piwi-1, Pmo_028279 (mRNA) Phagocata morgani

Overview
Namepiwi-1
Unique NamePmo_028279
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length2536
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of piwi-1 vs. uniprot
Match: gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD (RecName: Full=Piwi-like protein 1; AltName: Full=SMEDWI-1 [Schmidtea mediterranea])

HSP 1 Score: 1167.91 bits (3020), Expect = 0
Identity = 544/746 (72.92%), Postives = 647/746 (86.73%), Query Frame = 1
Query:  199 FFMYDVKMPPKSLRGKLDLLNSVASTKEN-RPFCFDGRRLFTSSQWHQ-EDIETISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2430
F+MYDV M KS+R KL+LL + A++K N +PFCFDGRRLFT+S+WH ED E + IKD E+SIR L +F++N+EEYYQM+NI+FNNIQ FMGQE+IGR FFLGSN + GPSFFK DNFKILGG++TT++RGTN +G+ASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITKYNNKTYRISDIKEMDVNDE++L KISY NYFKQRYNI L N KQPFVISR++R ++ KE ENEPE P E DQSLSIPGELC+LCGFSDSERSNINLQK+LG+VLKREPRERL DI DFC WT GK+ +MK+WG+ ++ QPITI GREL VD+FS + +IN K PDDWKFGE+KFD+PKG HRF +L V+R+PS FN FI+DVKREI RLR+NY+++++++CR+NE+ED LTDF+RV KVH+ALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQ+F+KLGYDPWGI LKM PTM+VGLDTFHSKTGKRS+QASVFSIS+KFSQY+SFVNS KGKNE+H+NL +NF+ A+ TF++KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K++E IYEN+ LPQIIY++VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+KT E + + LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG PP I+DRIRERLFYL
Sbjct: 63 FYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808

HSP 2 Score: 54.299 bits (129), Expect = 4.21718e-06
Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:   54 KRGGLQKRFYIIEPSLQPXXXXXXXXXXXXXXXLKSNYANFKLAMKGPFF 203
+RGGLQ+RF IIEP+LQPD V DK+GKDG+ V+LKSNYANF + ++GPF+
Sbjct: 15 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFY 64
BLAST of piwi-1 vs. uniprot
Match: gi|90101433|sp|Q2PC95|PIWIL_DUGJA (RecName: Full=Piwi-like protein [Dugesia japonica])

HSP 1 Score: 891.338 bits (2302), Expect = 0
Identity = 434/755 (57.48%), Postives = 563/755 (74.57%), Query Frame = 1
Query:  199 FFMYDVKMPPKSLRGKLDLLNSVASTKE-NRP--FCFDGRRLFTSSQWHQ-EDIETISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNES--TSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAAPFMKN-WGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQK--VHLALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENEN--LPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2430
+ MYD L KL L V KE N P FC+DGRRLFTS W + DI+ +I +++VS+R +++F+ +TEEYYQM+N++ NN+Q MGQE+IG+ +FLGSNSN+ GP+FF+ +NFK+LGGF TTL RGT +G +TLLY+ERINRVLN+NSV YN+ +D LIGRD++TKYNNKTYRIS+IKEM++N+ E+ G +SYA YFK+RYNI L +QPFV++R++++A + K + NE EAP++ D +L+I GELCFLCGFSD E+SNI+LQK+LG VLKR PRERL DI FC W + M N WG+++DN P+ I GREL DV SG QRIN K DDWKFG+V+F++ KG +H ++ V+R+ SQ+ F++DV+ EI +LR + I V C AN++E L D +R +ALVF+ DD+ YA+VK+FTISTGLLTQCVT RNGTNR+D+RR+VV+ K+VMQIF+K GYDPW I++KM PTM+VG+DTFH+K K+SI ASVFSI+S FSQY+SF NSPKGK E+HD LS NF AA+ FK + LP R ++YRDGVGDSQL FTK++E DA+ ++E IY+ +PQIIY+IVKKRI K F G+N NPGTIVD+++VKPNF+EF+LVSQR T+GTA+PTNYNVL DT+ N K G I +LQ ITY LTHLYFNWMGTIRVPVP HYAH+LAEL+G VH+G+ P +I++RIR RLFYL
Sbjct: 65 YIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818
BLAST of piwi-1 vs. uniprot
Match: gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD (RecName: Full=Piwi-like protein 2; AltName: Full=SMEDWI-2 [Schmidtea mediterranea])

HSP 1 Score: 868.996 bits (2244), Expect = 0
Identity = 428/763 (56.09%), Postives = 568/763 (74.44%), Query Frame = 1
Query:  199 FFMYDVKMPPKSLRGKLDLLNSVASTKENR---PFCFDGRRLFTSSQWHQE-DIETISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSN--SNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQK-------ENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAAPFMKN-WGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQK--VHLALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGKRSIQASVFSISSKFSQYLSF-VNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENEN--LPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 2430
F MYD L K+ L V +EN+ FCFDGRRLFTS +WH E DI+ S ++++++R +++ + TEEYYQM+N++ NN+Q +GQERIG+ +FL N +E GP+FF+ ++FK+LGGF TTL RGT G +TLLY+ERINRVLN+NSV YN+ +D LIGRD+ITKYNNKTYRIS+IKEM+V+++ E+ G +SYA YFK+RYNI L G QPFV++R+++ +++ +E E EAP+E D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI +C+W AA M N W +++DN+P+ I GREL DV SG +IN K DDWKFG V+FDI + +H ++ V+R+ Q+ F++DV++E+ +R++ + V TC N++E CL D R +ALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQIFAK GYDPW +E+K+ PTM+VG+DT+H+K+ K+SIQASVFSI+S F+QY+SF VNSPKG+ E+H+ L +NF A+ FK +++ LPQR +++RDGVGD+QL FTK +E DA+ ++E IY+ +PQIIY+IVKKR+ K F GNNPNPGT+VD+++VKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L +K G P+ +LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP I++RIR RLFYL
Sbjct: 72 FMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833
BLAST of piwi-1 vs. uniprot
Match: gi|33112431|sp|Q9VKM1|PIWI_DROME (RecName: Full=Protein piwi)

HSP 1 Score: 261.151 bits (666), Expect = 8.39003e-73
Identity = 201/732 (27.46%), Postives = 343/732 (46.86%), Query Frame = 1
Query:  292 FCFDGRRLFTSSQWHQEDIETISIKDE-----EVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF-CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWK--FGEVK-FDIPKGAQHRFAILAVERSPSQFNQFIDDVKREIS----RLR-----VNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKA--YARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENL--PQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2367
+ FDG +LFT+ ++ QE I +S K + ++SI+F+ + Q++N+I + E +GR F + +K FK ++ G+ T++ + LL E ++V+ ++Y+I + N LDL+ V+T YNN+TYRI+D+ G IS+ Y+ +YNI + + QP +IS+ R A++ A + + + ELC + G + RSN L +++ S + P++R + F + ++ +++W ++LD + GR + ++ ++ A DW+ F + + P R+A++A +R+ + +D + R S R+R + Y T RA ++DC+ L L + +D A Y+ +K + + TQ VT++ NR +A K +Q+ KLGY PW IEL + M +G D S + KR+ A + S+ + S Y S V + + L A+ ++ + LP R + YRDGV L ++E +++ ++T Y L PQ+ YI+V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT +PT+YNVL + + ++Q +TY + HLY+NW GT RVP YA +LA LVGT
Sbjct: 146 YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSIRQH-----EKDILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALK------------TNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRA--MDDCVRS-----DPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826
BLAST of piwi-1 vs. uniprot
Match: gi|226701015|sp|A6N7Y9|PIWL1_CHICK (RecName: Full=Piwi-like protein 1)

HSP 1 Score: 260.766 bits (665), Expect = 1.26057e-72
Identity = 207/749 (27.64%), Postives = 348/749 (46.46%), Query Frame = 1
Query:  298 FDGRRLFTSSQWHQEDIETISI----KDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSV----YNIYNKNQ--------LDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL---NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF--CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRI--NAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQK---------VHLALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFH-SKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
FDG LF + + E S +D ++I + Q NIIF + M ++IGR ++ N + S + GF +++ + S +L + +++L +V Y++Y + + LIG V+TKYNN+TYR+ DI + D N + +G++ISY +Y+K++YN +++ QP +IS+ RR ++ N P + IP ELC+L G ++ R++ N+ K L + P +R ++I C DE +++WG+ D+ ++ GR + + N + D + V I + ++ R+ N + ++ + + + + T+ E++D ++RV + V L DK A K + +QCV R T + + K +Q+ K+G + W +E+ + M+VG+D +H + +GK+SI V S++ K +++ S E D L A+ + LP R I+YRDGVGD QL YE L ++T+ ++ N P++ I+VKKR+S +FF NP PGT+VD +V +P +Y+F++VSQ G PT+YNV+ DT + + +Q +TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N ++SD RL+YL
Sbjct: 171 FDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYY---NPKDPVS------IPNHRLMVWPGFTSSILQY-----EESIMLCADVSHKILRSETVLDFMYSLYEQVEERRFRDACAKELIGVIVLTKYNNRTYRVDDI-DWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRR----KRGNVTVGP--------VVLIP-ELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDEC-VQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGIRMNKATMI-----EVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN-PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDT----------SKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPN-LLLSD----RLYYL 867
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15026177 (SmedSxldir_c80243_g1_i2|m.21809|m.41374)

HSP 1 Score: 1167.53 bits (3019), Expect = 0
Identity = 545/747 (72.96%), Postives = 648/747 (86.75%), Query Frame = 1
Query:  199 FFMYDVKMPPKSLRGKLDLLNSVASTKEN-RPFCFDGRRLFTSSQWHQ-EDIETISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2433
F+MYDV M KS+R KL+LL + A++K N +PFCFDGRRLFT+S+WH ED E + IKD E+SIR L +F++N+EEYYQM+NI+FNNIQ FMGQE+IGR FFLGSN + GPSFFK DNFKILGG++TT++RGTN +G+ASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITKYNNKTYRISDIKEMDVNDE++L KISY NYFKQRYNI L N KQPFVISR++R ++ KE ENEPE P E DQSLSIPGELC+LCGFSDSERSNINLQK+LG+VLKREPRERL DI DFC WT GK+ +MK+WG+ ++ QPITI GREL VD+FS + +IN K PDDWKFGE+KFD+PKG HRF +L V+R+PS FN FI+DVKREI RLR+NY+++++++CR+NE+ED LTDF+RV KVH+ALVFI DDK YA+VKNFT+STGLLTQCVT RNG+NRDDRRRK VADKSVMQ+F+KLGYDPWGI LKM PTM+VGLDTFHSKTGKRS+QASVFSIS+KFSQY+SFVNS KGKNE+H+NL +NF+ A+ TF++KFNT+P R IIYRDGVGDSQL FTKK+ETDAV+K++E IYEN+ LPQIIY++VKKRISVKFFKDG NPNPGT+VDEK+VKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN+KT E + + LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG PP I+DRIRERLFYL*
Sbjct: 106 FYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL* 852

HSP 2 Score: 53.9138 bits (128), Expect = 3.90872e-07
Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:   54 KRGGLQKRFYIIEPSLQPXXXXXXXXXXXXXXXLKSNYANFKLAMKGPFF 203
+RGGLQ+RF IIEP+LQPD V DK+GKDG+ V+LKSNYANF + ++GPF+
Sbjct: 58 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFY 107
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15015947 (SmedSxldir_c101456_g1_i1|m.49141|m.12333)

HSP 1 Score: 872.463 bits (2253), Expect = 0
Identity = 424/767 (55.28%), Postives = 567/767 (73.92%), Query Frame = 1
Query:  199 FFMYDVKMPPKSLRGKLDLLNSVASTKENR---PFCFDGRRLFTSSQWHQE-DIETISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSN--SNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEA-----------DQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAAPFMKN-WGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQK--VHLALVFIGDDKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENEN--LPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2433
F MYD L K+ L V +EN+ FCFDGRRLFTS +WH E DI+ S ++++++R +++ + TEEYYQM+N++ NN+Q +GQERIG+ +FL N +E GP+FF+ ++FK+LGGF TTL RGT G +TLLY+ERINRVLN+NSV YN+ +D LIGRD+ITKYNNKTYRIS+IKEM+V+++ E+ G +SYA YFK+RYNI L G QPFV++R+++ ++++ ++ E ++ D +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL DI +C+W AA M N W +++DN+P+ I GREL DV SG +IN K DDWKFG V+FDI + +H ++ V+R+ Q+ F++DV++E+ +R++ + V TC N++E CL D R +ALVF+ DD+ YA+VK+FT+STGLLTQCVT RNGTNR+D+RRKVV+ K+VMQIFAK GYDPW +E+K+ PTM+VG+DT+H+K+ K+SIQASVFSI+S F+QY+SFVNSPKG+ E+H+ L +NF A+ FK +++ LPQR +++RDGVGD+QL FTK +E DA+ ++E IY+ +PQIIY+IVKKR+ K F GNNPNPGT+VD+++VKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L +K G P+ +LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP I++RIR RLFYL*
Sbjct: 72 FMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL* 837
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15000111 (Asxlregen_comp31087_c0_seq1|m.709|m.20657)

HSP 1 Score: 248.054 bits (632), Expect = 4.99431e-69
Identity = 199/712 (27.95%), Postives = 341/712 (47.89%), Query Frame = 1
Query:  409 NTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIY--------NKNQL-----DLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLS--IPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCS--WTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQ-RINAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSP-SQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVR-----VQKVHLALVFIGDDKAYARVKNFT-ISTGLLTQCV---TVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDG-------NNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL* 2433
N E + N++F I+ + +IGR +F R +I G+ T++ N DG LL + ++V+ +SVY+I NK Q+ + L+G+ V+T +NN+ YRI+DI + E + G KISY +YFK Y + + + +QP ++S+ + + P+ KE D L IP ELC L G +D + L + L + P++R + + +F ++ E +A + WG+ ++ + I ++N ++ G + ++A ++K + G + IL +S ++ N + + + R+ V + + + E+ L + R VQ V L + +D+ Y +K F + + +Q V T++ G + VA +QI AKLG + W +++ + MVVGLD +H G+ RS+ A V S ++ +++ S + + E L ++ + + ++ N LP+ +YRDGV D QL + +K E + K+ E+ + + P ++Y +V+KRI+ + + NNPNPGTIVD V + N Y+F+LVSQ +GT TPT+Y VL D + Q+Q + Y H+Y+NW GT+RVP P YAH+LA +VG + ++ D RLFYL*
Sbjct: 306 NFSECPMVYNVLFKRIENSLRMVKIGRDYFYPEKK---------IVLDRRRMEIWPGYVTSIQ---NFDGG--LLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK-----SNSRSGKNRGPKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCE-EAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNS-----VAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFES-FSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL* 975
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15032988 (SmedSxlregen_c81582_g1_i1|m.21324|m.3914)

HSP 1 Score: 121.324 bits (303), Expect = 5.99621e-28
Identity = 114/451 (25.28%), Postives = 197/451 (43.68%), Query Frame = 1
Query: 1138 FMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQHRFAILAV--ERSPSQFNQFIDDVKREISRLRVNYSIETVAT-----CRANEIEDCLTDFVR-----VQKVHLALVFIGDDKAYARVKNF-TISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPT------------MVVGLDTFHSKTGK----RSIQASVFSISSKFSQYLSFVNSPKGKNEY--------HDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFF---------KDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLA 2352
F++N+ +++D + I + R L+G + G QR W KF P +A+ AV ER + ++ + D++ ++ N I + IE TD +R +K+ L + + +D+ Y VK F + G++TQC+ + T + ++++ KLG G+ ++ P MV G+D H + + +S+ A V S+ + + Y + + K E +++ N + +K P+R I YRDGV + Q K+E A+ + + E + P I YI+V+KR ++FF + GN P+ GT+VD+ + ++FYL S +GT+ P +Y+VL D N + E LQ TY L H+Y ++ P PT+YAH A
Sbjct: 540 FLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCM--KYATLNRQKFLDQYLGNIMLKVNGKLG----GVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTF--YKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPS-GTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAHLAA 970
BLAST of piwi-1 vs. Smed Unigenes AA
Match: SMU15015027 (SmedAsxldir_c97534_g1_i3|m.40524|m.26292)

HSP 1 Score: 105.531 bits (262), Expect = 3.10129e-26
Identity = 49/73 (67.12%), Postives = 57/73 (78.08%), Query Frame = 1
Query:  778 MDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCF 996
MDVNDE++L KISY NYFKQRYNI L N +QPFVISR++R ++QKE ENEPE P E DQSLSI GEL +
Sbjct: 1 MDVNDEVQLGDKKISYLNYFKQRYNINLKNDRQPFVISRVKRSVVRQKEKIENEPEGPTETDQSLSISGELGY 73
BLAST of piwi-1 vs. RefSeq Human
Match: gi|66346725|ref|NP_004755.2| (piwi-like protein 1 isoform 1 [Homo sapiens])

HSP 1 Score: 257.299 bits (656), Expect = 7.12976e-72
Identity = 207/748 (27.67%), Postives = 345/748 (46.12%), Query Frame = 1
Query:  298 FDGRRLFTSSQWHQEDIETISI----KDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKYNNKTYRISDIKEMDVNDEI---ELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEG-KAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRI--NAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRV--QKV----HLALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
FDG LF + Q+ E S +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + NS +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + D N + + +G+++S+ Y++++YN + + KQP ++S Q K + P A + IP ELC+L G +D R++ N+ K L + P +R +++ + + +++WG+ D+ ++ GR L + G + N + D K I + ++ R+ N I ++ + + + + E++D ++RV QKV + + + DK A K +QCV R T + +A K +Q+ K+G + W +++ + M+VG+D +H T G+RSI V SI+ +++ S E D L AA+ + +P R I+YRDGVGD QL YE L +++I N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + +Q +TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 163 FDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVS-------QPKRRRGPGGTLPGPA---MLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|530401794|ref|XP_005253689.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 257.299 bits (656), Expect = 7.12976e-72
Identity = 207/748 (27.67%), Postives = 345/748 (46.12%), Query Frame = 1
Query:  298 FDGRRLFTSSQWHQEDIETISI----KDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKYNNKTYRISDIKEMDVNDEI---ELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEG-KAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRI--NAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRV--QKV----HLALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
FDG LF + Q+ E S +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + NS +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + D N + + +G+++S+ Y++++YN + + KQP ++S Q K + P A + IP ELC+L G +D R++ N+ K L + P +R +++ + + +++WG+ D+ ++ GR L + G + N + D K I + ++ R+ N I ++ + + + + E++D ++RV QKV + + + DK A K +QCV R T + +A K +Q+ K+G + W +++ + M+VG+D +H T G+RSI V SI+ +++ S E D L AA+ + +P R I+YRDGVGD QL YE L +++I N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + +Q +TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 163 FDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVS-------QPKRRRGPGGTLPGPA---MLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|578824471|ref|XP_006719761.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 257.299 bits (656), Expect = 7.12976e-72
Identity = 207/748 (27.67%), Postives = 345/748 (46.12%), Query Frame = 1
Query:  298 FDGRRLFTSSQWHQEDIETISI----KDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKYNNKTYRISDIKEMDVNDEI---ELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEG-KAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRI--NAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRV--QKV----HLALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
FDG LF + Q+ E S +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + NS +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + D N + + +G+++S+ Y++++YN + + KQP ++S Q K + P A + IP ELC+L G +D R++ N+ K L + P +R +++ + + +++WG+ D+ ++ GR L + G + N + D K I + ++ R+ N I ++ + + + + E++D ++RV QKV + + + DK A K +QCV R T + +A K +Q+ K+G + W +++ + M+VG+D +H T G+RSI V SI+ +++ S E D L AA+ + +P R I+YRDGVGD QL YE L +++I N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + +Q +TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 163 FDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVS-------QPKRRRGPGGTLPGPA---MLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975969|ref|XP_011537304.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 257.299 bits (656), Expect = 7.12976e-72
Identity = 207/748 (27.67%), Postives = 345/748 (46.12%), Query Frame = 1
Query:  298 FDGRRLFTSSQWHQEDIETISI----KDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKYNNKTYRISDIKEMDVNDEI---ELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEG-KAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRI--NAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRV--QKV----HLALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
FDG LF + Q+ E S +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + NS +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + D N + + +G+++S+ Y++++YN + + KQP ++S Q K + P A + IP ELC+L G +D R++ N+ K L + P +R +++ + + +++WG+ D+ ++ GR L + G + N + D K I + ++ R+ N I ++ + + + + E++D ++RV QKV + + + DK A K +QCV R T + +A K +Q+ K+G + W +++ + M+VG+D +H T G+RSI V SI+ +++ S E D L AA+ + +P R I+YRDGVGD QL YE L +++I N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + +Q +TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 163 FDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVS-------QPKRRRGPGGTLPGPA---MLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Human
Match: gi|767975971|ref|XP_011537305.1| (PREDICTED: piwi-like protein 1 isoform X2 [Homo sapiens])

HSP 1 Score: 257.299 bits (656), Expect = 7.12976e-72
Identity = 207/748 (27.67%), Postives = 345/748 (46.12%), Query Frame = 1
Query:  298 FDGRRLFTSSQWHQEDIETISI----KDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSV----YNIYNKNQLDL--------LIGRDVITKYNNKTYRISDIKEMDVNDEI---ELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEG-KAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRI--NAKSPDDWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRV--QKV----HLALVFIGD---DKAYARVKNFTISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKT-GKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
FDG LF + Q+ E S +D ++I + Q NIIF + M ++IGR ++ N N+ P I GF T++ + NS +L + ++VL +V +N Y++ + LIG V+TKYNNKTYR+ DI + D N + + +G+++S+ Y++++YN + + KQP ++S Q K + P A + IP ELC+L G +D R++ N+ K L + P +R +++ + + +++WG+ D+ ++ GR L + G + N + D K I + ++ R+ N I ++ + + + + E++D ++RV QKV + + + DK A K +QCV R T + +A K +Q+ K+G + W +++ + M+VG+D +H T G+RSI V SI+ +++ S E D L AA+ + +P R I+YRDGVGD QL YE L +++I N P++ I+VKKR++ +FF NP PGT++D +V +P +Y+F++VSQ G+ +PT+YNV+ D + + +Q +TY L H+Y+NW G IRVP P YAH+LA LVG ++HR N + RL+YL
Sbjct: 163 FDGTILFLPKRLQQKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY---NPND------PIDIPSHRLVIWPGFTTSILQYENS-----IMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVS-------QPKRRRGPGGTLPGPA---MLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----EVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNL-----SLSNRLYYL 861
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|17136736|ref|NP_476875.1| (piwi, isoform A [Drosophila melanogaster])

HSP 1 Score: 261.151 bits (666), Expect = 9.68504e-74
Identity = 201/732 (27.46%), Postives = 343/732 (46.86%), Query Frame = 1
Query:  292 FCFDGRRLFTSSQWHQEDIETISIKDE-----EVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF-CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWK--FGEVK-FDIPKGAQHRFAILAVERSPSQFNQFIDDVKREIS----RLR-----VNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKA--YARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENL--PQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2367
+ FDG +LFT+ ++ QE I +S K + ++SI+F+ + Q++N+I + E +GR F + +K FK ++ G+ T++ + LL E ++V+ ++Y+I + N LDL+ V+T YNN+TYRI+D+ G IS+ Y+ +YNI + + QP +IS+ R A++ A + + + ELC + G + RSN L +++ S + P++R + F + ++ +++W ++LD + GR + ++ ++ A DW+ F + + P R+A++A +R+ + +D + R S R+R + Y T RA ++DC+ L L + +D A Y+ +K + + TQ VT++ NR +A K +Q+ KLGY PW IEL + M +G D S + KR+ A + S+ + S Y S V + + L A+ ++ + LP R + YRDGV L ++E +++ ++T Y L PQ+ YI+V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT +PT+YNVL + + ++Q +TY + HLY+NW GT RVP YA +LA LVGT
Sbjct: 146 YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSIRQH-----EKDILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALK------------TNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRA--MDDCVRS-----DPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|665407544|ref|NP_001285825.1| (piwi, isoform B [Drosophila melanogaster])

HSP 1 Score: 261.151 bits (666), Expect = 9.68504e-74
Identity = 201/732 (27.46%), Postives = 343/732 (46.86%), Query Frame = 1
Query:  292 FCFDGRRLFTSSQWHQEDIETISIKDE-----EVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNIYNK--------------NQLDLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF-CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWK--FGEVK-FDIPKGAQHRFAILAVERSPSQFNQFIDDVKREIS----RLR-----VNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKA--YARVKNFT-ISTGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHS-KTGKRSIQASVFSIS-SKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENL--PQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGT 2367
+ FDG +LFT+ ++ QE I +S K + ++SI+F+ + Q++N+I + E +GR F + +K FK ++ G+ T++ + LL E ++V+ ++Y+I + N LDL+ V+T YNN+TYRI+D+ G IS+ Y+ +YNI + + QP +IS+ R A++ A + + + ELC + G + RSN L +++ S + P++R + F + ++ +++W ++LD + GR + ++ ++ A DW+ F + + P R+A++A +R+ + +D + R S R+R + Y T RA ++DC+ L L + +D A Y+ +K + + TQ VT++ NR +A K +Q+ KLGY PW IEL + M +G D S + KR+ A + S+ + S Y S V + + L A+ ++ + LP R + YRDGV L ++E +++ ++T Y L PQ+ YI+V + ++ +FF +G NP PGTIVD+ + P Y+FYLVSQ+ +GT +PT+YNVL + + ++Q +TY + HLY+NW GT RVP YA +LA LVGT
Sbjct: 146 YLFDGLQLFTTRKFEQE-ITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF------DPRAKIEIREFK---MELWPGYETSIRQH-----EKDILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLI----VLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALK------------TNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRA--MDDCVRS-----DPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMS---IATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSM----------GLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGT 826
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513719|ref|NP_001036627.2| (argonaute 3, isoform D [Drosophila melanogaster])

HSP 1 Score: 246.514 bits (628), Expect = 1.17383e-68
Identity = 205/775 (26.45%), Postives = 352/775 (45.42%), Query Frame = 1
Query:  202 FMYDVKM--PPKSLRGKLDLLNS----VASTKENRPFCFDGRRLFTSSQWHQEDIETIS-IKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAA-PFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQ-HRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFI----GDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
F Y+V+ P S+ ++ LN + TK FDG L+ + IS +D E+ IR L E Q+ NI+F+ + + + R F S P ++ G+ T + + +L + +R+L + +V + Y ++ +L+G V+T+YNN+TY+I+DI + + + E+ SY Y+KQ +NI + + QP + S + I A +E Q IP ELC+L G D RS+ L + + + + P +R ++ F AA + +WG+ L N I GR+++ ++ + ++A ++ V ++ K ++ I+ + +D++K+ L +N S T+ + + I+ + R ++ +V D YA +K S + +Q + + N + V K V+Q+ KLG W +++ M+ G+D++H + + S+ A V SI+S +SQ+ S + E + LS +F A+ ++ + LP IIYRDG+GD QLY YE + E + N +I YI+V+KRI+ + F NP PGT+VD+ + K N Y+F+LVSQ +GT TPT+Y VL D +Q ++Y L LY+NW GT+R+P YAH+LA L+G ++ R +++ + E+LFYL
Sbjct: 146 FNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513722|ref|NP_001036629.2| (argonaute 3, isoform E [Drosophila melanogaster])

HSP 1 Score: 246.514 bits (628), Expect = 1.17383e-68
Identity = 205/775 (26.45%), Postives = 352/775 (45.42%), Query Frame = 1
Query:  202 FMYDVKM--PPKSLRGKLDLLNS----VASTKENRPFCFDGRRLFTSSQWHQEDIETIS-IKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAA-PFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQ-HRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFI----GDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
F Y+V+ P S+ ++ LN + TK FDG L+ + IS +D E+ IR L E Q+ NI+F+ + + + R F S P ++ G+ T + + +L + +R+L + +V + Y ++ +L+G V+T+YNN+TY+I+DI + + + E+ SY Y+KQ +NI + + QP + S + I A +E Q IP ELC+L G D RS+ L + + + + P +R ++ F AA + +WG+ L N I GR+++ ++ + ++A ++ V ++ K ++ I+ + +D++K+ L +N S T+ + + I+ + R ++ +V D YA +K S + +Q + + N + V K V+Q+ KLG W +++ M+ G+D++H + + S+ A V SI+S +SQ+ S + E + LS +F A+ ++ + LP IIYRDG+GD QLY YE + E + N +I YI+V+KRI+ + F NP PGT+VD+ + K N Y+F+LVSQ +GT TPT+Y VL D +Q ++Y L LY+NW GT+R+P YAH+LA L+G ++ R +++ + E+LFYL
Sbjct: 146 FNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Match: gi|221513725|ref|NP_001036628.2| (argonaute 3, isoform F [Drosophila melanogaster])

HSP 1 Score: 246.514 bits (628), Expect = 1.17383e-68
Identity = 205/775 (26.45%), Postives = 352/775 (45.42%), Query Frame = 1
Query:  202 FMYDVKM--PPKSLRGKLDLLNS----VASTKENRPFCFDGRRLFTSSQWHQEDIETIS-IKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLGSNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERINRVLNENSVYNI-----------YNKNQLDLLIGRDVITKYNNKTYRISDIK-EMDVNDEIELNGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDFCSWTDEGKAA-PFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPDDWKFGEVKFDIPKGAQ-HRFAILAVERSPSQFNQFIDDVKREISRLRVNYSIETVATCRANEIEDCLTDFVRVQKVHLALVFI----GDDKAYARVKNFTIS-TGLLTQCVTVRNGTNXXXXXXKVVADKSVMQIFAKLGYDPWGIELKMVPTMVVGLDTFHSKTGK-RSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFIAAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYENENLPQIIYIIVKKRISVKFFKDGN----NPNPGTIVDEKVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVG-TVHRGTNPPVISDRIRERLFYL 2430
F Y+V+ P S+ ++ LN + TK FDG L+ + IS +D E+ IR L E Q+ NI+F+ + + + R F S P ++ G+ T + + +L + +R+L + +V + Y ++ +L+G V+T+YNN+TY+I+DI + + + E+ SY Y+KQ +NI + + QP + S + I A +E Q IP ELC+L G D RS+ L + + + + P +R ++ F AA + +WG+ L N I GR+++ ++ + ++A ++ V ++ K ++ I+ + +D++K+ L +N S T+ + + I+ + R ++ +V D YA +K S + +Q + + N + V K V+Q+ KLG W +++ M+ G+D++H + + S+ A V SI+S +SQ+ S + E + LS +F A+ ++ + LP IIYRDG+GD QLY YE + E + N +I YI+V+KRI+ + F NP PGT+VD+ + K N Y+F+LVSQ +GT TPT+Y VL D +Q ++Y L LY+NW GT+R+P YAH+LA L+G ++ R +++ + E+LFYL
Sbjct: 146 FNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKT-----FDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAVD-----EYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGI----------PAERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQNDLKI--RSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNR--IKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRD----------DCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRD-----VAEALSEKLFYL 867
The following BLAST results are available for this feature:
BLAST of piwi-1 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|90101431|sp|Q2Q5Y9|PIWI1_SCHMD4.217180e-672.92RecName: Full=Piwi-like protein 1; AltName: Full=S... [more]
gi|90101433|sp|Q2PC95|PIWIL_DUGJA0.000000e+057.48RecName: Full=Piwi-like protein [Dugesia japonica][more]
gi|90101432|sp|Q2Q5Y8|PIWI2_SCHMD0.000000e+056.09RecName: Full=Piwi-like protein 2; AltName: Full=S... [more]
gi|33112431|sp|Q9VKM1|PIWI_DROME8.390030e-7327.46RecName: Full=Protein piwi[more]
gi|226701015|sp|A6N7Y9|PIWL1_CHICK1.260570e-7227.64RecName: Full=Piwi-like protein 1[more]
back to top
BLAST of piwi-1 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150261773.908720e-772.96SmedSxldir_c80243_g1_i2|m.21809|m.41374[more]
SMU150159470.000000e+055.28SmedSxldir_c101456_g1_i1|m.49141|m.12333[more]
SMU150001114.994310e-6927.95Asxlregen_comp31087_c0_seq1|m.709|m.20657[more]
SMU150329885.996210e-2825.28SmedSxlregen_c81582_g1_i1|m.21324|m.3914[more]
SMU150150273.101290e-2667.12SmedAsxldir_c97534_g1_i3|m.40524|m.26292[more]
back to top
BLAST of piwi-1 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|66346725|ref|NP_004755.2|7.129760e-7227.67piwi-like protein 1 isoform 1 [Homo sapiens][more]
gi|530401794|ref|XP_005253689.1|7.129760e-7227.67PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|578824471|ref|XP_006719761.1|7.129760e-7227.67PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975969|ref|XP_011537304.1|7.129760e-7227.67PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
gi|767975971|ref|XP_011537305.1|7.129760e-7227.67PREDICTED: piwi-like protein 1 isoform X2 [Homo sa... [more]
back to top
BLAST of piwi-1 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136736|ref|NP_476875.1|9.685040e-7427.46piwi, isoform A [Drosophila melanogaster][more]
gi|665407544|ref|NP_001285825.1|9.685040e-7427.46piwi, isoform B [Drosophila melanogaster][more]
gi|221513719|ref|NP_001036627.2|1.173830e-6826.45argonaute 3, isoform D [Drosophila melanogaster][more]
gi|221513722|ref|NP_001036629.2|1.173830e-6826.45argonaute 3, isoform E [Drosophila melanogaster][more]
gi|221513725|ref|NP_001036628.2|1.173830e-6826.45argonaute 3, isoform F [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_028279 ID=Pmo_028279|Name=piwi-1|organism=Phagocata morgani|type=mRNA|length=2536bp
TTGCATATTTTTCTTAACTTTAATATTTAGACATGGAAGAAAAGAAGACA
TTTAAGAGAGGAGGACTTCAAAAGAGATTTTATATCATCGAACCTTCACT
TCAACCTGATGGCGTCAAAGACAAAGTTGGAAAGGATGGAAAAGCTGTTG
CTTTAAAATCGAATTATGCTAATTTTAAATTGGCAATGAAAGGTCCTTTT
TTTTATGTATGACGTCAAGATGCCACCGAAGAGTTTAAGAGGGAAGTTGG
ACTTATTAAACAGCGTCGCTTCAACGAAAGAAAATCGGCCATTTTGTTTC
GATGGTCGCCGTCTTTTTACATCTTCACAGTGGCACCAAGAAGATATAGA
AACAATTTCGATAAAAGATGAAGAAGTATCAATTCGTTTTTTAGCCTCAT
TTGTGGAAAATACCGAAGAATATTATCAAATGGTTAACATAATCTTCAAT
AACATTCAAGCGTTCATGGGACAAGAACGAATTGGTAGAGCTTTTTTCTT
GGGTTCGAATAGTAATGAATCTACATCCAAATGTGGGCCATCTTTTTTCA
AAAGAGATAATTTTAAAATATTGGGCGGTTTTGCTACAACATTGTCAAGA
GGAACTAATTCCGATGGAAGTGCTTCAACTTTACTTTATTTAGAGCGCAT
TAATCGAGTATTGAATGAAAATTCAGTTTATAATATTTATAATAAAAATC
AATTGGATCTGTTGATTGGAAGAGATGTTATAACCAAATATAATAACAAA
ACATACAGAATTTCCGATATTAAGGAGATGGATGTTAATGACGAAATAGA
ATTAAATGGTACAAAGATTTCATATGCCAATTATTTTAAGCAAAGATACA
ACATAACGCTTAATAATGGAAAGCAACCATTTGTCATATCAAGATTGAGA
AGAGTGGCTATTCAACAAAAAGAAAATCAAGAAAATGAACCCGAGGCACC
AAAGGAAGCTGATCAAAGTTTATCTATTCCTGGCGAATTGTGCTTTTTGT
GTGGCTTTTCGGATAGTGAGAGATCGAACATTAATTTGCAAAAGAGCCTA
GGATCAGTTCTTAAAAGAGAACCACGAGAACGATTAAAAGATATTAGTGA
TTTTTGTAGTTGGACTGATGAAGGCAAGGCGGCTCCATTTATGAAAAATT
GGGGAGTTCAATTAGATAATCAACCAATAACAATTATGGGGCGAGAACTA
AATGGGGTTGATGTATTTTCTGGGCAACAACGTATTAATGCCAAATCTCC
AGATGATTGGAAATTCGGTGAAGTTAAATTTGATATTCCAAAGGGTGCTC
AGCATCGTTTTGCTATTTTAGCCGTCGAAAGAAGTCCTAGTCAATTCAAT
CAATTTATAGATGATGTTAAGCGTGAAATAAGTAGGCTAAGAGTTAATTA
TTCAATAGAGACTGTGGCAACTTGCAGAGCAAATGAAATTGAAGATTGCT
TAACAGATTTTGTTAGAGTTCAAAAGGTTCATTTGGCTTTGGTTTTTATT
GGTGACGATAAGGCATATGCTCGTGTAAAGAACTTTACGATAAGCACTGG
ATTATTAACCCAGTGCGTGACTGTAAGAAATGGGACAAATAGAGATGATC
GTCGTAGAAAAGTTGTGGCTGATAAAAGTGTTATGCAAATTTTTGCTAAA
TTGGGTTACGATCCATGGGGAATTGAGTTAAAAATGGTACCGACGATGGT
TGTTGGTTTGGACACTTTTCATAGCAAGACTGGAAAGCGATCAATTCAAG
CATCTGTATTCAGTATCAGTTCGAAATTTTCTCAATATTTGAGTTTTGTA
AATTCACCAAAAGGCAAGAATGAATATCATGATAATTTGAGTCAAAATTT
CATCGCAGCCATAAATACATTTAAAGATAAATTTAACACTTTGCCACAAA
GGTTTATTATTTATCGAGACGGTGTTGGAGATTCTCAATTGTATTTCACT
AAAAAGTACGAAACTGATGCTGTTTTAAAAATTATGGAAACAATTTACGA
AAATGAAAATTTGCCCCAAATAATTTATATAATTGTTAAAAAGAGAATAA
GTGTCAAGTTTTTTAAAGATGGTAATAATCCTAATCCCGGAACGATCGTA
GATGAGAAGGTTGTCAAACCGAACTTTTATGAATTTTATTTAGTTTCACA
GAGAACGACGAAGGGTACTGCAACTCCGACAAATTATAACGTATTGATGG
ACACTCAATTGACTAATCGTAAAACTGGCGAGAAGGCTCCTATTCCTGCG
GGTCAATTGCAGCATATTACGTATGCTTTGACTCATCTTTACTTTAACTG
GATGGGAACTATTCGGGTTCCTGTGCCAACGCATTACGCACATCGATTAG
CTGAACTTGTTGGAACTGTTCATCGTGGAACCAATCCTCCGGTAATTTCT
GATCGTATTAGGGAACGTCTGTTCTATCTTTGAACAGCTTGTATTTGTCT
CATTGTTGTCTAATCAATATATTTGTAGCTTTATATCTAGTCCCGTGTAC
TTTTTATAAATATAAATATTTGTTTTTAAAAAAAAA

Design Primers for piwi-1

back to top

protein sequence

>Pmo_028279-protein ID=Pmo_028279-protein|Name=piwi-1|organism=Phagocata morgani|type=polypeptide|length=743bp
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
back to top

coding sequence

>Pmo_028279.205.2433 ID=Pmo_028279.205.2433|Name=Pmo_028279.205.2433|organism=Phagocata morgani|type=CDS|length=2229bp
ATGTATGACGTCAAGATGCCACCGAAGAGTTTAAGAGGGAAGTTGGACTT
ATTAAACAGCGTCGCTTCAACGAAAGAAAATCGGCCATTTTGTTTCGATG
GTCGCCGTCTTTTTACATCTTCACAGTGGCACCAAGAAGATATAGAAACA
ATTTCGATAAAAGATGAAGAAGTATCAATTCGTTTTTTAGCCTCATTTGT
GGAAAATACCGAAGAATATTATCAAATGGTTAACATAATCTTCAATAACA
TTCAAGCGTTCATGGGACAAGAACGAATTGGTAGAGCTTTTTTCTTGGGT
TCGAATAGTAATGAATCTACATCCAAATGTGGGCCATCTTTTTTCAAAAG
AGATAATTTTAAAATATTGGGCGGTTTTGCTACAACATTGTCAAGAGGAA
CTAATTCCGATGGAAGTGCTTCAACTTTACTTTATTTAGAGCGCATTAAT
CGAGTATTGAATGAAAATTCAGTTTATAATATTTATAATAAAAATCAATT
GGATCTGTTGATTGGAAGAGATGTTATAACCAAATATAATAACAAAACAT
ACAGAATTTCCGATATTAAGGAGATGGATGTTAATGACGAAATAGAATTA
AATGGTACAAAGATTTCATATGCCAATTATTTTAAGCAAAGATACAACAT
AACGCTTAATAATGGAAAGCAACCATTTGTCATATCAAGATTGAGAAGAG
TGGCTATTCAACAAAAAGAAAATCAAGAAAATGAACCCGAGGCACCAAAG
GAAGCTGATCAAAGTTTATCTATTCCTGGCGAATTGTGCTTTTTGTGTGG
CTTTTCGGATAGTGAGAGATCGAACATTAATTTGCAAAAGAGCCTAGGAT
CAGTTCTTAAAAGAGAACCACGAGAACGATTAAAAGATATTAGTGATTTT
TGTAGTTGGACTGATGAAGGCAAGGCGGCTCCATTTATGAAAAATTGGGG
AGTTCAATTAGATAATCAACCAATAACAATTATGGGGCGAGAACTAAATG
GGGTTGATGTATTTTCTGGGCAACAACGTATTAATGCCAAATCTCCAGAT
GATTGGAAATTCGGTGAAGTTAAATTTGATATTCCAAAGGGTGCTCAGCA
TCGTTTTGCTATTTTAGCCGTCGAAAGAAGTCCTAGTCAATTCAATCAAT
TTATAGATGATGTTAAGCGTGAAATAAGTAGGCTAAGAGTTAATTATTCA
ATAGAGACTGTGGCAACTTGCAGAGCAAATGAAATTGAAGATTGCTTAAC
AGATTTTGTTAGAGTTCAAAAGGTTCATTTGGCTTTGGTTTTTATTGGTG
ACGATAAGGCATATGCTCGTGTAAAGAACTTTACGATAAGCACTGGATTA
TTAACCCAGTGCGTGACTGTAAGAAATGGGACAAATAGAGATGATCGTCG
TAGAAAAGTTGTGGCTGATAAAAGTGTTATGCAAATTTTTGCTAAATTGG
GTTACGATCCATGGGGAATTGAGTTAAAAATGGTACCGACGATGGTTGTT
GGTTTGGACACTTTTCATAGCAAGACTGGAAAGCGATCAATTCAAGCATC
TGTATTCAGTATCAGTTCGAAATTTTCTCAATATTTGAGTTTTGTAAATT
CACCAAAAGGCAAGAATGAATATCATGATAATTTGAGTCAAAATTTCATC
GCAGCCATAAATACATTTAAAGATAAATTTAACACTTTGCCACAAAGGTT
TATTATTTATCGAGACGGTGTTGGAGATTCTCAATTGTATTTCACTAAAA
AGTACGAAACTGATGCTGTTTTAAAAATTATGGAAACAATTTACGAAAAT
GAAAATTTGCCCCAAATAATTTATATAATTGTTAAAAAGAGAATAAGTGT
CAAGTTTTTTAAAGATGGTAATAATCCTAATCCCGGAACGATCGTAGATG
AGAAGGTTGTCAAACCGAACTTTTATGAATTTTATTTAGTTTCACAGAGA
ACGACGAAGGGTACTGCAACTCCGACAAATTATAACGTATTGATGGACAC
TCAATTGACTAATCGTAAAACTGGCGAGAAGGCTCCTATTCCTGCGGGTC
AATTGCAGCATATTACGTATGCTTTGACTCATCTTTACTTTAACTGGATG
GGAACTATTCGGGTTCCTGTGCCAACGCATTACGCACATCGATTAGCTGA
ACTTGTTGGAACTGTTCATCGTGGAACCAATCCTCCGGTAATTTCTGATC
GTATTAGGGAACGTCTGTTCTATCTTTGA
back to top
Gene Groups
piwi-1 is similar in sequence to the genes of this group: GG204
Gene NameGene ID
SMU15015947SMU15015947
SMU15026177SMU15026177
Ddo_002056Ddo_002056
piwi-1Ddo_012777
Ddo_017828Ddo_017828
Ddo_020375Ddo_020375
Ddo_024742Ddo_024742
Gsp_010608Gsp_010608
piwi-1Gsp_021025
Gsp_022278Gsp_022278
Pgr_002280Pgr_002280
Pgr_007521Pgr_007521
Pgr_014266Pgr_014266
Pgr_016029Pgr_016029
piwi-1Pgr_018001
Pgr_018247Pgr_018247
Pgr_023068Pgr_023068
Pgr_032137Pgr_032137
Pmo_000476Pmo_000476
Pmo_002658Pmo_002658
Pmo_009451Pmo_009451
piwi-1Pmo_028279

Gene Group Protein Sequences

>SMU15015947

MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
>SMU15026177
IKLLLLYNTNHKPLKQLYLLFYIVYFVYLNRSLCFNIFTQIYEMDSTNVT
SDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNI
KVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSK
WHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQE
KIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTAS
TLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKE
MDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPR
ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNE
VKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKRE
IGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKV
KNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN
LKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEF
HENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVM
KMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNF
YEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYS
LTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFY
L*
>Ddo_002056 Ddo_002056
KLELLYSVASTKADNQPFCFDGRRLFTPSQWHKEDIETFNIKDEEVSIRF
LATFIENTEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIKEGP
SFFKMENFKILGGYSTTITRGTNEDGTASTLLYLERINRVLNENSVIAVY
RRDQIDQLIGRDIITKYNNKTYRISDIKEMGINDEIELNGTKISYYNYFK
QRYNITLKNDKQPFVISRIKRSMTHRPKEKSENEPEGPKETDQSLSIPGE
LCYLCGFSDSERSNINLQKSLGGVLKREPRERINDIKDFCKWTGGGKSKD
YMKTWNMTIEEQPITIRGRELPPVDIMSNDVKINAKTPDDWKFGEVKFDV
PKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_012777 piwi-1
MDPSNSQTTRPRRGGLQRRFAIIEPALQPDTVVDKIGRDGRAVNLKSNYA
NFTINTDGPFFMYDVVCENKSLRSKLTFLTNYAKTRKNKTPFCFDGRRLF
TCEAWHGGEDDTTATLTIDDMELSIRYLTSFLKNSEEYYQMVNIVFNNVQ
CLMGQEKIGRQYFISSNIDSVSLKEGPSFFKMENFKILGGFSTTITRGTN
SDGTASTLLYLERINRVLNESSVCSVYRRDQIDALIGRDIITKYNNKTYR
ISDIKEMAIDDEIELGGKRISYREYFKQRYNIALKTDKQPFVISRMKRSI
APNLRNKNKAEGAAEEGDVPPREPDQSLSIPGELCYLCGFSDSERANINL
QKSMGGVLKREPRERLNDIRDFCKWTSNGAQTREFMTSWGMNIDEQPITI
RGREMPPVDIFSMDQKINTKIPDDWKFGEVRFDIPKGTAHRFGVLVVDRN
PAHFNAFIEDVKREIGRLRINYTIEAVSSCRGNEVEDALAEFIKINKVHM
ALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKVVADKSVM
QMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQ
YISFVNSSKGKNEFHENLAKNFLTAINTFQSKFNTMPQRFIIYRDGVGDS
QLAFTKKYETEAVMKMLETIYENQPLPQILYVIVKKRISVKFFKDGGNPN
PGTIVDEKVVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKMTNKKTNEV
AAMAPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGAN
PPTINERIRERLFYL*
>Ddo_017828 Ddo_017828
LSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYI
ERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDE
KFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLTRVKKPMRRERRKPGEED
KEKEREKEKEAPQEKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLK
REPRERLDDIPAFCNWIRGSDNANGMCNKWQLKIDNKPLEIEGRELPPCD
VISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMN
DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGSAKMALVFVPD
DRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFG
YDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQ
PRGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKN
FEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVV
DKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPN
ELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNNPAVINE
RIRNRLFYL*
>Ddo_020375 Ddo_020375
DITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKSN
YANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFTT
SKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFMG
QEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDGT
ASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISDI
KEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHRP
KEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLKR
EPRERINDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDIM
SNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
>Ddo_024742 Ddo_024742
MDENNGKKMIKHENGSETKGRGTRGGLRRTFRIVEPNLAPTDITEKTGNL
GRVVRLQSSFTKFSIMRSEKYMMYDSVFSTMGLPPKAKLQLIVRICQENK
LPGAFCFDGRRLFTSEKWHGETDIQEFNYEDKKMTLRLVAQIIPETEEYY
QMINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNCGPTFFETNSFKV
LGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIG
RDIITKYNNKTYRISEVKEMSVDEKFEMGGRTLSYAEYFKERYNIRLTGG
EQPFVLTRVKKPMRRGPRKPRGEKPAEGGEAEVVAEEAPKEREREAPEEK
DMTLNIPGELCFLCGFSDQEKANMDLQKNLGGVLKREPRERLEDIPAFCN
WLKQNDNAGRLIDKWQFKIDNKPLEIEGRELPACDVISGGNKINEKMGDD
WKFGRIQFDIKRDRKHEIDVVIVDRNDFQYKNFMGDVEQELRQMRIDARI
GKVNTCGPNDIERCLNDSARSGSGCAKMALVFVPDDRAYAKVKSFTMSTG
LLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMI
VGLDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF
NLALEDFKKRYDILPQRILVYRDGVGDNQLWFTKQFEVDAMKPLVENIYK
NNGFPVPQIIYVIVKKRITTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLV
SQRTTKGTATPSNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFN
WMGTIRVPVPVHYAHRLAELVGKVHKGSAPAVINERIRNRLFYL*
>Gsp_010608 Gsp_010608
MALVFVPDDRAYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTV
MQIFAKFGYDPWTVEIKLRPTMIVGLDTYHNKSSKKSIQASVFSINSTFT
QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVYRDGVGD
NQLWFTKQFEVDAMKPLVENIYKNNGFPVPQIIYVIVKKRITTKLFNRGN
NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPSNYNVLEDTRLLTKKG
TMDPMAPNELQKITYALTHLYFNWMGMIR
>Gsp_021025 piwi-1
MDITNVSRDPASRPKRGGLRQRFAIIEPTLQPETITDKVGKDGRVVNLKS
NYANFNIKIDGPFYMYDVVMEPKSIRSKLQLLMTKSDGQPFCFDGRRLFT
TSKWHSTDDVEKFTVNNVEISIRLLTTFVKSSEEYYQMINIVFNNIQIFM
GQEKIGRQFFLGSNCESGGIKEGPSFFKMENFKILGGYSTTITRGTNEDG
TASTLLYLERINRVLNENSVIAVYRRDQIDQLIGRDIITKYNNKTYRISD
IKEMGINDEIELNGTKISYYNYFKQRYNITLKNDKQPFVISRIKRSMTHR
PKEKSENEPEGPKETDQSLSIPGELCYLCGFSDSERSNINLQKSLGGVLK
REPRERLNDIKDFCKWTGGGKSKDYMKTWNMTIEEQPITIRGRELPPVDI
MSNDVKINAKTPDDWKFGEVKFDVPKGITHRFGVLVVDRNPSHFNNFIDD
VKREISRLRINYTIDNIASCRGNEVEDALTEFVRVNKVHLALVFIPDDKV
YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQIFAKLGYDP
WGISLKMAPTMIVGIDTFHSKTGKRSVQASVFSISSKFSQYMSFVNSPKG
KNEFHENLGKNFLTAITAFQQKFGTMPQRFIIYRDGVGDSQLFLTKKFET
DAVMKMVEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIV
KPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYCNKKTNEVSPMAPSVLQQ
ITYSLTHLYFNWMGTIRVPVPVHYADRLAELVGIVHRGTAPPTINERIRE
RLFYL*
>Gsp_022278 Gsp_022278
MAEDYLLVKSGTVNQIYKNLLMRRKKLTLRLVATILPETEEYYQMINVLL
NNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTT
LQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKY
NNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGDQPFVLT
RVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCFLCGFSD
QEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMCNKWQLK
IDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEI
DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDA
ARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKR
RKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS
VFSINSTFTQYMSFVNQPRGRQEFHETLGKNFNLALEDFKKRYDILPQRI
LVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRV
GTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLE
DTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA
ELVGKVHKGNNPAVINERIRNRLFYL*
>Pgr_002280 Pgr_002280
DGIRNAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNATNRMDKRR
QVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKKSIQASV
YSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIM
IYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRIS
TKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLED
TKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAE
LIGKIHKGTNPAVINDRIRDRLFYL*
>Pgr_007521 Pgr_007521
MINVLLNNLQVMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVL
GGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGR
DIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKDRYNIRLTQGD
QPFVLTRVKKPMRRERRKPGEEDKEKEREKEKEAPQEKDMTLNIPGELCF
LCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIRGSDNANGMC
NKWQLKIDNKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKR
DRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVE
RCLNDAARSGSGSAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGT
NRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTY
>Pgr_014266 Pgr_014266
GFATTLQRGTTRDGAMTTLLYIERINRVLNENSVLKSFRNGNVDQFIGRD
VMTKYNNKVYRISDMKEMSINGEFQVGDRTLSYFDYFKERYNITLQQSTQ
PFVITRAKRTFRRNEKNDEEKVSKSEPEDNEISLNIPGELCFLCGFSDQE
KTNMELQRGMGSILKREPRDRLNDIPNFCDWVRKCDGSSAVIQQWQLRIE
DRPLEIEGRELPPCEVVSNNKKINDKFADDWKFGRVQFDIDQKREHELNI
VIVDRNDFNYKKFIQDVEAELRTMRINAKIRDCKTCGANDIERCLEDIIR
SPSNAAKMALVFVPDDRTYARVKVFTMQTGLLTQCVTTRNATNKNDKRRQ
VVSSKTVMQIFSKFGYDPWSVTLKLRPTMIVGMDTYHNKNSKKSILASVF
SINCTFTQYMSFVNAPKGRQEFHENIGKNFIVALTDFKKRYFILPQRIMV
YRDGVGDSQLEFTKNFEVDAMKPMVEEIYKSMNSALPQIIYVIVKKRISI
KLFNRGNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDS
RLLTKSGAMDPMSPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAEL
VGKVHKGSSTPMIHDRIKSRLFYL*
>Pgr_016029 Pgr_016029
MEDLNPPKIRKTDNGDRGGKGPRGNRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFYMYDVVLSDMGIAPKGKLKIISKVQQT
NNLRGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVTAGTEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
IGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKTENPEEAPDEPPAEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRVENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFTTSSR
KNHEIDIIVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMALVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALK
>Pgr_018001 piwi-1
MEERKVAKRGGLQKRFYVIEPSLQPELIVDKVGKDGRAVALKSNYANFKV
GPKGPFFMYDVKMPMKSLRGKLELLYSVASTKADNQPFCFDGRRLFTPSQ
WHKEDIETFNIKDEEVSIRFLATFIENTEEYYQMINIIFNNIQVFMGQER
IGRAFFLGSNCNESLSKCGPTFFKRDNFKILGGFCTTLTRGTNQDGTACT
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEL
DVSEEIELNGVKISYFDYFKQRYNITLTTGKQPFVISRMRRIGIIQKENL
ENDPEAPKEADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRE
RLRDISDFCNWTKEGKASPFMEKWGLELENQPVTIMGRELNGVEVFSNKQ
RINTKSSDDWKFGEVKFDIPAGTQHRFGILVVERNPGQFNQFIDDVKREM
SRLRVSHTIGSVLSCRTNEIEDFLTDFIRDKVHLALVFIGDDKIYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMVAGLDTFHSKTGKRSIQASVFSISSKFTQYLSFVNSSKGKSEYHD
NLSQNFKAAINLFRDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKI
IESVYENQNLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKTGDKAPIPPSQLQHFTYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pgr_018247 Pgr_018247
NNLQVMLGQERIGKAYFLSANITKSEVSKNAGPTYFEMNNFKVLGGFATT
LQRGTTREGAMTTLLYIERINRVLNENSVLKIYNRNNIDQMIGRDIITKY
NNKTYRISDMKEMSIEEKFELGERTLTYAEYFKERYNISLQQTEQPFVIT
RVKRPVRRPHRKEGEEAPPPAPEEPDISLNIPGELCFLCGFSDQEKSNLD
LQKSLGSVLKREPRERLEDIPVYCEWVNKGEASSVLIKQWDLRIDNKPLE
IEGRELPAVEVMSNNQRINERIPDDWKFGRVQFNIRNDRAHEIDVIVVDR
NDFNYKNFIQDVEFELKNMRINARIGQRMNCGPNDIEKCLTDVARAGSNA
AKIALVFVPDDRTYARVKAFTIQTGLLTQCVTTRNGTNKNDKRRKVVSSK
TVMQVFSKFGYDPWTVELKLRPTMIVGMDTYHNKSSKKSIQASVFSINST
FTQYMSFVNAPKGRQEFHETLGKNFALALADFKNRYDILPQRIMIYRDGV
GDSQLQFTKNFEVDAMKPMVEEIYKNMGSSLPQLVYIIVKKRVGTKLFNR
GNNPNPGTIVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLSK
KATMDPMPPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH
KGTNPPIINERIRNRLFYL*
>Pgr_023068 Pgr_023068
MEEKRTIKRGGLQKRFYIIEPSLQPETVKDKVGKEGKAVALKSNYANFKL
TPRGPFFMYDVKMPAKSLRGKLDLLYSVATTKGSDQPFCFDGRRLFTPSQ
WHKEDIETFTVKDEEVSIRYLASFIENTEEYYQMVNIIFNNIQVFMGQER
IGRAFFLGSNCNEAISKNGPTFFKRDNFKILGGFATTLSRGTNQDGSAST
LLYLERINRVLNENSVYNIYNKNQLDLLIGRDIITKYNNKTYRISDIKEM
DITEEIELNGVKISYLDYFKQRYNITLANGKQPFVISRMRRLPIQQKENQ
ENEPEAPKDADQSLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRE
RLRDIGDFCSWTQEGKAAPFMEKWGVQLDNQPITIMGRELNGVEVFSGKQ
RINGKSPDDWKFGEVKFDIPQGAQHRFAILAVDRNPTHFNQFIDDVKREM
GRLRVNHSVETVTTCRVNEIEDYLTDFVRVQKVHMALVFINDDKAYARVK
NFTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVE
>Pgr_032137 Pgr_032137
MEDLNPAKIRKTDDGDRGGKSARGFRGGLQRRFRILEPNLQPTDITEKMG
NIGKTVKLASNFAKFSISNVETFFMYDVVMSDVGIAPKGKLKIISKVQQT
NNLKGPFCFDGRRLFTGEKWHGESDINEFTEDDKKITIRFITNVSAATEE
YYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNNF
RVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRSDQL
VGRDIITKYNNKTYRISDIKEMAVSEQFDLAGRKLSYYDYFKERYNIKLQ
HSNQPFVLTRMRRTVIRKKKPEKPEDAPEEPPPEPEPEMTLNIPGELCFL
CGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFMK
EWNLRIENRPLEIEGRELPPVDVVSGGQKINERIPDDWKFGRVKFTTSSR
KNHEIDIVVIDRNDFNYQKFIQDVKNEIRNLNVNAKVTSVEKCGPNDIES
ILTDIMRRSRDSVKMAMVFVPDDKTYARVKNFTLSTGLLTQCVTTRNGTN
RMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKK
SIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEI
YPQRIMIYRDGVGDSQMYFTKTFEADALKPIMEKLYQDKGFPIPQIIYVV
VKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTN
YNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHY
AHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_000476 Pmo_000476
MEEKKGVRRGGLQKRFYIIEPSLQPESVVDKVGKEGKAVALKSNYANFKL
APKGPFYMYDVKMPAKSLRGKLDVLNSIASTKNNQPFCFDGRRLFTSSQW
HKEDIETFTIKEDEISIRFLASFIENTEEYYQMVNIIFNNIQVFMGQERI
GRAYFLGSNSNEATSKFGPSFFKKDNFKILGGFSTTLTRGTSQDGTASTL
LYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKHNNKTYRISDIKEID
VTEQIELNGTKISYVDYFKQRYNITLNNGKQPFVISRMKRVGINRKENLE
NEPEAPKEADESLSIPGELCFLCGFSDSERSNLNLQKSLGSVLKREPRER
LRDISDFCSWTTEGKAAPFMGKWGVELDNQPITIMGRELNGVEVISNKRR
INDKTSDDWKFGEVKFDIPAGAQHRFAVLVVERNPSQFNQFIDDVKREMG
RLRVNHLIETVVSCRTNEIEDFLSDFIRVQKVHMALVFIGDDKAYARVKN
FTISTGLLTQCVTVRNGTNRDDRRRKVVADKSVMQMFAKLGYDPWGVELK
MVPTMIVGLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSSKGKNEYHD
NLAQNFKAAIQTFKEKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKF
MESVYENETLPQLIYVIVKKRISVKFFKDGSNPNPGTIVDEKIVKPNFYE
FYLVSQRTTKGTATPTNYNVLMDTQLTNRKSGEKTPIPPSQLQHITYALT
HLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*
>Pmo_002658 Pmo_002658
MKEWNLKIENRPLEIEGRELPPVDVVSGGQKVNERIPDDWKFGRVKFATN
SRKNHEIDIVIIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDV
ENILNDIMRRSRDAVKMALVFVPDDKVYARVKNFTLSTGLLTQCVTVRNG
TNKMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHNKTG
KKSIQASVYSINSTFTQYLSFINNPRGRQEFHEVLGRNFAAALQQFHSKY
EIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIY
VVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASP
TNYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPT
HYAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_009451 Pmo_009451
MEDLNPAKIRKTEDSDGRGGKGSRGSRGGLQRRFRILEPNLQPTDITEKM
GNIGKTVKLASNFAKFSICQVDTFFMYDVVLSDLGVAPKGKLKIISKVQQ
TNNLRGPFCFDGRRLFTGEKWHGESDISEFTEDEKKITIRFITNVTGGTE
EYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDVAKGSGPTYFEVNN
FRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQ
LVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKL
QHSNQPFVLTRMRRTGIRKKKPEKPEEAPEEPPPEPEPEMTLNIPGELCF
LCGFSDQEKGNNDLQKNLGGILKREPRQRLDDIPAFCDWIGKSEKASSFM
KEWSLKIENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFATSS
RKNHEIDIVVIDRNDFNYQKFIQDVKNELRNLNVNAKVTSVEKCGPNDIE
NILNDIMRRSRDAVKMALVFVSDDKMYARVKNFTLTTGLLTQCVTQRNAT
NRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGK
KSIQASVYSINSTFTQYLSFINNPKGRQEFHEVLGRNFAAALQQFHSKYE
IYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYV
VVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPT
NYNVLEDTKLLTKKGVMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTH
YAHRLAELIGKIHKGTNPAVINDRIRDRLFYL*
>Pmo_028279 piwi-1
MYDVKMPPKSLRGKLDLLNSVASTKENRPFCFDGRRLFTSSQWHQEDIET
ISIKDEEVSIRFLASFVENTEEYYQMVNIIFNNIQAFMGQERIGRAFFLG
SNSNESTSKCGPSFFKRDNFKILGGFATTLSRGTNSDGSASTLLYLERIN
RVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEMDVNDEIEL
NGTKISYANYFKQRYNITLNNGKQPFVISRLRRVAIQQKENQENEPEAPK
EADQSLSIPGELCFLCGFSDSERSNINLQKSLGSVLKREPRERLKDISDF
CSWTDEGKAAPFMKNWGVQLDNQPITIMGRELNGVDVFSGQQRINAKSPD
DWKFGEVKFDIPKGAQHRFAILAVERSPSQFNQFIDDVKREISRLRVNYS
IETVATCRANEIEDCLTDFVRVQKVHLALVFIGDDKAYARVKNFTISTGL
LTQCVTVRNGTNRDDRRRKVVADKSVMQIFAKLGYDPWGIELKMVPTMVV
GLDTFHSKTGKRSIQASVFSISSKFSQYLSFVNSPKGKNEYHDNLSQNFI
AAINTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDAVLKIMETIYEN
ENLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEKVVKPNFYEFYLVSQR
TTKGTATPTNYNVLMDTQLTNRKTGEKAPIPAGQLQHITYALTHLYFNWM
GTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.