innexin, Pmo_028978 (mRNA) Phagocata morgani

Overview
Nameinnexin
Unique NamePmo_028978
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1572
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of innexin vs. uniprot
Match: gi|10720325|sp|O01393|UNC9_CAEEL (RecName: Full=Innexin unc-9; AltName: Full=Uncoordinated protein 9)

HSP 1 Score: 204.912 bits (520), Expect = 1.52083e-58
Identity = 127/371 (34.23%), Postives = 206/371 (55.53%), Query Frame = 2
Query:  137 EDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIY 1249
+D DKL++ + I++ ++V+ K Y P+ C+V T + + Y ENYCWV T + D +P N +A+ +N +I YYQWVPF+L L+ ++FY+P I+W+L+ + ++G ++ L+ A + + R + +A +E+ L G +L N + ++ G + Y+ +K LY +N+ GQ+ ++ FLG N S +G VL++++NGR W ++G FPRVT C E++ LG +++ QC L INM NEKI++FLWFW FL+ T S+ W S + +FV K+L + Y D Q L F+ FLR DGVFL+RM+ +AG+L ++ + LW Y
Sbjct: 21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHN---YAERENR-QIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKL-------LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG-NRS-KWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375
BLAST of innexin vs. uniprot
Match: gi|418153|sp|Q03412|UNC7_CAEEL (RecName: Full=Innexin unc-7; AltName: Full=Uncoordinated protein 7)

HSP 1 Score: 196.052 bits (497), Expect = 4.65307e-54
Identity = 124/372 (33.33%), Postives = 209/372 (56.18%), Query Frame = 2
Query:  137 EDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFL-MMKDNYTR--SDKQKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWE 1243
+DF DKL++ + ++ ++V+ K Y P+ C+V T + + Y ENYCWV T + + +P+ + + +I YYQWVPFIL ++ ++FY+P I+W+ + Y +G +L+ L+ A A + +T V +AR ++D + RQG R N+ +H G ++ + Y+ +K LY NV Q ++ LG N+ ++G+++L ++++ W QTG+FPRVT C E+R LG +++ QC L INM NEKI++FLWFW G+VT + W + M S FV+K+L ++ D+ + +D L F FLR DGVF++RMI +AG+L++++++ LW+
Sbjct: 139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHS---RSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSND--LAYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499
BLAST of innexin vs. uniprot
Match: gi|261260089|sp|A8WVX4|INX19_CAEBR (RecName: Full=Innexin-19)

HSP 1 Score: 189.119 bits (479), Expect = 3.22429e-52
Identity = 135/429 (31.47%), Postives = 225/429 (52.45%), Query Frame = 2
Query:  131 GVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKA-ANNSPKERTEVVDKLARTIEDML-FQHRDYR---QGKVAELRRKVYNMCNFCVFSKHM-GTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQK--------------------LNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRNFSPYSKMTDNDTVLRRGGR 1339
G +D D+L++ + L +++ +V++ K Y P+ C+V S + + Y+E+YCW+ T I + +P DD A+ + +I YYQWVPFIL + +MF +P I W+L C ++G +++ LIN A A A +R + V+ + D L Q + R +G +A ++ FS+ + G + + Y K LY +NV Q I+ L +E + FG+ VLS++ GR W +TG FPRVT C E+R+L N+Y QCAL IN++NEK++ FLW W ++ ++T S W S + +V KF+ + ++ QK L+ F+ +FL+ DG+ ++RMI +AGD+I +VR LW+ +Y++ ++R F + +M D + +G R
Sbjct: 19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREEK--QIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVF-FGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQ----EYRERNWREFEEHEEMKDVEMRRIQGTR 424
BLAST of innexin vs. uniprot
Match: gi|74959869|sp|O61715|INX19_CAEEL (RecName: Full=Innexin-19; AltName: Full=Neuronal symmetry protein 5; AltName: Full=Protein opu-19 [Caenorhabditis elegans])

HSP 1 Score: 183.341 bits (464), Expect = 5.53235e-50
Identity = 132/429 (30.77%), Postives = 223/429 (51.98%), Query Frame = 2
Query:  131 GVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKA-ANNSPKERTEVVDKLARTIEDML-FQHRDYR---QGKVAELRRKVYNMCNFCVFSKHM-GTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQK--------------------LNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRNFSPYSKMTDNDTVLRRGGR 1339
G +D D+L++ + L +++ +V++ K Y P+ C+V S + + Y+E+YCW+ T I + +P DD A+ + +I YYQWVPFIL + +MF +P I W+L C ++G +++ LIN A A +R + V+ + D L Q + R +G +A ++ FS+ + G L + + K LY +NV Q I+ L ++ + FG+ VL+++ GR W +TG FPRVT C E+R+L N+Y QCAL IN++NEK++ FLW W ++ ++T S W S + +V KF+ + ++ QK L+ F+ +FL+ DGV ++RMI +AGD+I +VR LW+ ++++ ++R F + +M D + GG
Sbjct: 35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVP--DDHTAREEK--QIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLF-FGFQVLNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQ----EFRERNWREFEEHEEMKDVEMRRIHGGE 440
BLAST of innexin vs. uniprot
Match: gi|12643734|sp|Q19746|INX3_CAEEL (RecName: Full=Innexin-3; AltName: Full=Protein opu-3)

HSP 1 Score: 182.185 bits (461), Expect = 7.8331e-50
Identity = 118/377 (31.30%), Postives = 197/377 (52.25%), Query Frame = 2
Query:  137 EDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQ 1267
+D D+LS++ + ++ ++V+ K Y + C++ G ++ Y E+YC++ T I ++P + ++ KA+ I YYQWVP +L +Q MFY+P IW + Y + G D +I+EA + + RT+ V+KL I D+L G+ R F K +G+ + Y+ +K +Y NVF Q I+ +FLG NE+ +G+ +++ GR W +G+FPRVT C +R L ++Y QC L INM NEKIY+F+WFW V + T I+ R++F S+R ++++ L N + +K + F L+ DGV L+R I +AG ++T +I L++ + Q
Sbjct: 21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG-NETFL-WGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQH 377
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000837 (Asxlregen_comp60104_c0_seq1|m.8709|m.29256)

HSP 1 Score: 646.351 bits (1666), Expect = 0
Identity = 309/440 (70.23%), Postives = 369/440 (83.86%), Query Frame = 2
Query:   74 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV* 1393
MVAEEF+ L+ + K+S YVG+EDFADKLSF+ SV + +S+MVVTIKSY FKPLACY AT P G NF+NYLENYCWVHGTI+ LPG+ +PQND +WA+AD+ RI YYQWVPFILGLQCIMFYIP+IIWQ+ICYNK+GT+LE ++N+A+ A N P ER + ++++ARTIEDMLFQHRDYRQG A+LRRKVYN CNFCVFSKHMGTWL+L Y+L+K LY +NV GQL IMK+FLGFN + SSFGYTVLSNMI+G+ WHQTGIFPRVTYCY+ I+H+G +NKYVAQCALP+NMLNEKIYVFLWFW+ LVG+VTAISIP+WF RMAFLS RS F+K+FLMM NY RSDK +N+FI EFLRHDGVFLVRM+FINAGD+ITADIV RL EIY Y+ +DFRN++ Y+K D L R SD+SI+KEP+ENFV*
Sbjct: 1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV* 440
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15000657 (Asxlregen_comp58174_c0_seq1|m.6943|m.8923)

HSP 1 Score: 536.184 bits (1380), Expect = 0
Identity = 248/410 (60.49%), Postives = 327/410 (79.76%), Query Frame = 2
Query:   74 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRNFSPYSKM 1303
MVA+EF+ L+D+ KLS Y G+EDFAD+L+F+ SV+ +S+S+++VT K+YFFKPL+CYVATTPSGMNFD Y+ENYCWVHGTI L +++P ++WA D D RITYYQWVPFILGLQCI+FYIP+++W++ICYNK GT+LE LI A+ ++ P ER V++ + R IED+L+QHRDYRQGK+A+ RR++Y CNFCVFSKH+GTWLV Y +KCLY INV GQL +MK FLGFN S+SSFGYT+L+++I+G+ WH+T FPRV+YCY +I+HLGA N YVAQC LP+NMLNEKIY+FLWFWV LVG++T +SI W +R+ FLS RS F KK L M +Y RS+ +NHFI E+LR+DG+FL+RMI+IN+GD++ A+I+ LWE Y +Y DF N++ Y K+
Sbjct: 1 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKL 410
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15036482 (dd_smedV4_10766_0_1|m.1746|m.10467)

HSP 1 Score: 399.053 bits (1024), Expect = 1.4016e-133
Identity = 192/423 (45.39%), Postives = 295/423 (69.74%), Query Frame = 2
Query:   74 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNE-SISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQK--LNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRNFSPYSKMTDNDTVLRRG 1333
MVA EF+ + KL++S VG+ED D+L+F SV+ + + I++VT+K Y FKP++CY+ G N +Y+EN CWV GTI++ K P D+EW + ++ YYQWVPF+LGLQCIMFY+P+++WQ+ICYN+TGTD++ L+ A++A ++S + R+++V L++T+E +L+QHRD+R GK+A+ RRK++N F + SK +GTWLV Y+L+K Y N F QL IM++FLGF++ ++ +FG V +N+ +G W T IFPRV+YC++ ++ HLG N VAQC LP+NMLNE+IY FLW W+ +V +T +SIP+W +R+ + R HF+++FL++ + T+ K+ L F +FLRHDG+FL++MI +NAGD+IT++IV +LW IY Y +F N + T+++ G
Sbjct: 1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKH-KMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFV-KVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLNDGSDEDDDKSRTMIKLG 421
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15028181 (SmedSxldir_c95046_g3_i1|m.36596|m.28)

HSP 1 Score: 388.267 bits (996), Expect = 2.17831e-129
Identity = 198/442 (44.80%), Postives = 279/442 (63.12%), Query Frame = 2
Query:   74 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRN--FSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV* 1393
MVA EF L+++L G+ED ADK+S + SVL +S+ + +VTIKSY KP++CY++ PSG NF +Y+ENYCW+HGTI + P KL N W + + +I YYQWVPFILGLQCIMFYIP++IWQ+ C+N+ GT+L+ +I + K A ER + +A+ IE+ML HRD+R K+A +RR VY+ C+ + SK +GT +V Y + K LY N GQL +++ LGF + +FG + +++G FPRV +CY+ IRH+G N YVAQC LP+NMLNEKIY FLW W+ LV T ISIP+W R+ R H++ FL M ++Y K ++ FI +FLRHDG+FL+RMI NAGDLI A +V LW+IYL +YQ + R FS + + +++ +S + PI N++*
Sbjct: 1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLRKDIFSVSNHLKEDEA----NNSTSNSQNLNQCSPIMNYL* 438
BLAST of innexin vs. Smed Unigenes AA
Match: SMU15033126 (SmedSxlregen_c82372_g1_i1|m.22383|m.8894)

HSP 1 Score: 386.341 bits (991), Expect = 2.85671e-128
Identity = 197/416 (47.36%), Postives = 281/416 (67.55%), Query Frame = 2
Query:   74 MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYFFKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKADNDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYXXXXXXXXXXXXXTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDKQK--LNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQIDFRNFSPYSKMTDND 1315
MVA +FI + K ++S Y GVEDFADK +F+ +V+ + + +VT+K Y KP++CY++T SG N Y+ENYCWV GTI I K+P ++EWA+ N +I YYQWVPF+L LQ IMFYIPR+IWQ+ CYN TGTD+ LI A++A ++S + RT++V+ +A+TIE ML+QHRD R G++A RR +Y +C FC+ SK GT L+ Y ++K LY N QL MK FLG NE+ FG+ ++ N+ING+ W T +FPRV YCY+ ++++G +N VAQC LP+NMLNEKI+ FLW W+F ++ ISI +W R + R F+ +FL + D++K + F +FLR+DGVFL++MI +NAGD++ ADIV +LW+I+ +QY RNF S +D+D
Sbjct: 1 MVAGQFIDYLTKFQVSNYAGVEDFADKFNFLFTVIVLLICTSIVTMKQYILKPISCYISTI-SGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAEL-NKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQHRDNRNGRLARFRRSLYKICCFCIMSKRQGTRLLCMYFIIKFLYLTNCILQLYFMKCFLGLNEAGIFFGFKIMKNIINGQDWKSTLVFPRVGYCYVN-VKNVGTTNALVAQCVLPVNMLNEKIFFFLWCWIFSSAILLTISIIIWIFRTSVYQRRRGFIYRFLKLNQQLKNCDEEKCMVVKFEHQFLRYDGVFLLKMISLNAGDIVAADIVCQLWKIFKSQYAN---RNF--LSDGSDDD 408
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|386764824|ref|NP_001245787.1| (shaking B, isoform G [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 5.87686e-16
Identity = 74/280 (26.43%), Postives = 118/280 (42.14%), Query Frame = 2
Query:  173 VLFISMSIMVVTIKSYFFKPLAC-YVATTPSGMNFDNYLENYCWVHGTISIL------PGDKLPQNDDEWAKADNDLRIT---YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 973
+L I+ SI VT + Y P+ C + P ++ L YCW+H T +++ G ++P ++ L I YYQWV F L Q I+FY PR +W+ + G + LI + + +++ + + D L+++ Y W Y + + L INV GQ+ +M RF F+ +FG V+ M + IFPR+T C + G K+ A C LP+N++NEKIY
Sbjct: 37 ILLITFSI-AVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQ-----KKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|386764826|ref|NP_001245788.1| (shaking B, isoform H [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 5.87686e-16
Identity = 74/280 (26.43%), Postives = 118/280 (42.14%), Query Frame = 2
Query:  173 VLFISMSIMVVTIKSYFFKPLAC-YVATTPSGMNFDNYLENYCWVHGTISIL------PGDKLPQNDDEWAKADNDLRIT---YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 973
+L I+ SI VT + Y P+ C + P ++ L YCW+H T +++ G ++P ++ L I YYQWV F L Q I+FY PR +W+ + G + LI + + +++ + + D L+++ Y W Y + + L INV GQ+ +M RF F+ +FG V+ M + IFPR+T C + G K+ A C LP+N++NEKIY
Sbjct: 37 ILLITFSI-AVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQ-----KKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|665392683|ref|NP_001285503.1| (shaking B, isoform I [Drosophila melanogaster])

HSP 1 Score: 80.4925 bits (197), Expect = 5.87686e-16
Identity = 74/280 (26.43%), Postives = 118/280 (42.14%), Query Frame = 2
Query:  173 VLFISMSIMVVTIKSYFFKPLAC-YVATTPSGMNFDNYLENYCWVHGTISIL------PGDKLPQNDDEWAKADNDLRIT---YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 973
+L I+ SI VT + Y P+ C + P ++ L YCW+H T +++ G ++P ++ L I YYQWV F L Q I+FY PR +W+ + G + LI + + +++ + + D L+++ Y W Y + + L INV GQ+ +M RF F+ +FG V+ M + IFPR+T C + G K+ A C LP+N++NEKIY
Sbjct: 37 ILLITFSI-AVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQ-----KKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|24643566|ref|NP_523425.2| (shaking B, isoform C [Drosophila melanogaster])

HSP 1 Score: 80.1073 bits (196), Expect = 5.98349e-16
Identity = 74/280 (26.43%), Postives = 118/280 (42.14%), Query Frame = 2
Query:  173 VLFISMSIMVVTIKSYFFKPLAC-YVATTPSGMNFDNYLENYCWVHGTISIL------PGDKLPQNDDEWAKADNDLRIT---YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 973
+L I+ SI V T + Y P+ C + P ++ L YCW+H T +++ G ++P ++ L I YYQWV F L Q I+FY PR +W+ + G + LI + + +++ + + D L+++ Y W Y + + L INV GQ+ +M RF F+ +FG V+ M + IFPR+T C + G K+ A C LP+N++NEKIY
Sbjct: 21 ILLITFSIAVTT-RQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQ-----KKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 258
BLAST of innexin vs. RefSeq Drosophila melanogaster
Match: gi|161077972|ref|NP_608410.2| (shaking B, isoform D [Drosophila melanogaster])

HSP 1 Score: 80.1073 bits (196), Expect = 1.50298e-15
Identity = 74/280 (26.43%), Postives = 118/280 (42.14%), Query Frame = 2
Query:  173 VLFISMSIMVVTIKSYFFKPLAC-YVATTPSGMNFDNYLENYCWVHGTISIL------PGDKLPQNDDEWAKADNDLRIT---YYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCVFSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLSNMINGRHWHQTG---IFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY 973
+L I+ SI VT + Y P+ C + P ++ L YCW+H T +++ G ++P ++ L I YYQWV F L Q I+FY PR +W+ + G + LI + + +++ + + D L+++ Y W Y + + L INV GQ+ +M RF F+ +FG V+ M + IFPR+T C + G K+ A C LP+N++NEKIY
Sbjct: 192 ILLITFSI-AVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIGICSEAEKKQKKK-----LLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 429
The following BLAST results are available for this feature:
BLAST of innexin vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|10720325|sp|O01393|UNC9_CAEEL1.520830e-5834.23RecName: Full=Innexin unc-9; AltName: Full=Uncoord... [more]
gi|418153|sp|Q03412|UNC7_CAEEL4.653070e-5433.33RecName: Full=Innexin unc-7; AltName: Full=Uncoord... [more]
gi|261260089|sp|A8WVX4|INX19_CAEBR3.224290e-5231.47RecName: Full=Innexin-19[more]
gi|74959869|sp|O61715|INX19_CAEEL5.532350e-5030.77RecName: Full=Innexin-19; AltName: Full=Neuronal s... [more]
gi|12643734|sp|Q19746|INX3_CAEEL7.833100e-5031.30RecName: Full=Innexin-3; AltName: Full=Protein opu... [more]
back to top
BLAST of innexin vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150008370.000000e+070.23Asxlregen_comp60104_c0_seq1|m.8709|m.29256[more]
SMU150006570.000000e+060.49Asxlregen_comp58174_c0_seq1|m.6943|m.8923[more]
SMU150364821.401600e-13345.39dd_smedV4_10766_0_1|m.1746|m.10467[more]
SMU150281812.178310e-12944.80SmedSxldir_c95046_g3_i1|m.36596|m.28[more]
SMU150331262.856710e-12847.36SmedSxlregen_c82372_g1_i1|m.22383|m.8894[more]
back to top
BLAST of innexin vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of innexin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|386764824|ref|NP_001245787.1|5.876860e-1626.43shaking B, isoform G [Drosophila melanogaster][more]
gi|386764826|ref|NP_001245788.1|5.876860e-1626.43shaking B, isoform H [Drosophila melanogaster][more]
gi|665392683|ref|NP_001285503.1|5.876860e-1626.43shaking B, isoform I [Drosophila melanogaster][more]
gi|24643566|ref|NP_523425.2|5.983490e-1626.43shaking B, isoform C [Drosophila melanogaster][more]
gi|161077972|ref|NP_608410.2|1.502980e-1526.43shaking B, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_028978 ID=Pmo_028978|Name=innexin|organism=Phagocata morgani|type=mRNA|length=1572bp
TCATGAAGCTAAGCTTATCTGCACAGTCAACAAACAATAAAGTTACGGCA
ACGATTATCACTCTCGGTTAACAATGGTCGCGGAAGAATTCATTGGACTT
GTGGACAAGTTGAAGTTGTCCAAGTATGTGGGGGTTGAGGACTTTGCAGA
TAAGCTTAGCTTCATGATGAGCGTGCTGTTCATCAGTATGTCCATTATGG
TGGTCACCATCAAGTCGTACTTCTTCAAGCCTCTGGCCTGCTATGTGGCC
ACAACCCCCAGCGGCATGAACTTCGATAACTACCTGGAGAACTATTGCTG
GGTGCACGGCACCATCTCCATCCTGCCTGGTGACAAGCTGCCACAGAACG
ATGATGAATGGGCCAAGGCGGACAACGACCTCAGAATAACGTACTACCAA
TGGGTGCCATTCATCCTCGGCCTCCAGTGCATCATGTTCTACATCCCGAG
GATCATCTGGCAACTGATCTGCTACAATAAGACAGGCACCGACCTCGAGT
TCCTCATCAACGAGGCCAGCAAGGCTGCCAACAACTCACCGAAGGAGCGC
ACGGAGGTCGTTGACAAATTGGCGCGCACCATCGAGGACATGCTCTTCCA
GCACCGGGACTACCGGCAGGGCAAGGTCGCGGAACTGCGCCGCAAGGTGT
ACAACATGTGCAACTTCTGCGTGTTCTCAAAGCACATGGGCACGTGGCTG
GTGCTGTGCTACATGCTGATGAAGTGTCTGTATTGCATCAACGTATTTGG
TCAGCTGACCATCATGAAACGGTTTCTGGGCTTCAACGAGTCCATCTCAT
CCTTTGGGTACACGGTGCTATCAAATATGATCAATGGGCGCCACTGGCAC
CAGACGGGCATCTTCCCAAGGGTCACTTACTGTTACATCGGGGAGATACG
CCACCTCGGGGCCAGCAATAAGTACGTGGCGCAGTGTGCCCTCCCAATCA
ATATGCTCAATGAGAAGATTTACGTCTTTCTTTGGTTTTGGGTGTTCCTG
GTTGGTGTTGTGACGGCCATCAGCATTCCCGTGTGGTTCATTCGTATGGC
ATTCCTGAGTAACAGGAGCCACTTCGTGAAGAAGTTCCTCATGATGAAGG
ACAACTACACGCGCTCCGATAAACAGAAGTTGAACCACTTCATTGGGGAG
TTCCTGCGTCACGACGGCGTGTTCCTGGTGAGGATGATCTTCATCAACGC
CGGTGATCTGATCACGGCGGACATCGTCCGGCGGCTCTGGGAGATATACC
TCGCTCAGTACCAGCAGATCGACTTTAGGAACTTCTCTCCGTACTCCAAG
ATGACCGACAACGATACCGTCCTCAGACGAGGGGGTCGAGCACCGGACTC
TGATGAGTCCATTGAGAAGGAACCGATAGAGAACTTTGTGTGACACCTCA
TCGACTTTGAATGCTCAATTTTTGATGATTTTTATGCTGATTTTTATGAC
TTTTATGAATTTATTTTATTTTAACTTTTAATAACTGACTCATCATAGGT
ATAATTGCACAGTGATTTGAGACATGGGCAATGATTTCAGCGCATGAATT
CTTTAATAAATTCTGACATCTT

Design Primers for innexin

back to top

protein sequence

>Pmo_028978-protein ID=Pmo_028978-protein|Name=innexin|organism=Phagocata morgani|type=polypeptide|length=440bp
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*
back to top

coding sequence

>Pmo_028978.74.1393 ID=Pmo_028978.74.1393|Name=Pmo_028978.74.1393|organism=Phagocata morgani|type=CDS|length=1320bp
ATGGTCGCGGAAGAATTCATTGGACTTGTGGACAAGTTGAAGTTGTCCAA
GTATGTGGGGGTTGAGGACTTTGCAGATAAGCTTAGCTTCATGATGAGCG
TGCTGTTCATCAGTATGTCCATTATGGTGGTCACCATCAAGTCGTACTTC
TTCAAGCCTCTGGCCTGCTATGTGGCCACAACCCCCAGCGGCATGAACTT
CGATAACTACCTGGAGAACTATTGCTGGGTGCACGGCACCATCTCCATCC
TGCCTGGTGACAAGCTGCCACAGAACGATGATGAATGGGCCAAGGCGGAC
AACGACCTCAGAATAACGTACTACCAATGGGTGCCATTCATCCTCGGCCT
CCAGTGCATCATGTTCTACATCCCGAGGATCATCTGGCAACTGATCTGCT
ACAATAAGACAGGCACCGACCTCGAGTTCCTCATCAACGAGGCCAGCAAG
GCTGCCAACAACTCACCGAAGGAGCGCACGGAGGTCGTTGACAAATTGGC
GCGCACCATCGAGGACATGCTCTTCCAGCACCGGGACTACCGGCAGGGCA
AGGTCGCGGAACTGCGCCGCAAGGTGTACAACATGTGCAACTTCTGCGTG
TTCTCAAAGCACATGGGCACGTGGCTGGTGCTGTGCTACATGCTGATGAA
GTGTCTGTATTGCATCAACGTATTTGGTCAGCTGACCATCATGAAACGGT
TTCTGGGCTTCAACGAGTCCATCTCATCCTTTGGGTACACGGTGCTATCA
AATATGATCAATGGGCGCCACTGGCACCAGACGGGCATCTTCCCAAGGGT
CACTTACTGTTACATCGGGGAGATACGCCACCTCGGGGCCAGCAATAAGT
ACGTGGCGCAGTGTGCCCTCCCAATCAATATGCTCAATGAGAAGATTTAC
GTCTTTCTTTGGTTTTGGGTGTTCCTGGTTGGTGTTGTGACGGCCATCAG
CATTCCCGTGTGGTTCATTCGTATGGCATTCCTGAGTAACAGGAGCCACT
TCGTGAAGAAGTTCCTCATGATGAAGGACAACTACACGCGCTCCGATAAA
CAGAAGTTGAACCACTTCATTGGGGAGTTCCTGCGTCACGACGGCGTGTT
CCTGGTGAGGATGATCTTCATCAACGCCGGTGATCTGATCACGGCGGACA
TCGTCCGGCGGCTCTGGGAGATATACCTCGCTCAGTACCAGCAGATCGAC
TTTAGGAACTTCTCTCCGTACTCCAAGATGACCGACAACGATACCGTCCT
CAGACGAGGGGGTCGAGCACCGGACTCTGATGAGTCCATTGAGAAGGAAC
CGATAGAGAACTTTGTGTGA
back to top
Gene Groups
innexin is similar in sequence to the genes of this group: GG525
Gene NameGene ID
SMU15000657SMU15000657
SMU15000837SMU15000837
Ddo_007492Ddo_007492
Ddo_008154Ddo_008154
Ddo_009563Ddo_009563
Ddo_012721Ddo_012721
Ddo_013304Ddo_013304
Ddo_024546Ddo_024546
Gsp_010768Gsp_010768
Gsp_020345Gsp_020345
Pgr_019273Pgr_019273
Pgr_021595Pgr_021595
Pmo_008579Pmo_008579
innexinPmo_028978

Gene Group Protein Sequences

>SMU15000657

MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
>SMU15000837
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
>Ddo_007492 Ddo_007492
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRVYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNDSISSFGYTVLS
NMINGRHWH
>Ddo_008154 Ddo_008154
MVAEEFLSLIGQFKLSTYVGVEDFADKLSFLFSVVILIISMMIVTVKSYF
FKPLACYIATVPSGSNFENYLENYCWVHGTITILPGEKIPQNDEAWTLLD
NTRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKVGTNLETLVTNANS
ANEIPPEERKAKVEGIARTIEDMLYQHRDYRHGKIADMRRQLFDKCNFCV
FSKHLGTWLVLSYMLMKFLYAINLIGQLYIMKSFLGFNSSMKTFGYTVLD
NIVQGKEWHESGIFPRVTYCHIGEIRHLGASNKYIAQCALPINMLNEKIY
IFLWFWVLLVFLITAISIPMWFFRIVFLSRRSSFIKKFLLMHETYDRSNK
QIMNNFIREFLRHDGVFLIRMIFINAGDIITADIVHRLFEIYKENYKDID
FRNFTAYSKPMSVGTALRRNPNISGSDESIKKQPLENFV*
>Ddo_009563 Ddo_009563
YCWVHGTISILPGENIPQTDSDWAIVDQNKRITYYQWVPFILGLQCIMFY
VPRVIWQLICYNKVGTNLESLAIDADAASHSPPAERKDKIERIVRTIEDM
LFQHRDYRQGKMADIRRNLFKMCNFCVFSKHMGTWLVLSYILMKFMYGIN
VIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIG
EIKHLGASNKYIGQCALPINMLNEKIYVFLWFWVFIVGIITAISIPLWFF
RIAILSRR
>Ddo_012721 Ddo_012721
MVAQEFLNLVGQYQLSTYVGLEDFADKLNFMFTVVFLILSMMIVTIKSYF
FKPLACYMSTTPSGSNFEAYMENYCWVHGTIPVLSNEILPQNPADWSVWD
KSRRITYYQWVPFILGLQCIMFYIPKIIWQIICFNKTGTNLESFIKTAND
ASHLPPEERKKSLERICRTIEDMLYKHRDYRQGKIANFRRTIYDFCNFCV
FSKHLGTWLVLSYFAIKGLYFLNVVGQLYILKSFLGFHNNSLIFGYTILS
NMINGQEWHKTGIFPRVSYCYNSEIKVIGASNAYIAQCALPINMLNEKIY
IFISLWIFFVGIITLISIGIWISRMMFLKKRADFIKEFLIMRDKYDGKEK
LLINQFITEFLRYDGIFLIYMFFINVGDLVTSEIVNILWDIYKNKYKDLD
FRNFNNYKKLTDQFPGKDDSNDRFV*
>Ddo_013304 Ddo_013304
DFADKLNFLFSVVILTISLMIVTVKSYFFQPLACYMATTPSGSNFNSYLE
NYCWVHGTIAILPGQKIPQDDAHWTEMDSAKRITYYQWIPFILGLQCIMF
YIPRVVWQLICYNKIGTNLESLVVDADSASQNPPQERKDKVERIARKIED
MLYQHRDYRQGKVADFRRKLYKSCNFCVFSKHLGTWLVLSYMLMKVLYGV
NVIGQLFLMKHFLGFNSSINSFGYTLLSNMLEGKEWQETGIFPRVTYCYV
GEIRHLGANNRYVAQCALPINMLNEKIYVFLWFWVLYNTQNQRNTYIFSF
NIFIGRAHCATYLLLAPKCLISPT*
>Ddo_024546 Ddo_024546
RITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASKAAN
SAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCVFSK
HMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLNNMV
NGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIYVFL
WFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDKQSL
DHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHIDFRN
FSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Gsp_010768 Gsp_010768
MVAEEFFSLIGEFKVSSYVGVEDFADKMNFLFSGVLIILSMMVVTVKSYF
FKPLACYTATTPSGVDFDKYMENYCWVHGTIPILPSENIPQSTSEWEVWD
ANKRITYYQWVPFILGLQFIMFYTPKIIWQIICYNKIGTNLENLVNGAEE
ASKQPPKDRKDILNKISRTIEDMLYQHRDYRQGKIASTRRAIYSYCNFCV
FSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFNSSLTYFGYTVLE
NMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNTYVSQCTLPINMLNEKIY
VFLWFWILLVGIITLISIFLWFIRMVFLSKRSDFIKKLLKMHQSYKRTDQ
LLVNQFIKEYLRHDGVFLVRMIYINAGDIVTAEILGTLWEIYKEKYIDLD
FRNFNNYKKLNNNSESNPDESCNNTLKNDSPDNFI*
>Gsp_020345 Gsp_020345
MVAQEFLSLIGQFKLTTYVGVEDFADKLNFLFSVVILIISMMVVTVKSYF
FKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDSDWAIVD
QNKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADA
ASHSPPAERKDKIERIVRTIEDMLFQHRDYRQGKMADIRRNLFKMCNFCV
FSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILS
NIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYIGQCALPINMLNEKIY
VFLWFWVFIVGIITAISIPLWFFRIAILSRRSKFIKKFLMMHQSYNRSDK
QLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKHMD
FLNFSAYPKSMDMTTGLRRNQNISSSDESIKKEHLDNFV*
>Pgr_019273 Pgr_019273
MVAEEFLNLVGQFKLSTYVGVEDFADKLSFLFSVVFILLSLMVVTIKSYF
FKPLACYIATNPSGLNFDNYLENYCWVHGTIALLPGEKIPQTPDGWSLAD
DKRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEGLINDASKA
SNSSPEERKGTVERLARMIEDMLFQHRDYRQGKMADLRRKVYGSCNFCVF
SKHLGTWLVLSYMIIKFLYCLNVIGQLFIMKKFLGFNESTISFGYDVLNN
ILNGREWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIYV
FLWFWVLLVGVCTVISIPTWFMRIAFLKSRSHFIKKFLAMSDNYERTDKP
LMNHFIREFLRHDGVFLIRMMYINAGDLITSDIVKRLWEIYKDQYRNIDF
RNFSGYSKPINIGNALKKGVTINDSNVSIAKENFL*
>Pgr_021595 Pgr_021595
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFLFSVLFLSVSIMVVTIKSYF
FKPLACYVATTPSGLNFDNYLENYCWVHGTISILPGEKLPQNDDEWAIAD
NDRRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANSAPEDRKGIVDKMARTIEDMLFQHRDYRQGKMADIRRRMYKMCNFCV
FSKHMGTWLVLCYFIMKCLYCVNVFGQLLIMKKFLGFNESITAFGYTVLN
NMVNGQHWHQTGIFPRVTYCYLGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVITAISIPVWFLRIALLSNRSHFVKKFLLMKDKYTRSDK
QSLDHFISEFLRHDGVFLIRMIFINAGDLITSDIVRRLWEIYIDQYKHID
FRNFSHYGKPDDVGTAIRRSGRQPDSNESIEKEPIEHFV*
>Pmo_008579 Pmo_008579
KLSFLFSVVILIISMMIVTVKSYFFKPLACYIATVPSGSNFENYLENYCW
VHGTITILPGEKIPQNDEGWAMLDNTRRITYYQWVPFILGLQCIMFYIPR
IIWQLICYNKVGTNLETLVANANSANEIPPAERKDKVEGIARTIEDMLYQ
HRDYRHGKIADMRRQLFEKCNFCVFSKHLGTWLVLSYMLMKFLYTFNLIS
QLYIMKSFLGFNSSMKTFGYTVLDNIVQGKEWHESGIFPRVTYCHIGEIR
HLGASN
>Pmo_028978 innexin
MVAEEFIGLVDKLKLSKYVGVEDFADKLSFMMSVLFISMSIMVVTIKSYF
FKPLACYVATTPSGMNFDNYLENYCWVHGTISILPGDKLPQNDDEWAKAD
NDLRITYYQWVPFILGLQCIMFYIPRIIWQLICYNKTGTDLEFLINEASK
AANNSPKERTEVVDKLARTIEDMLFQHRDYRQGKVAELRRKVYNMCNFCV
FSKHMGTWLVLCYMLMKCLYCINVFGQLTIMKRFLGFNESISSFGYTVLS
NMINGRHWHQTGIFPRVTYCYIGEIRHLGASNKYVAQCALPINMLNEKIY
VFLWFWVFLVGVVTAISIPVWFIRMAFLSNRSHFVKKFLMMKDNYTRSDK
QKLNHFIGEFLRHDGVFLVRMIFINAGDLITADIVRRLWEIYLAQYQQID
FRNFSPYSKMTDNDTVLRRGGRAPDSDESIEKEPIENFV*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.