+ C + +P +
Sbjct: 1024 QCGSLSFPCNNGKCVPSFFRCDGVDDCHDNSDE--HQCGVFNNTCSPSAFAC--VRGG----QCIPGQWHCDRQNDCLDGSDEQNCPTHATSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSDEKNCQASGTCQPTQ 1154

HSP 9 Score: 71.633 bits (174), Expect = 4.97531e-11
Identity = 47/134 (35.07%), Postives = 61/134 (45.52%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVK 2644
C Q +C + CI C+G DC D SDE N CT C +GS+ C+ ++CDGV DC +N DE CP + C +QC G+ T IP + CDG DC DE P+ P
Sbjct: 1150 CQPTQFRCPDHRCISPLYVCDGDKDCADGSDEAGCVLN-CTSAQFKC--ADGSS----CINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIHGSDEHTGCVPKTCSPTH 1276

HSP 10 Score: 70.4774 bits (171), Expect = 1.02618e-10
Identity = 42/122 (34.43%), Postives = 58/122 (47.54%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRC--NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDE 2605
C L Q +C++ C CN DC D SDED C + C N C KRC+ + WQCD V+DC +N DE ++ C ++C N IP+++ CD + DC DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCESNEWQC-------ANKRCIPQSWQCDSVNDCLDNSDEDTSHCASR-TCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668

HSP 11 Score: 67.0106 bits (162), Expect = 1.30375e-09
Identity = 55/167 (32.93%), Postives = 77/167 (46.11%), Query Frame = 2
Query: 2177 DGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCK--SMEDEEGC---TSPQVIEPVKTSQLSV 2662
+G Y N NK + + C Q C N CI+++ C+ NDCGD SDE P C T S NG RCV H++CD +DCG+N DE C +N + + + C N IP +Y C+G +C DE+ C T P +T+ + V
Sbjct: 2681 EGNWYLANDNK---YCVVDTGTRCNQLQFTCLNGHCINQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCGNG-----RCVPYHYRCDYYNDCGDNSDEAGCLFRNCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCPPHTCPPDFTKCQTTNICV 2837

HSP 12 Score: 66.2402 bits (160), Expect = 2.33026e-09
Identity = 44/124 (35.48%), Postives = 63/124 (50.81%), Query Frame = 2
Query: 2255 NQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQ 2626
+Q C N C + ++ C+ DC D+SDE CT +F GS C+++ + CD +DC +N DE NC N D C G + C N I + + CDG+ DC+ DE+GC S Q
Sbjct: 148 DQLTCANGACYNTSQRCDQKVDCRDSSDE-----ANCTTLCSQKEFECGSG---ECILRAYVCDHDNDCEDNSDERNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260

HSP 13 Score: 65.0846 bits (157), Expect = 4.64647e-09
Identity = 47/127 (37.01%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 2246 CALNQRKCQN-ETCIDENKFCNGVNDCGDNSDED--PKRC-NECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
C Q KC + +CI+ C+GV DC DNSDE P R C P+ C +G+ C+ W+CDG DC + DE V C +H+ C N I +A+ CDG+ DC+ M DE+ C
Sbjct: 1188 CTSAQFKCADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPGMCHPDEFQCQG-DGT-----CIPNTWECDGHPDCIHGSDEHTGCVPKT--CSPTHFLCDNGNCIYKAWICDGDNDCRDMSDEKDC 1306

HSP 14 Score: 56.9954 bits (136), Expect = 1.33851e-06
Identity = 37/105 (35.24%), Postives = 53/105 (50.48%), Query Frame = 2
Query: 2216 EFVTLWVKDECALNQR-KCQNETCIDENKFCNGVNDCGDNSDEDPKRCNE-----CTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKC 2512
E + L C QR +C N C+ ++ CNGV+DCGD SDE + C + CT C NG+ C+ +H+ CD V+DCG+ DE C + + C
Sbjct: 3875 EEIHLCFNIPCESPQRFRCDNSRCVYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCS--NGN-----CISQHYVCDNVNDCGDLSDETGCNLGDNRTC 3972

HSP 15 Score: 56.6102 bits (135), Expect = 1.75206e-06
Identity = 50/146 (34.25%), Postives = 67/146 (45.89%), Query Frame = 2
Query: 2186 VYECNFNKLTEFVTLWVKDECALNQRKCQNE-TCIDENKFCNGVNDCGDNSDED----PKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQC-GNDTLIPRAYWCDGEADCKSMEDE 2605
VY+C N C ++ +CQ + TCI C+G DC SDE PK C+P CD NG+ C+ K W CDG +DC + DE +CP + C + +QC G T I + CDG DC + DE
Sbjct: 1211 VYDCRDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIHGSDEHTGCVPK---TCSPTHFLCD--NGN-----CIYKAWICDGDNDCRDMSDEKDCPTQ-PFHCPSTQWQCPGYSTCINLSALCDGVFDCPNGTDE 1345
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003325 (SmedAsxldir_c101543_g1_i1|m.51138|m.8906)

HSP 1 Score: 1345.1 bits (3480), Expect = 0
Identity = 644/1161 (55.47%), Postives = 861/1161 (74.16%), Query Frame = 2
Query:  206 SMHIFIPLLVMVGYFTKSYESVFPHTRTVSIDLEKLKKEPFNIYFTCANIRSKQDRVRYFR-VQNGARGLIEKKKRFGIILSIKSESDLGQYECSVTAPDKTVLNATLNTVDMKKMESPTKFVYDLSKTKYVIQKSGSVELDCGTSGNEVVTWYKPTQYHIFTGSKLKIDSLTNFDYGTYYCAVGDTNKATLMVTKVXXXXXXXXXXXXXXXXXVMYIESFIPKSKSVRFKPIDVVDKSFAVTWEQPPGTVLLEHARKLYFQSFSPDQTKIPFFYRITKNGDPSVNKVGKVYISDWTDKEVEVTLEGAVQYGSDMTVNCFPAP-ELGNDTSVIWRLDEKIIHRGNTYTIKNFQKQFFGKYSCEIQQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMGKNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRLDTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQTAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKPVLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGKLIVKSRPVLTVNPKEITVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIKQATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCEMK 3682
S + IPL + ++++ F TR VS++++ K P I+F C IR D ++Y++ V+N + E+ GI++ +K DLG+YECSV + DKT+ N+TLN D +ESP FVY ++ YV Q +G+VELDCG+ E V W++P QYHI++G K KID + + YGTYYC+ G+ NK ++ V K+IL+ + KEK IDE+V YIE+ SK +R++ +V+ V+WE PPGT+LL++ R Y +S + T I +YRI + GDPS+NK+GK+ IS ++ + + ++YGS+M ++C E G D VIW+ D+ +IH GNT TI +F+K FGKYSCEI + + R +NL P+Q ++ KIEMTPDPG YY +H G KELHCEILR D W +IIWT NGRK+D + ++ RLDT SVSILV+KN+ E+N+GTYKC+Q + +++A LLLE+S +L+E++PP Q ADNVN +AE HCRIDT N NSS I W FIPENS +E+ +P EA +E+P SSTSFV I+NVLK+HEG YVC+V D KV G+++V+++ VL V+PK +TVKPGG ARF+C+L G+ GKV+WRR DKKS KE+R S+LE+K AT DDGTVYEC FNKLT++VTL+VK+EC LNQRKC+NETCIDENKFC+G NDCGDNSDED K+CNEC+PNSIHCDFL +NP KRC+IKHWQCDG+DDCGNNFDELNCPVKNKDKC+G+HY C N+ LIPR+YWCDGE DC SMEDEE C++PQ+IEPVK + +S+ NSTL I C++SGRP+PTI+WRYNW +LP+ LD+NIT V+NCS+ITS+L + NI+ + SGIY+CEGI++RR++APD+SV+VTKG IC+RPFYNNDAWY ++CIRCYCSN+TD+C+SA GY N IES +K SDAAI+N+K YY+PAR +TFAN++ + Y IN+ YKKL+P+ D++ GG+FNM GSW+ +YG+PLTYKLI+SGE+ ++ GP+VV+ G SD IY+C+ KYR+P YAS + +ENN+RI LWEQD WF D CT TR +FI VL++VRLVLF+VKY+ QT+F+MSKI+MQEA+++ +SW +++EKC CPAGYSGLSCE K
Sbjct: 2 SFNKVIPLFIFQFLISQTFG--FQPTRNVSVNIKNSKFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYYRDFYMKSIYENFTTI--YYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYK----RKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESD-SIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCENK 1153
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15003584 (SmedAsxldir_c102345_g1_i1|m.54199|m.2277)

HSP 1 Score: 283.493 bits (724), Expect = 2.54836e-80
Identity = 191/625 (30.56%), Postives = 294/625 (47.04%), Query Frame = 2
Query: 1109 VTLEGAVQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQKQFFGKYSCEIQQSGVKIISRVINLAPEQDLQ------AKIEMTPDPGNYYNFHMGKNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRLDTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQTAADNVNQVAEFHCRIDT-PNYNSSLIKWSFIPENSDAEIPVP-AEAIIEKPVLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVV-GKLIV---KSRPVLTVNPKEITVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKE---------SRLGGDSNSVLEIKQATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLI--ECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKR-RVMAPDYSVTV 2911
+T +YG ++ C P N W ++ I IK+F+K G Y C + +++ S ++L E Q +KIE+T PG H G+ KELHCEI GN KE W +NG+K +N P + RLD + VS+LV+ ++ + N+G Y+C G+++ L++ + L+E SPP + Q EFHCR++ P+ + +KW+F + +P + + + TSF+ + G Y+C + + +LIV K + LT+ P+EI V+ G C G+ + SF NK S +G + + +D+ C+ ++V D C R CQN C++ KFC+ +N C D SDEDP C EC P S C+ N P K + HW CDG +DCGN +DE NC + + C G + C ++ IPR Y CD DC EDE GCTSPQ+ KTS VV + L+ C+ +G+P+P + WR+NWG + + + T+C+ +TS+L I + GIY CE ++ R R + D+ V +
Sbjct: 228 ITNPALFRYGERFSLRCEVEPFYQN-IKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKC---VASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVFVHRGEKKELHCEIETSSGN---RGKEAEWYINGKKF--KNGDIPLVN-----RLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEG--QSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRA--SGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQI---TKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 831
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001730 (Asxlregen_comp65513_c0_seq1|m.19286|m.12982)

HSP 1 Score: 277.33 bits (708), Expect = 9.74302e-78
Identity = 184/618 (29.77%), Postives = 288/618 (46.60%), Query Frame = 2
Query: 1127 VQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQKQFFGKYSCEIQQSGVKIISRVINLAPEQDLQA------KIEMTPDPGNYYNFHMGKNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFG--RLDTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQTAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKPVLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGK--LIVKSRPVLTVNPKEITVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIKQA----------TTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDT-LIPRAYWCDGEADCKSMEDEEGCTSPQVI-EPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIA-KRRVMAPDYSVTV 2911
V++ + +NC P L + T I+ ++++I + + +TI K G Y C + + + +IN +QA KIE++ PG G +ELHCEI G K IW G+++++ +D R+ + VSI+VL+N+ + N+G Y+C A +++ E+SP +QT EFHCR++ + + WSF+ + + + + TSF+ + + G Y+C + + LIV+S + V P I ++ G TA F C + G R D F R + +E +A TT D+GT + C + T V + V C+ R C+N CI+ KFC+G DC D SDED + C +C P S C+ NG PI HW CDG DDCGN +DE C N +C G YQC + T IPRA+ CD + DC + +DE CT P +I E + + +++ T+ + CQ++G P+P I WR+NWG L ++ + + NC STL I+ P GIY CE ++ +R + DY + +
Sbjct: 311 VRFFEPLELNCEVTPPLRDVTYEIY-FNDRLISQSSRHTIPRLDKTNMGVYQC-VSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTG---LQGKNAIWYFKGQEINS-------NDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLG-----AGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC-FGNVLECGGLKYQCNDGTKSIPRAFVCDKDTDCVNGDDESRCTQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLM 910
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15001643 (Asxlregen_comp65113_c0_seq2|m.18193|m.7115)

HSP 1 Score: 269.626 bits (688), Expect = 4.44586e-75
Identity = 190/621 (30.60%), Postives = 294/621 (47.34%), Query Frame = 2
Query: 1130 QYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQKQFFGKYSCEI------QQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMGKNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRLDTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQTAADNVNQVAEFHCRID-TPNYNSSLIKWSFIPENSDAEIPVPA-----EAIIEKPVLTSSTSFVTIDNVLKRHEGNYVCRVKD-RKVVGKLIVKSRP---VLTVNPKEITVKPGGTARFLC----QLTGID-GKVVWRRRDKKSFIENKESRLG----GDSNSVLEIKQA-TTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIA-KRRVMAPDYSVTV 2911
+ ++ + C P + N + IW+ D ++ T I +FQ+Q G YSCEI S + IS +N+ + KIE+ G +G+ KE+HCEI N ++ W N ++D + R D VSI+ L N+ N+G Y C + A L++ Q + + ++P + N + EFHCR + P++ ++ +KWSF ++ D + + + I T TSF++I + L + G Y+C + + +L++K R +LT+ P+ + V+ G C + TG G+ + KS + + RL G S L IK T+D+ EC+ + T++++++C N R+C N C KFC+GV +C D SDE+P CN+C P C+ P+K + HW+CDG +DCGNNFDE C +N KC + C N +IPRAY CD E+DC + EDE GC PQV + + + C+ G P P I WRYNWG L D L I + C+ + S LRI N P GIY CE ++ R + DY + +
Sbjct: 325 ELNNEFKLKCEIFPPIPN-ANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELD-KFGVQMISRVGEKKEMHCEISTSSPN---RGSDVEWFFNKERLD-----ETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINP--ERIIRNEGEPVEFHCRGNGIPDFINTKVKWSF--KSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSL--STDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCN-ENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRRGGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 928
BLAST of laminin vs. Smed Unigenes AA
Match: SMU15035123 (SmedSxlregen_c88126_g1_i1|m.36302|m.5005)

HSP 1 Score: 264.618 bits (675), Expect = 2.08618e-73
Identity = 184/608 (30.26%), Postives = 280/608 (46.05%), Query Frame = 2
Query: 1145 MTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQKQFFGKYSCEIQQSGVKIISRVINLAPEQDLQ----AKIEMTPDPGNYYNFHMGKNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRLDTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQTAADNVNQVAEFHCRID-TPNYNSSLIKWSFIPENSDAEIPVP-AEAIIEKPVLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVV-GKLIV---KSRPVLTVNPKEITVKPGGTARFLCQLTGIDGKVVWRRRDKKSF-----IENKESRLG---GDSNSVLEIKQATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGI-AKRRVMAPDYSVTV 2911
+++ C P L N W + + G T F K +Y C + + + + +Q L KIE+T +PG + + KELHCEI DG + + I W NG+ ++ + R R++ R VSILVL N DN+G Y+C G AT++L+ ++ +P + + EFHCRID N ++ + W F N + ++ + + + TSF+ +D G C + +LIV K + +TV P + V+ F C G + + K F +EN + L G S + D C+ NK V + V++ C NQR+CQN C+ KFC+G+ DC D SDEDP CN C P C + G P ++ + K+W CDG +DCGNN+DE+NC K+ KC G + C N+ IPR CDG +DC EDE C P +I K S + S + ++C+ + P+PTI WR+NWG LP++ I+ V NC + STL I+ IY CE + + R ++ D+ V++
Sbjct: 329 LSLRCQVLPSLTN-VRYEWFRNGQYYQTGQTLIFPKFSKLLVDRYECRAIGTTENQVEIFLTVESDQKLTYLSYNKIELTENPGPNIALKLNEKKELHCEIEDIDG---LSGENIEWFFNGKMIE-----NSLIKSYRLDRVNKRLVSILVLMNSQLDNEGRYECRYGIVRKEATVMLDIDSGMIVTNPSKIKVIEG--SPVEFHCRIDDVYNIDNRNLSWRFYNNNFQINYSLENSKWRLTESKIADHTSFINLDRATMADSGYIECISGNGLTAQSQLIVVEDKHKFNITVTPNHLRVRKNQLFEFEC--FGQSDEGIPYGEPKFEFPGGKPVENDKRFLVTTVGPSRIRITAPHGVNIKDELKLICSVNKQVSAVYIQVQETCPPNQRQCQNRQCLPVGKFCDGIADCVDGSDEDPTVCNSCEPAFTTCQDVYGFAPTRKTINKNWICDGENDCGNNYDEINCEDKST-KCNGLFFTCKNNMTIPRGQVCDGNSDCLLDEDEADCLKPVIISTSK-SHVKANIGSKVKLQCEATAHPLPTIIWRFNWGCLPNENRVTISTVKKNCRKVISTLTIDEFQAGDDAIYNCEALSSSNRALSQDFHVSI 921
BLAST of laminin vs. RefSeq Human
Match: gi|578798995|ref|XP_006710657.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X2 [Homo sapiens])

HSP 1 Score: 170.629 bits (431), Expect = 1.3746e-41
Identity = 139/492 (28.25%), Postives = 205/492 (41.67%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APD--YSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYV------INKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTY--KLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
C + C+N CI + C+G DC D SDE D C PN C NG C +K W+CDG DC + DE NCP K ++ G + ++C + IP ++ CD E+DC DE GC PQV+ P + S + T+ C G P P I WR NWG++P H V + TL I ++ G YTCE + R ++ PD + +G FY + C+ C+C +T C S + D I + D ++K PA+ T S + + D + D F G+ ++ YG L Y + ++ + + P VV+ G Y + P N R + + ++ W + + V R+E ++VL+ + VL + Y TK +S I M V H VE+C CP GYSGLSCE
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NG-----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPS---HPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQSTRRF---RDQIRLRFDQPD----DFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAG----YRLLSRGHTPTQPGALNQ----RQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCE 760
BLAST of laminin vs. RefSeq Human
Match: gi|126012571|ref|NP_005520.4| (basement membrane-specific heparan sulfate proteoglycan core protein isoform b precursor [Homo sapiens])

HSP 1 Score: 169.859 bits (429), Expect = 2.24793e-41
Identity = 139/492 (28.25%), Postives = 205/492 (41.67%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APD--YSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYV------INKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTY--KLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
C + C+N CI + C+G DC D SDE D C PN C NG C +K W+CDG DC + DE NCP K ++ G + ++C + IP ++ CD E+DC DE GC PQV+ P + S + T+ C G P P I WR NWG++P H V + TL I ++ G YTCE + R ++ PD + +G FY + C+ C+C +T C S + D I + D ++K PA+ T S + + D + D F G+ ++ YG L Y + ++ + + P VV+ G Y + P N R + + ++ W + + V R+E ++VL+ + VL + Y TK +S I M V H VE+C CP GYSGLSCE
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NG-----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPS---HPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQSTRRF---RDQIRLRFDQPD----DFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAG----YRLLSRGHTPTQPGALNQ----RQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCE 743
BLAST of laminin vs. RefSeq Human
Match: gi|578799001|ref|XP_006710660.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X9 [Homo sapiens])

HSP 1 Score: 169.859 bits (429), Expect = 2.38607e-41
Identity = 139/492 (28.25%), Postives = 205/492 (41.67%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APD--YSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYV------INKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTY--KLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
C + C+N CI + C+G DC D SDE D C PN C NG C +K W+CDG DC + DE NCP K ++ G + ++C + IP ++ CD E+DC DE GC PQV+ P + S + T+ C G P P I WR NWG++P H V + TL I ++ G YTCE + R ++ PD + +G FY + C+ C+C +T C S + D I + D ++K PA+ T S + + D + D F G+ ++ YG L Y + ++ + + P VV+ G Y + P N R + + ++ W + + V R+E ++VL+ + VL + Y TK +S I M V H VE+C CP GYSGLSCE
Sbjct: 285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NG-----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPS---HPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQSTRRF---RDQIRLRFDQPD----DFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAG----YRLLSRGHTPTQPGALNQ----RQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCE 743
BLAST of laminin vs. RefSeq Human
Match: gi|767903961|ref|XP_011539621.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X6 [Homo sapiens])

HSP 1 Score: 169.474 bits (428), Expect = 2.75038e-41
Identity = 137/490 (27.96%), Postives = 204/490 (41.63%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APDYSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYV------INKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTY--KLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
C + C+N CI + C+G DC D SDE D C PN C NG C +K W+CDG DC + DE NCP K ++ G + ++C + IP ++ CD E+DC DE GC PQV+ P + S + T+ C G P P I WR NWG++P H V + TL I ++ G YTCE + R ++ PD + + P + + C+ C+C +T C S + D I + D ++K PA+ T S + + D + D F G+ ++ YG L Y + ++ + + P VV+ G Y + P N R + + ++ W + + V R+E ++VL+ + VL + Y TK +S I M V H VE+C CP GYSGLSCE
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NG-----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPS---HPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRF---RDQIRLRFDQPD----DFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAG----YRLLSRGHTPTQPGALNQ----RQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCE 761
BLAST of laminin vs. RefSeq Human
Match: gi|767903954|ref|XP_011539619.1| (PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein isoform X1 [Homo sapiens])

HSP 1 Score: 169.474 bits (428), Expect = 2.99906e-41
Identity = 137/490 (27.96%), Postives = 204/490 (41.63%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLG-SHYQC-GNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVM--APDYSVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYV------INKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTY--KLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
C + C+N CI + C+G DC D SDE D C PN C NG C +K W+CDG DC + DE NCP K ++ G + ++C + IP ++ CD E+DC DE GC PQV+ P + S + T+ C G P P I WR NWG++P H V + TL I ++ G YTCE + R ++ PD + + P + + C+ C+C +T C S + D I + D ++K PA+ T S + + D + D F G+ ++ YG L Y + ++ + + P VV+ G Y + P N R + + ++ W + + V R+E ++VL+ + VL + Y TK +S I M V H VE+C CP GYSGLSCE
Sbjct: 302 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NG-----HCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES-IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPS---HPRVTVTSEGG--RGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRAGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRF---RDQIRLRFDQPD----DFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAG----YRLLSRGHTPTQPGALNQ----RQVQFSEEHWVHESG--RPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCE 761
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389369|ref|NP_001284822.1| (terribly reduced optic lobes, isoform AS [Drosophila melanogaster])

HSP 1 Score: 188.734 bits (478), Expect = 1.12192e-47
Identity = 171/574 (29.79%), Postives = 258/574 (44.95%), Query Frame = 2
Query: 2066 KVVWRRRDK-KSFIENKESRLGG--------DSNSVLEIKQATTADDGTVYECNFNKLTEF-----VTLWVKDE------------CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCN---ECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNC-PVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKR--RVMAPDYSVTV--TKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSAN--GYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYF-TKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
+V++R RD+ + + K SR GG D N LEI D GT Y C + VT+ + E C Q C N CID++ C+G DC D SDE + C+ +C PN C SN +CV + W+CDG +DCG+N DE +C P + C + +QC + IP+++ CD DC DE GC +P I P S +S++E L + C +G P PTI WR NWG++PDK + + T TLR ++ P+ SG Y+CE I R + PD VTV + +C+ F+N A E C++C+C V C SAN Y I+ + +V + + + + P + + + N + P +L + G+ + YG L Y++ G S ++GP V++TG+ T YR+ +NN I + W D + +R E + +L +V +L R+ Y + + + I + A + S VEKC CP GY G SCE
Sbjct: 708 EVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC-----SN--SKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR------FTLTYRVRTQPG----QNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCE 1246

HSP 2 Score: 72.4034 bits (176), Expect = 2.95698e-12
Identity = 42/125 (33.60%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 2240 DECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGC 2614
+EC N+ +C N CID K CN V+DC + DE+ + C C N C+ NG CV C+G +C ++ DELNC +CL + ++C + + + C+G DC+ DE+ C
Sbjct: 490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN--NGD-----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNC 603

HSP 3 Score: 59.3066 bits (142), Expect = 3.27322e-08
Identity = 62/265 (23.40%), Postives = 104/265 (39.25%), Query Frame = 2
Query: 2900 SVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGY--VINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHIS---GPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCEM 3679
SV + CK ++ +++ CI C+CS V DC S+ Y + S S+V + NY V+ A E + I D + + G+ ++ YG LTY L S G +S P VV+ D ++ + + +P+ A + Y I+ W++ + R + L D+ + + Y T + + ++T+ A + VE+C CP GY GLSCE
Sbjct: 1369 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPT--PDTVPVSMAAEPNALSFIGSADQSG----NTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVA--NTYSVEIKESAWQRGDEVV-------ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQ 1618

HSP 4 Score: 58.9214 bits (141), Expect = 3.8087e-08
Identity = 65/265 (24.53%), Postives = 98/265 (36.98%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDK--------------------------CLGSHYQCGNDTLIPRAYWCDGEADCK-SMEDEEGCTS-PQVIEPV-----KTSQLS---------VVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVTV 2911
C NQ +C N C+ + CNG ++C D+SDE + EC PN C+ +CV +C+G DC ++ DE NC ++ + C + ++C N I C+G DC DE C I+P + +QL+ + E+ ++ C+ G + W G L TD L I NI E +G Y CE + + P VTV
Sbjct: 529 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDIDPADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVGYASYI-PGQQVTV 775
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389355|ref|NP_001245492.2| (terribly reduced optic lobes, isoform AL [Drosophila melanogaster])

HSP 1 Score: 188.348 bits (477), Expect = 1.23533e-47
Identity = 171/574 (29.79%), Postives = 258/574 (44.95%), Query Frame = 2
Query: 2066 KVVWRRRDK-KSFIENKESRLGG--------DSNSVLEIKQATTADDGTVYECNFNKLTEF-----VTLWVKDE------------CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCN---ECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNC-PVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKR--RVMAPDYSVTV--TKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSAN--GYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYF-TKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
+V++R RD+ + + K SR GG D N LEI D GT Y C + VT+ + E C Q C N CID++ C+G DC D SDE + C+ +C PN C SN +CV + W+CDG +DCG+N DE +C P + C + +QC + IP+++ CD DC DE GC +P I P S +S++E L + C +G P PTI WR NWG++PDK + + T TLR ++ P+ SG Y+CE I R + PD VTV + +C+ F+N A E C++C+C V C SAN Y I+ + +V + + + + P + + + N + P +L + G+ + YG L Y++ G S ++GP V++TG+ T YR+ +NN I + W D + +R E + +L +V +L R+ Y + + + I + A + S VEKC CP GY G SCE
Sbjct: 631 EVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC-----SN--SKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR------FTLTYRVRTQPG----QNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCE 1169

HSP 2 Score: 81.2629 bits (199), Expect = 6.19768e-15
Identity = 68/233 (29.18%), Postives = 103/233 (44.21%), Query Frame = 2
Query: 2240 DECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTS------PQVIEPVKT---SQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVTV 2911
+EC N+ +C N CID K CN V+DC + DE+ + C C N C+ NG CV C+G +C ++ DELNC +CL + ++C + + + C+G DC+ DE+ C + P + +KT SQ+ + E+ ++ C+ G + W G L TD L I NI E +G Y CE + + P VTV
Sbjct: 490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN--NGD-----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLN-LKTYPDSQI-IKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVGYASYI-PGQQVTV 698

HSP 3 Score: 58.9214 bits (141), Expect = 3.52598e-08
Identity = 62/265 (23.40%), Postives = 104/265 (39.25%), Query Frame = 2
Query: 2900 SVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGY--VINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHIS---GPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCEM 3679
SV + CK ++ +++ CI C+CS V DC S+ Y + S S+V + NY V+ A E + I D + + G+ ++ YG LTY L S G +S P VV+ D ++ + + +P+ A + Y I+ W++ + R + L D+ + + Y T + + ++T+ A + VE+C CP GY GLSCE
Sbjct: 1292 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPT--PDTVPVSMAAEPNALSFIGSADQSG----NTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVA--NTYSVEIKESAWQRGDEVV-------ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQ 1541
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389379|ref|NP_001284824.1| (terribly reduced optic lobes, isoform AX [Drosophila melanogaster])

HSP 1 Score: 188.348 bits (477), Expect = 1.2803e-47
Identity = 171/574 (29.79%), Postives = 258/574 (44.95%), Query Frame = 2
Query: 2066 KVVWRRRDK-KSFIENKESRLGG--------DSNSVLEIKQATTADDGTVYECNFNKLTEF-----VTLWVKDE------------CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCN---ECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNC-PVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKR--RVMAPDYSVTV--TKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSAN--GYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYF-TKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
+V++R RD+ + + K SR GG D N LEI D GT Y C + VT+ + E C Q C N CID++ C+G DC D SDE + C+ +C PN C SN +CV + W+CDG +DCG+N DE +C P + C + +QC + IP+++ CD DC DE GC +P I P S +S++E L + C +G P PTI WR NWG++PDK + + T TLR ++ P+ SG Y+CE I R + PD VTV + +C+ F+N A E C++C+C V C SAN Y I+ + +V + + + + P + + + N + P +L + G+ + YG L Y++ G S ++GP V++TG+ T YR+ +NN I + W D + +R E + +L +V +L R+ Y + + + I + A + S VEKC CP GY G SCE
Sbjct: 658 EVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC-----SN--SKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR------FTLTYRVRTQPG----QNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCE 1196

HSP 2 Score: 80.8777 bits (198), Expect = 8.34258e-15
Identity = 68/233 (29.18%), Postives = 103/233 (44.21%), Query Frame = 2
Query: 2240 DECALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTS------PQVIEPVKT---SQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVTV 2911
+EC N+ +C N CID K CN V+DC + DE+ + C C N C+ NG CV C+G +C ++ DELNC +CL + ++C + + + C+G DC+ DE+ C + P + +KT SQ+ + E+ ++ C+ G + W G L TD L I NI E +G Y CE + + P VTV
Sbjct: 517 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN--NGD-----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLN-LKTYPDSQI-IKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVGYASYI-PGQQVTV 725

HSP 3 Score: 59.3066 bits (142), Expect = 3.0685e-08
Identity = 62/265 (23.40%), Postives = 104/265 (39.25%), Query Frame = 2
Query: 2900 SVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGY--VINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHIS---GPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCEM 3679
SV + CK ++ +++ CI C+CS V DC S+ Y + S S+V + NY V+ A E + I D + + G+ ++ YG LTY L S G +S P VV+ D ++ + + +P+ A + Y I+ W++ + R + L D+ + + Y T + + ++T+ A + VE+C CP GY GLSCE
Sbjct: 1319 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPT--PDTVPVSMAAEPNALSFIGSADQSG----NTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVA--NTYSVEIKESAWQRGDEVV-------ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQ 1568
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389375|ref|NP_001284823.1| (terribly reduced optic lobes, isoform AV [Drosophila melanogaster])

HSP 1 Score: 188.348 bits (477), Expect = 1.31177e-47
Identity = 171/574 (29.79%), Postives = 258/574 (44.95%), Query Frame = 2
Query: 2066 KVVWRRRDK-KSFIENKESRLGG--------DSNSVLEIKQATTADDGTVYECNFNKLTEF-----VTLWVKDE------------CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCN---ECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNC-PVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKR--RVMAPDYSVTV--TKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSAN--GYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYF-TKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
+V++R RD+ + + K SR GG D N LEI D GT Y C + VT+ + E C Q C N CID++ C+G DC D SDE + C+ +C PN C SN +CV + W+CDG +DCG+N DE +C P + C + +QC + IP+++ CD DC DE GC +P I P S +S++E L + C +G P PTI WR NWG++PDK + + T TLR ++ P+ SG Y+CE I R + PD VTV + +C+ F+N A E C++C+C V C SAN Y I+ + +V + + + + P + + + N + P +L + G+ + YG L Y++ G S ++GP V++TG+ T YR+ +NN I + W D + +R E + +L +V +L R+ Y + + + I + A + S VEKC CP GY G SCE
Sbjct: 814 EVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC-----SN--SKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR------FTLTYRVRTQPG----QNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCE 1352

HSP 2 Score: 58.9214 bits (141), Expect = 3.63128e-08
Identity = 62/265 (23.40%), Postives = 104/265 (39.25%), Query Frame = 2
Query: 2900 SVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGY--VINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHIS---GPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCEM 3679
SV + CK ++ +++ CI C+CS V DC S+ Y + S S+V + NY V+ A E + I D + + G+ ++ YG LTY L S G +S P VV+ D ++ + + +P+ A + Y I+ W++ + R + L D+ + + Y T + + ++T+ A + VE+C CP GY GLSCE
Sbjct: 1475 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPT--PDTVPVSMAAEPNALSFIGSADQSG----NTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVA--NTYSVEIKESAWQRGDEVV-------ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQ 1724

HSP 3 Score: 53.9138 bits (128), Expect = 1.24498e-06
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDK 2509
C NQ +C N C+ + CNG ++C D+SDE + EC PN C+ +CV +C+G DC ++ DE NC + D+
Sbjct: 712 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 793

HSP 4 Score: 53.5286 bits (127), Expect = 1.65737e-06
Identity = 51/192 (26.56%), Postives = 79/192 (41.15%), Query Frame = 2
Query: 2363 CTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTS------PQVIEPVKT---SQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVTV 2911
C N C+ NG CV C+G +C ++ DELNC +CL + ++C + + + C+G DC+ DE+ C + P + +KT SQ+ + E+ ++ C+ G + W G L TD L I NI E +G Y CE + + P VTV
Sbjct: 712 CYANQFRCN--NGD-----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLN-LKTYPDSQI-IKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVGYASYI-PGQQVTV 881
BLAST of laminin vs. RefSeq Drosophila melanogaster
Match: gi|665389381|ref|NP_001245494.2| (terribly reduced optic lobes, isoform AY [Drosophila melanogaster])

HSP 1 Score: 188.348 bits (477), Expect = 1.45102e-47
Identity = 171/574 (29.79%), Postives = 258/574 (44.95%), Query Frame = 2
Query: 2066 KVVWRRRDK-KSFIENKESRLGG--------DSNSVLEIKQATTADDGTVYECNFNKLTEF-----VTLWVKDE------------CALNQRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCN---ECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNC-PVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKR--RVMAPDYSVTV--TKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSAN--GYVINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYF-TKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCE 3676
+V++R RD+ + + K SR GG D N LEI D GT Y C + VT+ + E C Q C N CID++ C+G DC D SDE + C+ +C PN C SN +CV + W+CDG +DCG+N DE +C P + C + +QC + IP+++ CD DC DE GC +P I P S +S++E L + C +G P PTI WR NWG++PDK + + T TLR ++ P+ SG Y+CE I R + PD VTV + +C+ F+N A E C++C+C V C SAN Y I+ + +V + + + + P + + + N + P +L + G+ + YG L Y++ G S ++GP V++TG+ T YR+ +NN I + W D + +R E + +L +V +L R+ Y + + + I + A + S VEKC CP GY G SCE
Sbjct: 736 EVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMC-----SN--SKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRG-SGRPVNGPDVIITGNR------FTLTYRVRTQPG----QNNRVSIPFVPGGWQKPDG--RKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCE 1274

HSP 2 Score: 65.4698 bits (158), Expect = 3.84426e-10
Identity = 62/227 (27.31%), Postives = 95/227 (41.85%), Query Frame = 2
Query: 2258 QRKCQNETCIDENKFCNGVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEEGCTS------PQVIEPVKT---SQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDKLDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVTV 2911
Q +C + C E++ C+ C D SDE N C N C+ NG CV C+G +C ++ DELNC +CL + ++C + + + C+G DC+ DE+ C + P + +KT SQ+ + E+ ++ C+ G + W G L TD L I NI E +G Y CE + + P VTV
Sbjct: 603 QHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN--NGD-----CVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLN-LKTYPDSQI-IKESREVIFRCRDEGPARAKVKWSRPGGR---PLPPGFTDR-------NGRLEIPNIRVEDAGTYVCEAVGYASYI-PGQQVTV 803

HSP 3 Score: 58.9214 bits (141), Expect = 3.62287e-08
Identity = 62/265 (23.40%), Postives = 104/265 (39.25%), Query Frame = 2
Query: 2900 SVTVTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGY--VINSDPIESKVKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHFLGGSFNMRGSWINKYGFPLTYKLIISGESVGHIS---GPIVVMTGHSDKKIYYCTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEXXXXXXXXXXXXKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGYSGLSCEM 3679
SV + CK ++ +++ CI C+CS V DC S+ Y + S S+V + NY V+ A E + I D + + G+ ++ YG LTY L S G +S P VV+ D ++ + + +P+ A + Y I+ W++ + R + L D+ + + Y T + + ++T+ A + VE+C CP GY GLSCE
Sbjct: 1397 SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPT--PDTVPVSMAAEPNALSFIGSADQSG----NTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVA--NTYSVEIKESAWQRGDEVV-------ANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQ 1646

HSP 4 Score: 53.5286 bits (127), Expect = 1.55936e-06
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 2
Query: 2246 CALNQRKCQNETCIDENKFCNGVNDCGDNSDE-DPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDDCGNNFDELNCPVKNKDK 2509
C NQ +C N C+ + CNG ++C D+SDE + EC PN C+ +CV +C+G DC ++ DE NC + D+
Sbjct: 634 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNS-------GQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 715
The following BLAST results are available for this feature:
BLAST of laminin vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|317373536|sp|P98160|PGBM_HUMAN5.956230e-4128.25RecName: Full=Basement membrane-specific heparan s... [more]
gi|30179887|sp|Q06561|UNC52_CAEEL6.832030e-3426.55RecName: Full=Basement membrane proteoglycan; AltN... [more]
gi|1172451|sp|Q05793|PGBM_MOUSE1.291490e-3232.84RecName: Full=Basement membrane-specific heparan s... [more]
gi|160409939|sp|A2ARV4|LRP2_MOUSE4.428970e-1636.11RecName: Full=Low-density lipoprotein receptor-rel... [more]
gi|1708867|sp|P98158|LRP2_RAT8.808980e-1536.92RecName: Full=Low-density lipoprotein receptor-rel... [more]
back to top
BLAST of laminin vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150033250.000000e+055.47SmedAsxldir_c101543_g1_i1|m.51138|m.8906[more]
SMU150035842.548360e-8030.56SmedAsxldir_c102345_g1_i1|m.54199|m.2277[more]
SMU150017309.743020e-7829.77Asxlregen_comp65513_c0_seq1|m.19286|m.12982[more]
SMU150016434.445860e-7530.60Asxlregen_comp65113_c0_seq2|m.18193|m.7115[more]
SMU150351232.086180e-7330.26SmedSxlregen_c88126_g1_i1|m.36302|m.5005[more]
back to top
BLAST of laminin vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|578798995|ref|XP_006710657.1|1.374600e-4128.25PREDICTED: basement membrane-specific heparan sulf... [more]
gi|126012571|ref|NP_005520.4|2.247930e-4128.25basement membrane-specific heparan sulfate proteog... [more]
gi|578799001|ref|XP_006710660.1|2.386070e-4128.25PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903961|ref|XP_011539621.1|2.750380e-4127.96PREDICTED: basement membrane-specific heparan sulf... [more]
gi|767903954|ref|XP_011539619.1|2.999060e-4127.96PREDICTED: basement membrane-specific heparan sulf... [more]
back to top
BLAST of laminin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|665389369|ref|NP_001284822.1|1.121920e-4729.79terribly reduced optic lobes, isoform AS [Drosophi... [more]
gi|665389355|ref|NP_001245492.2|1.235330e-4729.79terribly reduced optic lobes, isoform AL [Drosophi... [more]
gi|665389379|ref|NP_001284824.1|1.280300e-4729.79terribly reduced optic lobes, isoform AX [Drosophi... [more]
gi|665389375|ref|NP_001284823.1|1.311770e-4729.79terribly reduced optic lobes, isoform AV [Drosophi... [more]
gi|665389381|ref|NP_001245494.2|1.451020e-4729.79terribly reduced optic lobes, isoform AY [Drosophi... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_031777 ID=Pmo_031777|Name=laminin|organism=Phagocata morgani|type=mRNA|length=3827bp
CAGATTTTCTGTCCTACAAAACGAATAAATATGACCAGTCTGTTTATCAA
TTTTCAATCAATTAATTCTAGAAATTACACTAATATTATCGTTGTTATTG
TGCAGTGTGTTGGGTGCATTTACTCTCTCATCAACGATAATCAATTATTG
ACGGTGTTTTTTTAAATAAAAAAAGTTTAGTGTTGACAAATAATACAAAG
ACAATTCAATGCATATTTTCATTCCTTTACTGGTGATGGTAGGGTATTTC
ACTAAATCGTACGAGTCAGTGTTTCCTCATACCAGAACGGTGTCTATCGA
CCTTGAGAAATTGAAAAAAGAACCTTTTAACATATATTTCACCTGTGCCA
ATATTCGATCAAAGCAAGACCGAGTACGATATTTTAGAGTCCAAAATGGT
GCCAGAGGATTAATAGAAAAAAAGAAACGTTTTGGGATAATTTTAAGCAT
TAAATCAGAATCGGATCTTGGTCAATATGAATGTTCCGTTACAGCGCCCG
ATAAGACAGTATTAAACGCCACTTTAAATACCGTGGACATGAAGAAAATG
GAAAGTCCTACGAAATTCGTTTACGATTTGTCTAAAACGAAATACGTAAT
TCAGAAATCAGGATCCGTAGAATTGGACTGCGGAACATCGGGCAATGAAG
TGGTGACGTGGTACAAACCAACTCAGTATCACATATTTACCGGAAGCAAA
TTAAAAATCGATTCATTGACAAATTTCGATTATGGAACGTATTATTGTGC
TGTTGGTGATACAAATAAGGCGACTTTGATGGTAACTAAAGTGATATTGC
TGCCAGAAGAACCAAAACAGAAAGAAAAGAAAATTGACGAGGACGTAATG
TATATTGAAAGCTTCATCCCGAAATCAAAATCAGTCCGATTCAAACCTAT
AGACGTGGTCGACAAATCATTCGCCGTCACATGGGAACAGCCACCAGGAA
CTGTCCTATTGGAGCACGCACGAAAACTTTACTTCCAGTCGTTTTCACCA
GACCAGACTAAGATTCCATTCTTTTACCGAATTACTAAAAACGGCGATCC
ATCGGTCAACAAAGTTGGGAAAGTGTATATTTCAGATTGGACAGATAAAG
AAGTTGAAGTAACGCTGGAAGGAGCTGTTCAGTATGGCAGCGATATGACT
GTTAATTGTTTCCCGGCCCCGGAATTGGGAAATGATACATCGGTCATTTG
GCGTCTGGACGAAAAGATAATCCATCGCGGAAATACATACACAATAAAGA
ACTTCCAGAAGCAGTTTTTTGGCAAGTACAGTTGTGAGATTCAACAAAGT
GGAGTTAAAATCATTAGTCGGGTCATAAACCTCGCTCCGGAACAGGATTT
GCAGGCGAAAATAGAGATGACCCCGGATCCTGGCAATTATTATAATTTCC
ACATGGGTAAAAACAAAGAATTGCACTGTGAAATTTTACGTGAGGATGGA
AATTGGAAGTTCAATGCTAAAGAAATTATATGGACTTTAAATGGCCGAAA
AATGGACACGGAAAATCCATCATCTCCTTTCAGCGATCCTAAAAGATTCG
GTCGTCTCGACACTCGATCTGTGAGTATTCTCGTCTTAAAAAACCTGGGA
GAAGATAACAAAGGCACATATAAATGCTTCCAAGGTGCAAATGTATATGC
GGCGACCTTGCTCCTCGAACAAAGTGACATTCTCGTGGAATTATCACCAC
CGGAACAAACTGCGGCAGACAATGTAAACCAAGTGGCAGAGTTCCATTGT
CGGATCGATACTCCAAATTATAATTCTAGTCTCATCAAATGGTCATTTAT
TCCCGAAAACTCCGATGCAGAAATTCCCGTGCCTGCAGAAGCAATCATCG
AAAAGCCAGTTTTAACATCGTCAACGTCTTTCGTTACAATCGATAATGTT
CTGAAACGGCACGAGGGAAATTATGTTTGTCGAGTAAAAGACAGAAAAGT
TGTCGGAAAACTGATTGTCAAGTCTAGACCAGTATTAACGGTTAATCCAA
AGGAAATCACAGTCAAGCCAGGAGGAACGGCAAGATTCTTATGTCAGCTG
ACTGGAATTGATGGGAAAGTCGTTTGGAGAAGACGAGATAAGAAAAGTTT
TATCGAAAATAAAGAAAGCCGTTTAGGGGGCGATTCAAATTCTGTGTTGG
AAATAAAACAGGCCACAACTGCCGATGATGGAACTGTTTACGAATGCAAT
TTTAATAAATTAACAGAATTCGTGACATTGTGGGTCAAAGATGAATGTGC
TTTGAATCAGAGAAAATGTCAAAACGAAACTTGCATTGATGAAAATAAAT
TTTGCAATGGGGTAAACGATTGCGGAGATAACTCAGACGAAGATCCGAAA
AGATGTAACGAATGTACTCCCAATTCGATACACTGTGACTTCCTGAATGG
TTCAAATCCAATCAAAAGGTGCGTAATAAAACATTGGCAATGCGACGGTG
TTGATGATTGCGGAAACAACTTCGATGAGCTCAATTGTCCAGTAAAAAAC
AAAGACAAATGTCTCGGTTCACACTACCAATGCGGTAATGACACTTTGAT
ACCACGGGCATATTGGTGTGACGGCGAGGCAGACTGCAAATCGATGGAGG
ACGAGGAAGGATGCACGTCACCCCAAGTCATAGAGCCGGTGAAGACCAGC
CAGTTATCCGTGGTGGAGAATAGCACCCTGTTGATCGAGTGTCAGATTTC
CGGTCGGCCGATACCGACTATAACCTGGCGCTACAATTGGGGTTACTTGC
CGGACAAGTTGGACCACAACATAACCGATGTAGTCACAAATTGTAGCATT
ATAACGAGCACGTTACGGATCAATAACATAAGTCCGGAGCAGAGTGGCAT
ATACACGTGTGAGGGCATCGCTAAGCGGAGGGTGATGGCGCCGGATTATT
CGGTCACTGTAACAAAGGGATCGATATGCAAGAGACCGTTTTACAACAAT
GACGCCTGGTATCAGGAATTGTGTATACGTTGTTACTGTTCCAATGTCAC
AGATGATTGTACCAGTGCCAATGGATACGTTATAAATTCGGATCCAATAG
AAAGCAAAGTCAAAGCGTCTGATGCAGCAATTATGAATTACAAAAACAAT
GTCTACTACGAACCTGCCCGCGCGGTCACTTTTGCCAATGAAAGCATCTT
AATGTACGTAATAAATAAAGATGATTACAAGAAATTGATTCCGGACGACG
ACCATTTCTTGGGAGGCAGTTTCAATATGAGAGGGTCGTGGATTAACAAA
TATGGATTTCCGTTAACTTATAAATTGATTATTTCCGGAGAAAGCGTTGG
ACATATTTCGGGACCAATAGTTGTCATGACAGGCCACAGCGACAAGAAGA
TCTACTACTGCACCCAGAAATATCGTATTCCAGCCTATGCATCTGAGGAC
AACTACGAGAACAACATTCGGATCATATTGTGGGAACAAGACCGCTGGTT
CATCGATGATGCGTGCACAAAATCTGTGACGAGATCTGAATTTATCGAAG
TGTTGCGAGATGTTCGCCTGGTTCTATTCCGAGTGAAATATTTCACTAAA
CAGACCGATTTCAAAATGTCAAAGATCACGATGCAGGAGGCCGTCAAATC
GAAGTACGACCACTCCTGGGTGTCCAGAGTAGAGAAATGTAACTGCCCGG
CGGGATATTCTGGATTATCGTGTGAGATGAAAGAAAATTAATCGGCATCT
CTCTCTCTCCCTCGCAATTGACTCGATCTTATAGTCTTAGACAATTGTAG
TGACTATCTGGTTATGCTCTATATTATAGTTTCGCCTTTATTTTAAATAA
ATATATGATTACAATTTTTAAAAAAAA

Design Primers for laminin

back to top

protein sequence

>Pmo_031777-protein ID=Pmo_031777-protein|Name=laminin|organism=Phagocata morgani|type=polypeptide|length=1161bp
MHIFIPLLVMVGYFTKSYESVFPHTRTVSIDLEKLKKEPFNIYFTCANIR
SKQDRVRYFRVQNGARGLIEKKKRFGIILSIKSESDLGQYECSVTAPDKT
VLNATLNTVDMKKMESPTKFVYDLSKTKYVIQKSGSVELDCGTSGNEVVT
WYKPTQYHIFTGSKLKIDSLTNFDYGTYYCAVGDTNKATLMVTKVILLPE
EPKQKEKKIDEDVMYIESFIPKSKSVRFKPIDVVDKSFAVTWEQPPGTVL
LEHARKLYFQSFSPDQTKIPFFYRITKNGDPSVNKVGKVYISDWTDKEVE
VTLEGAVQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQ
KQFFGKYSCEIQQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMG
KNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRL
DTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQ
TAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKP
VLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGKLIVKSRPVLTVNPKEI
TVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIK
QATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCN
GVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDD
CGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE
GCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDK
LDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVT
VTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESK
VKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHF
LGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYY
CTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEVLR
DVRLVLFRVKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGY
SGLSCEMKEN*
back to top

coding sequence

>Pmo_031777.209.3691 ID=Pmo_031777.209.3691|Name=Pmo_031777.209.3691|organism=Phagocata morgani|type=CDS|length=3483bp
ATGCATATTTTCATTCCTTTACTGGTGATGGTAGGGTATTTCACTAAATC
GTACGAGTCAGTGTTTCCTCATACCAGAACGGTGTCTATCGACCTTGAGA
AATTGAAAAAAGAACCTTTTAACATATATTTCACCTGTGCCAATATTCGA
TCAAAGCAAGACCGAGTACGATATTTTAGAGTCCAAAATGGTGCCAGAGG
ATTAATAGAAAAAAAGAAACGTTTTGGGATAATTTTAAGCATTAAATCAG
AATCGGATCTTGGTCAATATGAATGTTCCGTTACAGCGCCCGATAAGACA
GTATTAAACGCCACTTTAAATACCGTGGACATGAAGAAAATGGAAAGTCC
TACGAAATTCGTTTACGATTTGTCTAAAACGAAATACGTAATTCAGAAAT
CAGGATCCGTAGAATTGGACTGCGGAACATCGGGCAATGAAGTGGTGACG
TGGTACAAACCAACTCAGTATCACATATTTACCGGAAGCAAATTAAAAAT
CGATTCATTGACAAATTTCGATTATGGAACGTATTATTGTGCTGTTGGTG
ATACAAATAAGGCGACTTTGATGGTAACTAAAGTGATATTGCTGCCAGAA
GAACCAAAACAGAAAGAAAAGAAAATTGACGAGGACGTAATGTATATTGA
AAGCTTCATCCCGAAATCAAAATCAGTCCGATTCAAACCTATAGACGTGG
TCGACAAATCATTCGCCGTCACATGGGAACAGCCACCAGGAACTGTCCTA
TTGGAGCACGCACGAAAACTTTACTTCCAGTCGTTTTCACCAGACCAGAC
TAAGATTCCATTCTTTTACCGAATTACTAAAAACGGCGATCCATCGGTCA
ACAAAGTTGGGAAAGTGTATATTTCAGATTGGACAGATAAAGAAGTTGAA
GTAACGCTGGAAGGAGCTGTTCAGTATGGCAGCGATATGACTGTTAATTG
TTTCCCGGCCCCGGAATTGGGAAATGATACATCGGTCATTTGGCGTCTGG
ACGAAAAGATAATCCATCGCGGAAATACATACACAATAAAGAACTTCCAG
AAGCAGTTTTTTGGCAAGTACAGTTGTGAGATTCAACAAAGTGGAGTTAA
AATCATTAGTCGGGTCATAAACCTCGCTCCGGAACAGGATTTGCAGGCGA
AAATAGAGATGACCCCGGATCCTGGCAATTATTATAATTTCCACATGGGT
AAAAACAAAGAATTGCACTGTGAAATTTTACGTGAGGATGGAAATTGGAA
GTTCAATGCTAAAGAAATTATATGGACTTTAAATGGCCGAAAAATGGACA
CGGAAAATCCATCATCTCCTTTCAGCGATCCTAAAAGATTCGGTCGTCTC
GACACTCGATCTGTGAGTATTCTCGTCTTAAAAAACCTGGGAGAAGATAA
CAAAGGCACATATAAATGCTTCCAAGGTGCAAATGTATATGCGGCGACCT
TGCTCCTCGAACAAAGTGACATTCTCGTGGAATTATCACCACCGGAACAA
ACTGCGGCAGACAATGTAAACCAAGTGGCAGAGTTCCATTGTCGGATCGA
TACTCCAAATTATAATTCTAGTCTCATCAAATGGTCATTTATTCCCGAAA
ACTCCGATGCAGAAATTCCCGTGCCTGCAGAAGCAATCATCGAAAAGCCA
GTTTTAACATCGTCAACGTCTTTCGTTACAATCGATAATGTTCTGAAACG
GCACGAGGGAAATTATGTTTGTCGAGTAAAAGACAGAAAAGTTGTCGGAA
AACTGATTGTCAAGTCTAGACCAGTATTAACGGTTAATCCAAAGGAAATC
ACAGTCAAGCCAGGAGGAACGGCAAGATTCTTATGTCAGCTGACTGGAAT
TGATGGGAAAGTCGTTTGGAGAAGACGAGATAAGAAAAGTTTTATCGAAA
ATAAAGAAAGCCGTTTAGGGGGCGATTCAAATTCTGTGTTGGAAATAAAA
CAGGCCACAACTGCCGATGATGGAACTGTTTACGAATGCAATTTTAATAA
ATTAACAGAATTCGTGACATTGTGGGTCAAAGATGAATGTGCTTTGAATC
AGAGAAAATGTCAAAACGAAACTTGCATTGATGAAAATAAATTTTGCAAT
GGGGTAAACGATTGCGGAGATAACTCAGACGAAGATCCGAAAAGATGTAA
CGAATGTACTCCCAATTCGATACACTGTGACTTCCTGAATGGTTCAAATC
CAATCAAAAGGTGCGTAATAAAACATTGGCAATGCGACGGTGTTGATGAT
TGCGGAAACAACTTCGATGAGCTCAATTGTCCAGTAAAAAACAAAGACAA
ATGTCTCGGTTCACACTACCAATGCGGTAATGACACTTTGATACCACGGG
CATATTGGTGTGACGGCGAGGCAGACTGCAAATCGATGGAGGACGAGGAA
GGATGCACGTCACCCCAAGTCATAGAGCCGGTGAAGACCAGCCAGTTATC
CGTGGTGGAGAATAGCACCCTGTTGATCGAGTGTCAGATTTCCGGTCGGC
CGATACCGACTATAACCTGGCGCTACAATTGGGGTTACTTGCCGGACAAG
TTGGACCACAACATAACCGATGTAGTCACAAATTGTAGCATTATAACGAG
CACGTTACGGATCAATAACATAAGTCCGGAGCAGAGTGGCATATACACGT
GTGAGGGCATCGCTAAGCGGAGGGTGATGGCGCCGGATTATTCGGTCACT
GTAACAAAGGGATCGATATGCAAGAGACCGTTTTACAACAATGACGCCTG
GTATCAGGAATTGTGTATACGTTGTTACTGTTCCAATGTCACAGATGATT
GTACCAGTGCCAATGGATACGTTATAAATTCGGATCCAATAGAAAGCAAA
GTCAAAGCGTCTGATGCAGCAATTATGAATTACAAAAACAATGTCTACTA
CGAACCTGCCCGCGCGGTCACTTTTGCCAATGAAAGCATCTTAATGTACG
TAATAAATAAAGATGATTACAAGAAATTGATTCCGGACGACGACCATTTC
TTGGGAGGCAGTTTCAATATGAGAGGGTCGTGGATTAACAAATATGGATT
TCCGTTAACTTATAAATTGATTATTTCCGGAGAAAGCGTTGGACATATTT
CGGGACCAATAGTTGTCATGACAGGCCACAGCGACAAGAAGATCTACTAC
TGCACCCAGAAATATCGTATTCCAGCCTATGCATCTGAGGACAACTACGA
GAACAACATTCGGATCATATTGTGGGAACAAGACCGCTGGTTCATCGATG
ATGCGTGCACAAAATCTGTGACGAGATCTGAATTTATCGAAGTGTTGCGA
GATGTTCGCCTGGTTCTATTCCGAGTGAAATATTTCACTAAACAGACCGA
TTTCAAAATGTCAAAGATCACGATGCAGGAGGCCGTCAAATCGAAGTACG
ACCACTCCTGGGTGTCCAGAGTAGAGAAATGTAACTGCCCGGCGGGATAT
TCTGGATTATCGTGTGAGATGAAAGAAAATTAA
back to top
Gene Groups
laminin is similar in sequence to the genes of this group: GG2514
Gene NameGene ID
SMU15003325SMU15003325
lamininDdo_003647
lamininGsp_020815
Pgr_001754Pgr_001754
lamininPgr_008586
Pmo_019678Pmo_019678
lamininPmo_031777

Gene Group Protein Sequences

>SMU15003325

MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIR
PDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDK
TIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESV
NWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVK
NMVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTI
LLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAM
DVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFK
KDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSG
VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNS
VSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELAD
NVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAAS
STSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKP
GGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATK
DDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKND
CGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNN
FDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN
PQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYN
ITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKG
QICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPS
DAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGA
FNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKY
RLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLV
LFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSC
ENKVE*
>Ddo_003647 laminin
MFAKNVIWTLNDKKIDIKHPLYGLKIGRLDTNSVSILVLKEMADDLEGTY
KCYQNTTVLAAKLLMERSDVLIEVAPSEQTVFDNVNQESELHCRIDTANI
NSSFIQWSFIPENSKTEVELPPEAKVSRPALTSSTSFVVIENTLKRHEGT
YVCRVLGKKVFGRVIVKAKPVLKVSPKTITIKPGGDARFLCQLMGADGKV
IWRRFDKKSLEVNKENRIGGSTQSILEIKQATKNDHGTIYECVFNKLIEQ
VTLFVEEECALNQRKCKNDLCIDENKFCDGKNDCGDNSDEDRTRCNECSP
NAIHCDFLKGADPTKRCVIKHWQCDGIDDCGNNFDELNCPVKNTDKCIGT
HFLCDDDVLIPRSYWCDGDSDCKSMEDEKSCSHPQVVEPEKQMQISVFSG
STLTLTCEMSGRPVPSITWRYNWGHLSENLLYNITTKISNCSVITSTLTV
HNITMDQSGVYSCEGIARRRVMAPDFIVVVSKGSICQKPFYNNDAWDTSM
CIKCYCSNLTDDCTSATGYVNNPQPVESGIKPSDAAIVNYKTTEYYEPAR
EVTFANANLKKYYIDKNSYIKFIPTADYYFGGVFNVEGSWLNRYGFPLSY
QLILSGESYKYIPGPLIVIKGGSDYVYYCGIQNDFRLPVYASEDSYENKI
RVVLWEQEWHADPQCKKGVSRQHFMNVLINVNLLLFKVKYFEKQTDFMMS
KISINEAIKTKDKYTWVGNLEKCNCPAGYSGLSCEIKSNER*
>Gsp_020815 laminin
MTTFNNIPLLIFIFTKILQSEGFQPTRNVSVDVDDLKIRNMNLYFVCPYV
RSKTNVIKYFKYVENTSIVLKEKQNAHGIIITLKDASDMGKYGCSVILEN
GMIKNATFNIIDKQLMENPKLFIYKTEETIYVTQKGNVAELSCGNLMNPS
TTWYRPPQYHIYSGSKYIIKDVDRYSYGTYYCTSETTNTNTVSVRKVILV
KEIPKIKEKSIEEEVNYVETLSVQPGTVRYRSSNIAKSNDMIIWENPPGT
ILLDHERDLYIQSIKDDENIFYYRINRYGDSSINNVGKLIISIKKQDKLM
NLQSPVIYGGEIKMDCISSTDFNNNTAVIWKRNSEIIFHGNTLTIPSFNK
KTFGKYSCEVLQGNEKQKTRFLNLLPEQKIESKIEMTPEPGNFYLYHSGA
KKELHCEIERVNNQWIMKAKDVIWTFNNKKIETIANSVLKRVDRLDTNSV
SILVLTDIDEKHEGNYNCFQGSTVLSAKLLMERSNILLELAPPLQEVADN
VNQGAELHCRIDTQNVNSSSIIWKFIPEKSLIETELPIEAKIERPSLTSS
TSFIVINNVLKRHEGTYVCQVLNTKVFGKIIVRTKPVLTVTPKSITIKPG
STARFLCQLNGLEGKVIWRRTDRKSLTVNRENRLGGDASSLLEIKDVTRD
DHGTIYECVFNKLTEFVTLNVEEECELNQRKCKNEICIDENKFCDGKDDC
GDNSDEDRQRCNECNPNSIHCDFLNNSNPNKRCVIKHWQCDGIDDCGNNF
DELNCPVKNQNRCIGTHFLCNNNTLIPRSYWCDGEPDCLSMEDEIDCSDP
QVIEPVKQMQISIFTNSTLILTCKMSGRPVPTISWRFNWDHLPVNLNHNI
TTTTSNCSMITSTLLIKDISTDHSGVYSCEGISRRRVMAPDFSVSVSKGL
ICQKPYYNNDAWYPEMCLRCYCSNVTDDCTSATGYITKPEPIESGIKPSD
AAIVNFKTLEYYKPAREITFANMEKMNYFINETYYQRLVPNQDYYFGGAF
NMGGSWLKRYGYPMTYKLKLSGESKTYIPNPMVMIKGEVASIYYCGVKYR
LPVYASNENFENNIRIFLWEKDYWYNDYSCTVPVSRNDIINVLKEVRLAL
FKVKYFVGQTDFQMSKLSMQEAIETKDKYSWVGKIEKCNCPLGFSGLSCE
TKID*
>Pgr_001754 Pgr_001754
MESPTKFTYDLSQTKYVIQNSGSVELDCGAPANEIVTWFRPPQFHIYTGS
KLKIETLTKFDYGTYYCAIGSTAKSTVPVTKVILLPEEPKQKEKKLDEDF
LFMESLVPKSSEVRFKPSDVAGKFDTVTWEQPPGTILLEHGRNLYFQSYS
PETSKTPFYYRIHRNGDHLINKVGKLFIAHWQDKEEQMTVEGAVQYGNDM
TINCFSDPESINETHVVWRLDDKIIHRGNTYTIKNFQKKYFGKYSCEIEK
GGVRIVSRSINLAPEQDLAAKIEMTPDPGNYYNFHSGKNKELHCEIQRED
GNWKFKSKDIIWTLNGRKIDIGNPGSPFANTKRFGRLNTQSVSILVLKEL
GEDNKGTYKCFQGSTVYAATLLMEPSEILIELSPPEQTAADNVNQMAEFH
CRIDTPNYNSSFIRWSFIPEGSDQEEKVPTEAVIDNPIQTSSTSFVSIEN
VLKRHEGQYVCRVLDRKVVGKLIVKSRPVLKVNPKEITVKPGGTARYLCQ
LTGIEGKVIWRRRDKKSFIENKETRMGGDTNSLLEIKQTTTADDGTVYEC
NFNKLTEYVTLWVKDDCALNQRKCQNSTCIDENKFCDGKNDCGDNSDEDP
KRCNECTPNSIHCDFLNNSIPNKRCVVKHWQCDGVDDCGNNFDELNCPVK
NTEKCLGSHYQCGNETLIPRAYWCDGEVDCKSGEDEEGCTSPQVIEPAKP
SQLTVVENSTMIIECQISGRPVPTVTWRYNWGYLPDKLEHNITDVVTNCS
MVTSTLRINNISPEQSGIYTCEGIAKRRVMAPDISVTVTKETVCKRPFFN
NDAWTQELCLRCYCSNVTDDCTSASGYVINPDLIESQARSSDAAVINYKT
NEYYEPARPVGFANDTLKMYIINKENYKKLIPDDDHFLGGSFNMRGSWIN
RYGFPLTYKLTLAGESVGHISGPIVVMVGHSEKKIFYCTPKYRLPAYASD
DNTENNMRIILWEQDRWFVDDKCSKSVTRSEFIEVLRDVRLVLFRVRYFT
KQTDFKMSKITMQEAIKSKYEHSWIPRIEKCNCPQGYSGLSCENKST*
>Pgr_008586 laminin
MISIAKSLFIVKLVVLGFLVDENTAVFNLTRNVSIQVEPLKYGEVNIYFV
CPNIRSNEDKVMYYKVEKGIKGLIQKRKPHGIILKIKTKSDLGEYQCSII
SKDSSTRNATLNIIDSKEMESPVKFVYDYSKTKYVIEKSGSVELDSEAST
NDMVTWYRPPQFHIFTGRKLKIDNLNEFDFGTYYFAIGMTSKSVLQVTKV
ILLPQRPTKREKTIDEDVMYLENIIPKAKEIRYRPGNVAGISETVTWEQP
PGTILLEHGRDAYFYSYTASKSDLPLYYRINKNGDFTVNKVGKVFISEWK
NREVEMSVEGRAAYGAEMKVNCIPSPDLGNKTEVIWRLDDKIIHRGNTYF
IKNFQKEVYGKYSCEIHRNGVMIQSRIINLTPKAGTESKIEMTPDPGLYY
NFHPEKTKELHCEIVREDGEWKFRSKDIIWTFNGRKIDVENPLSAFGNIN
RFGRLDTRSVSILVLKDMGEDNQGVYKCFQGPLTFASILIMEQSEVIIEL
SPPRLTVLHNANHVAEFHCRIDTPGYNSSFIEWKFMKFNSTIEYDLPPES
IVEKPHQTSATSFVTIKNSLKKHEGFYVCKVLGRQVTGILIVKTKQMLTV
NPKEITVSPGGTARFLCQLTAMNGKVTWRRKDKKSFILNKENRLGGSTNS
LLEIKEVTKADDGTIYECNFNSLTEIVTLWVKDECALNQRKCQNETCIDE
GKFCDGKNDCGDNSDEDPKRCRECTPNSIHCDFLNNSSPIKRCVVRHWQC
DGIDDCGNNFDELHCPDKNKDKCLGSHYSCDNGTLIPRAYWCDGDSDCKS
MEDEEGCSPPQVIEPAKLSHLSVIENSTLTLVCQISGRPMPTITWRYNWG
YLPDTMDHNVTEVVTNCTLITSTLTITNISPEDSGIYTCEGIEKRRIMAP
DFSVTVTKGSVCKRPYFNNDAWDQEFCLRCYCSNVTDDCTSANGYITNPD
LVESKVRSSDAAIMNYQTNEYFEPARMVSFVDDVSKTYSINTTNYEKFVT
SDDLFLGGSFNMRGSWINRYGYPLTYKIIISGESVGHIPGPIVVIEGYNA
KKIFYCSFKYRIPAYASNEYHENNIRIILWEQDRWFTDHECTKPVPRPVF
IELLRDVRFIFFRIKYFRKQSDFKMSMITMQEAIKTKYDYLWVPRLEKCN
CPSGYSGLSCETKTE*
>Pmo_019678 Pmo_019678
GVFNNEVVTWYRPPQFHIFTGNKLEIKQLTEFDFGTYYFSVGMTTKSVLL
VTKVILLPSEPEKREKTIDEDVLYLENVIPKAKDIRYRPGNVDGNSDIVT
WEQPPGTILLEHGRDAYFSAYSINQTELPFYYRINRNGDSSVNKVGKVFI
SEWKDREVEMSVEGRAAYGAEMKVNCFPSPDLGNDTEVIWKLDGKEIHRG
NTYIIKTFQKEVYGRYSCEIHSRGILIKSRIINLTPREGIESKIEMTLDP
GLYYNFHPDKTKELHCEIQREDGEWKFKSKDIIWTFNGRKIDVYNPLSAF
GNINRFGRLDTRSVSILVLRNMGEDNQGVYKCFQGPSTYAAILIMEQSEV
LIELSPPKLIVQHNSNHVAEFHCRIDTPGYNSSFIEWKFKEFNSTIEQDI
PPEATVEKPHQTSATSFITIKNSLKKHEGIYVCKVLGQQVSGILIVKTKQ
VLTVNPKEITVSPGGTARFFCQLSGIDGKVVWRRKDRKNFILNKENRKGG
STNSLLEVNHVTTADDGTIYECNFNELTESAILWVKDECALNQRKCKNET
CIDETKFCDGKDDCGDNSDEDPTRCKECIPNSIHCDFLNNSSPIKRCIVR
HWQCDGVDDCGNNFDELNCPVMNKDRCIGSHYLCGNGTLIPRAYWCDGEP
DCRSMEDEEGCSSSQVIEPSKLSHLSIIENSTLTLICQISGRPIPTITWR
YNWGYLPDSLNHNLTEVVTNCSMITSTLTINNIAPENSGIYTCEGIEKRR
IMAPDYAVTVTKGSVCKRPFFNNDAWDQEFCLRCYCSNVTDDCTSASGYI
TNPDLVESKVRSSDAAIMNYKTNDYHEPARSISFVDDNLKMYSINKTNYM
KYVIEDDFFLGGSFNMRGSWINRYGYPLTYKIVISGDSVGHISGPIVVIM
SNNEKKIYYCSWKYRISAYASDEYYENNIRIILWEQDRWFTDNACTTKVQ
RAEFLEILK
>Pmo_031777 laminin
MHIFIPLLVMVGYFTKSYESVFPHTRTVSIDLEKLKKEPFNIYFTCANIR
SKQDRVRYFRVQNGARGLIEKKKRFGIILSIKSESDLGQYECSVTAPDKT
VLNATLNTVDMKKMESPTKFVYDLSKTKYVIQKSGSVELDCGTSGNEVVT
WYKPTQYHIFTGSKLKIDSLTNFDYGTYYCAVGDTNKATLMVTKVILLPE
EPKQKEKKIDEDVMYIESFIPKSKSVRFKPIDVVDKSFAVTWEQPPGTVL
LEHARKLYFQSFSPDQTKIPFFYRITKNGDPSVNKVGKVYISDWTDKEVE
VTLEGAVQYGSDMTVNCFPAPELGNDTSVIWRLDEKIIHRGNTYTIKNFQ
KQFFGKYSCEIQQSGVKIISRVINLAPEQDLQAKIEMTPDPGNYYNFHMG
KNKELHCEILREDGNWKFNAKEIIWTLNGRKMDTENPSSPFSDPKRFGRL
DTRSVSILVLKNLGEDNKGTYKCFQGANVYAATLLLEQSDILVELSPPEQ
TAADNVNQVAEFHCRIDTPNYNSSLIKWSFIPENSDAEIPVPAEAIIEKP
VLTSSTSFVTIDNVLKRHEGNYVCRVKDRKVVGKLIVKSRPVLTVNPKEI
TVKPGGTARFLCQLTGIDGKVVWRRRDKKSFIENKESRLGGDSNSVLEIK
QATTADDGTVYECNFNKLTEFVTLWVKDECALNQRKCQNETCIDENKFCN
GVNDCGDNSDEDPKRCNECTPNSIHCDFLNGSNPIKRCVIKHWQCDGVDD
CGNNFDELNCPVKNKDKCLGSHYQCGNDTLIPRAYWCDGEADCKSMEDEE
GCTSPQVIEPVKTSQLSVVENSTLLIECQISGRPIPTITWRYNWGYLPDK
LDHNITDVVTNCSIITSTLRINNISPEQSGIYTCEGIAKRRVMAPDYSVT
VTKGSICKRPFYNNDAWYQELCIRCYCSNVTDDCTSANGYVINSDPIESK
VKASDAAIMNYKNNVYYEPARAVTFANESILMYVINKDDYKKLIPDDDHF
LGGSFNMRGSWINKYGFPLTYKLIISGESVGHISGPIVVMTGHSDKKIYY
CTQKYRIPAYASEDNYENNIRIILWEQDRWFIDDACTKSVTRSEFIEVLR
DVRLVLFRVKYFTKQTDFKMSKITMQEAVKSKYDHSWVSRVEKCNCPAGY
SGLSCEMKEN*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.