collagen, Pmo_027332 (mRNA) Phagocata morgani

Overview
Namecollagen
Unique NamePmo_027332
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length8160
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of collagen vs. uniprot
Match: gi|18202250|sp|O93484|CO1A2_ONCMY (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor [Oncorhynchus mykiss])

HSP 1 Score: 148.288 bits (373), Expect = 4.04525e-34
Identity = 71/219 (32.42%), Postives = 110/219 (50.23%), Query Frame = 3
Query: 7452 IKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFN-GHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNH--PIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
+ P+G+K PA+TC+ + +S+P+ G YWIDPN G I DA+K +C S TCI P IA K W+ ++ N H W T+ E Y+ +QL+F++ + +A Q +T+ C N + G +G + K L +D LR + + + V+ D C ++TVIE +N + PI D+ I + D +FGL VCF
Sbjct: 1139 LLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAV--LLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355

HSP 2 Score: 148.288 bits (373), Expect = 4.04525e-34
Identity = 71/219 (32.42%), Postives = 110/219 (50.23%), Query Frame = -3
Query:   92 IKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFN-GHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNH--PIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 709
+ P+G+K PA+TC+ + +S+P+ G YWIDPN G I DA+K +C S TCI P IA K W+ ++ N H W T+ E Y+ +QL+F++ + +A Q +T+ C N + G +G + K L +D LR + + + V+ D C ++TVIE +N + PI D+ I + D +FGL VCF
Sbjct: 1139 LLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAV--LLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355
BLAST of collagen vs. uniprot
Match: gi|8039779|sp|P02465|CO1A2_BOVIN (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor)

HSP 1 Score: 145.206 bits (365), Expect = 3.7618e-33
Identity = 74/251 (29.48%), Postives = 121/251 (48.21%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWH-TTNFNGHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL--ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
A Q RSPT + D + A L N + P+G++ PA+TC+ L +S+P G YWIDPN G DA+KV+C S +TCI+ DI +K W+ + H W+ T+ + +Y++ +QL+F++ + A Q +T+ C N I D + + +L ++D ++ + + YTV+ D C + +T+IE +N + PI D+ I D + L VCF
Sbjct: 1115 YRADQPRSPTS-LRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNS-IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCF 1363

HSP 2 Score: 145.206 bits (365), Expect = 3.7618e-33
Identity = 74/251 (29.48%), Postives = 121/251 (48.21%), Query Frame = -3
Query:   92 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWH-TTNFNGHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL--ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 796
A Q RSPT + D + A L N + P+G++ PA+TC+ L +S+P G YWIDPN G DA+KV+C S +TCI+ DI +K W+ + H W+ T+ + +Y++ +QL+F++ + A Q +T+ C N I D + + +L ++D ++ + + YTV+ D C + +T+IE +N + PI D+ I D + L VCF
Sbjct: 1115 YRADQPRSPTS-LRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNS-IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCF 1363

HSP 3 Score: 58.9214 bits (141), Expect = 8.02333e-07
Identity = 50/106 (47.17%), Postives = 59/106 (55.66%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDG------HEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G +GK G+ G+ GPAG GP G +GP G G G G +G PGD GP G GL G G G H G QG PG VGP+G G +GP G G G+ G PG +G
Sbjct: 968 GPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGDQGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVG 1073

HSP 4 Score: 58.9214 bits (141), Expect = 8.02333e-07
Identity = 50/106 (47.17%), Postives = 59/106 (55.66%), Query Frame = -3
Query: 2396 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDG------HEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2695
G +GK G+ G+ GPAG GP G +GP G G G G +G PGD GP G GL G G G H G QG PG VGP+G G +GP G G G+ G PG +G
Sbjct: 968 GPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGDQGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVG 1073

HSP 5 Score: 58.151 bits (139), Expect = 1.34095e-06
Identity = 49/110 (44.55%), Postives = 61/110 (55.45%), Query Frame = 3
Query: 5463 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGH------EGGQGTPGFV------GPSGEPGKSGPVGSPGAGGQRGFPG 5756
AG++G G G +GPAG+RGP G+ G G G +G G G PG+ GP GK+G G G DG G +G PG + GPSG+PGK+G G G G RG PG
Sbjct: 412 AGVMGPAGSRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPG 521

HSP 6 Score: 58.151 bits (139), Expect = 1.34095e-06
Identity = 49/110 (44.55%), Postives = 61/110 (55.45%), Query Frame = -3
Query: 2405 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGH------EGGQGTPGFV------GPSGEPGKSGPVGSPGAGGQRGFPG 2698
AG++G G G +GPAG+RGP G+ G G G +G G G PG+ GP GK+G G G DG G +G PG + GPSG+PGK+G G G G RG PG
Sbjct: 412 AGVMGPAGSRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPG 521
BLAST of collagen vs. uniprot
Match: gi|8134352|sp|O46392|CO1A2_CANFA (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor)

HSP 1 Score: 142.124 bits (357), Expect = 3.33663e-32
Identity = 72/251 (28.69%), Postives = 120/251 (47.81%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWH-TTNFNGHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL--ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
A Q RSP + D + A L N + P+G++ PA+TC+ L +S+P G YWIDPN G DA+KV+C S +TCI+ +I K W+ + H W+ T+ + +Y++ +QL+F++ + A Q +T+ C N I D + + +L ++D ++ + + YTV+ D C + +T+IE +N + PI D+ I D +F + VCF
Sbjct: 1117 YRADQPRSPPS-LRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNS-IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365

HSP 2 Score: 142.124 bits (357), Expect = 3.33663e-32
Identity = 72/251 (28.69%), Postives = 120/251 (47.81%), Query Frame = -3
Query:   92 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWH-TTNFNGHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL--ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 796
A Q RSP + D + A L N + P+G++ PA+TC+ L +S+P G YWIDPN G DA+KV+C S +TCI+ +I K W+ + H W+ T+ + +Y++ +QL+F++ + A Q +T+ C N I D + + +L ++D ++ + + YTV+ D C + +T+IE +N + PI D+ I D +F + VCF
Sbjct: 1117 YRADQPRSPPS-LRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNS-IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365

HSP 3 Score: 55.8398 bits (133), Expect = 6.47596e-06
Identity = 48/110 (43.64%), Postives = 61/110 (55.45%), Query Frame = 3
Query: 5463 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGH------EGGQGTPGFV------GPSGEPGKSGPVGSPGAGGQRGFPG 5756
AG++G G G +GPAG+RGP G+ G G G +G G G PG+ GP GK+G G G DG G +G PG + GP+G+PGK+G G G G RG PG
Sbjct: 414 AGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPG 523

HSP 4 Score: 55.8398 bits (133), Expect = 6.47596e-06
Identity = 48/110 (43.64%), Postives = 61/110 (55.45%), Query Frame = -3
Query: 2405 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGH------EGGQGTPGFV------GPSGEPGKSGPVGSPGAGGQRGFPG 2698
AG++G G G +GPAG+RGP G+ G G G +G G G PG+ GP GK+G G G DG G +G PG + GP+G+PGK+G G G G RG PG
Sbjct: 414 AGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPG 523
BLAST of collagen vs. uniprot
Match: gi|18202034|sp|O42350|CO1A2_LITCT (RecName: Full=Collagen alpha-2(I) chain; AltName: Full=Alpha-2 type I collagen; Flags: Precursor)

HSP 1 Score: 140.198 bits (352), Expect = 1.43e-31
Identity = 67/220 (30.45%), Postives = 104/220 (47.27%), Query Frame = 3
Query: 7449 VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFN---GHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
VI P+G++ PA+TC+ L +S+P G YWIDPN G DA++VFC S +TCI +I K W+ N H W L + +Y +QL+F++ + +A Q +T+ C N ++ N + L +D LR + + Y+V+ D C +TVIE +N + PI D+ I +D + G + VCF
Sbjct: 1135 VILTPEGSRKNPARTCRDLRLSHPEWTSGFYWIDPNQGCTSDAIRVFCDFSSGETCIHANPDEITQKNWYINTSNKDKKHLWFGEILNGGTQFEYHDEGLTAKDMATQLAFMRLLANQASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELRAEGNTRFTYSVLEDGCTKHTGEWGKTVIEYRTNKPSRLPILDIAPLDIGGHDQEIGFEIGPVCF 1354

HSP 2 Score: 140.198 bits (352), Expect = 1.43e-31
Identity = 67/220 (30.45%), Postives = 104/220 (47.27%), Query Frame = -3
Query:   92 VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFN---GHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 712
VI P+G++ PA+TC+ L +S+P G YWIDPN G DA++VFC S +TCI +I K W+ N H W L + +Y +QL+F++ + +A Q +T+ C N ++ N + L +D LR + + Y+V+ D C +TVIE +N + PI D+ I +D + G + VCF
Sbjct: 1135 VILTPEGSRKNPARTCRDLRLSHPEWTSGFYWIDPNQGCTSDAIRVFCDFSSGETCIHANPDEITQKNWYINTSNKDKKHLWFGEILNGGTQFEYHDEGLTAKDMATQLAFMRLLANQASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELRAEGNTRFTYSVLEDGCTKHTGEWGKTVIEYRTNKPSRLPILDIAPLDIGGHDQEIGFEIGPVCF 1354

HSP 3 Score: 57.7658 bits (138), Expect = 1.62524e-06
Identity = 49/114 (42.98%), Postives = 62/114 (54.39%), Query Frame = 3
Query: 5460 LAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQ------------GLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G+ G++G+ G++GP G RGP G G A G+ G PG G PG+ GPVG Q G G +G+ G +G +G PG G GE G +G GSPG G RG PGE G
Sbjct: 104 FQGLPGENGEPGQTGPVGSRGPSGAPGKA---GEDGHPGKSGRPGERGPVGPQGARGFPGTPGLPGFKGIRGHTGSDGQKGAPGAAGVKGENGANGDNGSPGQAGARGLPGERG 214

HSP 4 Score: 57.7658 bits (138), Expect = 1.62524e-06
Identity = 49/114 (42.98%), Postives = 62/114 (54.39%), Query Frame = -3
Query: 2396 LAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQ------------GLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2701
G+ G++G+ G++GP G RGP G G A G+ G PG G PG+ GPVG Q G G +G+ G +G +G PG G GE G +G GSPG G RG PGE G
Sbjct: 104 FQGLPGENGEPGQTGPVGSRGPSGAPGKA---GEDGHPGKSGRPGERGPVGPQGARGFPGTPGLPGFKGIRGHTGSDGQKGAPGAAGVKGENGANGDNGSPGQAGARGLPGERG 214
BLAST of collagen vs. uniprot
Match: gi|82202407|sp|Q6P4Z2|CO2A1_XENTR (RecName: Full=Collagen alpha-1(II) chain; AltName: Full=Alpha-1 type II collagen; Flags: Precursor)

HSP 1 Score: 139.428 bits (350), Expect = 2.3974e-31
Identity = 72/233 (30.90%), Postives = 109/233 (46.78%), Query Frame = 3
Query: 7413 DDSMTAKLLGGNV--IKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTT--NFNGHSWI-HTLTKKNEVKY----SIPNS---QLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
D T K L + I++P GTK PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P I K W + H W T+ + Y S PN+ Q++FL+ S A Q +T+ C N ++ N + L +D +R + + Y + D C+ ++TVIE + + PI D+ I D +FG+ VCF
Sbjct: 1259 DVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491

HSP 2 Score: 139.428 bits (350), Expect = 2.3974e-31
Identity = 72/233 (30.90%), Postives = 109/233 (46.78%), Query Frame = -3
Query:   92 DDSMTAKLLGGNV--IKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTT--NFNGHSWI-HTLTKKNEVKY----SIPNS---QLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 748
D T K L + I++P GTK PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P I K W + H W T+ + Y S PN+ Q++FL+ S A Q +T+ C N ++ N + L +D +R + + Y + D C+ ++TVIE + + PI D+ I D +FG+ VCF
Sbjct: 1259 DVEATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15040033 (dd_smedV4_702_0_1|m.35199|m.6295)

HSP 1 Score: 372.089 bits (954), Expect = 3.35057e-105
Identity = 153/237 (64.56%), Postives = 200/237 (84.39%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIISKNDSQFGLKFEEVCFS* 8075
+MAMQMRSPTKG+ YGDD + A+LLG N IKNP+GTK+VPA TCK LSV +PN PDGEYWIDPN GR++DAVKV+C+IS+Q+TCIKPI+ +I+++ W + + NGH+W+ ++ K E++YSIPN Q++FLK S+ A+QRVTFTC+NHPIIGN+ K+NKVT+PRLLADDD+I+++ H LKYTVI D+CQY KSSEAE++IEV N AN+ PIRD+GV+II+ S+FG+ EEVCFS*
Sbjct: 1050 IMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS* 1286

HSP 2 Score: 372.089 bits (954), Expect = 3.35057e-105
Identity = 153/237 (64.56%), Postives = 200/237 (84.39%), Query Frame = -3
Query:   86 VMAMQMRSPTKGIMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIISKNDSQFGLKFEEVCFS* 796
+MAMQMRSPTKG+ YGDD + A+LLG N IKNP+GTK+VPA TCK LSV +PN PDGEYWIDPN GR++DAVKV+C+IS+Q+TCIKPI+ +I+++ W + + NGH+W+ ++ K E++YSIPN Q++FLK S+ A+QRVTFTC+NHPIIGN+ K+NKVT+PRLLADDD+I+++ H LKYTVI D+CQY KSSEAE++IEV N AN+ PIRD+GV+II+ S+FG+ EEVCFS*
Sbjct: 1050 IMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS* 1286

HSP 3 Score: 92.0485 bits (227), Expect = 4.17701e-18
Identity = 213/351 (60.68%), Postives = 244/351 (69.52%), Query Frame = 3
Query: 4209 LIKCSFTPSGSVFFLGILSCIQIAFGQFKSLQEAVGPPGIRXXXXXXXXXXXXXXXXAAGSTGFMGKDGVRGPPGLIGPAGKPXXXXXXXXXXXXXXXXXXXEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMXXXXXXXXXXXXXXXXNPGEVGPKGSEGDQGPIXXXXXXXXXXXXXXXXDRGRPGQIGENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNG 5261
+ K S SG++ IL + ++GQF++L EA GP GIRGNPG +GK GPDGD G++G G GKDG+RG PG GPAG G DGK+GV G G PG RGE G G +G+EG+ GP GY G GEKGD G GE GD G+IGP G GP GP GQ GP+G QG G RG GPDG VGPPGP+G+MG G PG PGE+G KGE G EG KGGKG +GK G+N K GK G G G G +G+QGR+G G+IG+ G QG G RG RG +GNPG+ GPKGS+GDQGPIGLEGKPG GP G KGDRGRPG GE GP GP G G G KG RGEIGPNGSPGTPG NG
Sbjct: 1 MFKNSIF-SGAILL--ILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLGPPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKKGEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNG 348

HSP 4 Score: 92.0485 bits (227), Expect = 4.17701e-18
Identity = 213/351 (60.68%), Postives = 244/351 (69.52%), Query Frame = -3
Query: 2900 LIKCSFTPSGSVFFLGILSCIQIAFGQFKSLQEAVGPPGIRXXXXXXXXXXXXXXXGAAGSTGFMGKDGVRGPPGLIGPAGKPXXXXXXXXXXXXXXXXXXGEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMXXXXXXXXXXXXXXXGNPGEVGPKGSEGDQGPIXXXXXXXXXXXXXXXGDRGRPGQIGENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNG 3952
+ K S SG++ IL + ++GQF++L EA GP GIRGNPG +GK GPDGD G++G G GKDG+RG PG GPAG G DGK+GV G G PG RGE G G +G+EG+ GP GY G GEKGD G GE GD G+IGP G GP GP GQ GP+G QG G RG GPDG VGPPGP+G+MG G PG PGE+G KGE G EG KGGKG +GK G+N K GK G G G G +G+QGR+G G+IG+ G QG G RG RG +GNPG+ GPKGS+GDQGPIGLEGKPG GP G KGDRGRPG GE GP GP G G G KG RGEIGPNGSPGTPG NG
Sbjct: 1 MFKNSIF-SGAILL--ILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLGPPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKKGEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNG 348

HSP 5 Score: 77.0258 bits (188), Expect = 1.73378e-13
Identity = 125/264 (47.35%), Postives = 151/264 (57.20%), Query Frame = 3
Query: 5475 GKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGA---------------------GGQRGFPGELGVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGITGPSGVLGVPGTYGPNGAPGPEGTLGKQGPIGKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRISKPQPRGAGPAGPKGETGKPGLDGVPGEVGPSGK 6203
G+ G LG +G G+RGP G G G G +G+PGLRG PG G G +G G G+ G G G PG +G +G G GP+G+ G+ G G+PG G+ GKNG PG GKPGK G PG G G PGP GD G+ GP G G+ G G+ GVPG YGPNG+PG G LGKQGP G G G+ G PG GP+GPPG +G PG G + K +PR G AG +G GKPG+DG PG+VGP GK
Sbjct: 399 GRKGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVGPPGK 662

HSP 6 Score: 77.0258 bits (188), Expect = 1.73378e-13
Identity = 125/264 (47.35%), Postives = 151/264 (57.20%), Query Frame = -3
Query: 1958 GKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGA---------------------GGQRGFPGELGVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGARGITGPSGVLGVPGTYGPNGAPGPEGTLGKQGPIGKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRISKPQPRGAGPAGPKGETGKPGLDGVPGEVGPSGK 2686
G+ G LG +G G+RGP G G G G +G+PGLRG PG G G +G G G+ G G G PG +G +G G GP+G+ G+ G G+PG G+ GKNG PG GKPGK G PG G G PGP GD G+ GP G G+ G G+ GVPG YGPNG+PG G LGKQGP G G G+ G PG GP+GPPG +G PG G + K +PR G AG +G GKPG+DG PG+VGP GK
Sbjct: 399 GRKGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVGPPGK 662
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15002271 (Asxlregen_comp67208_c0_seq1|m.27270|m.10319)

HSP 1 Score: 259.996 bits (663), Expect = 9.94134e-70
Identity = 113/233 (48.50%), Postives = 149/233 (63.95%), Query Frame = 3
Query: 7380 MRSPTKGIMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPII-GNDGKINKVTSPRLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIISKNDSQFGLKFEEVCFS* 8075
+RSPTKG+ + DD A G N I P+GTK+VPA++CKHLS NP+ DGEYWIDPN GR+ DAV V+C+I+ QQTCIKPI W H W T+ E +Y I N QL++LKA SE A Q+++ C N II GK++ V + LL DDD+IL + HPK ++ VI D+CQY K SEAET++EV A+ PI+DVG+ I S + G++ EVC+S*
Sbjct: 1064 LRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWT-SLLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS* 1295

HSP 2 Score: 259.996 bits (663), Expect = 9.94134e-70
Identity = 113/233 (48.50%), Postives = 149/233 (63.95%), Query Frame = -3
Query:   86 MRSPTKGIMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPII-GNDGKINKVTSPRLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIISKNDSQFGLKFEEVCFS* 781
+RSPTKG+ + DD A G N I P+GTK+VPA++CKHLS NP+ DGEYWIDPN GR+ DAV V+C+I+ QQTCIKPI W H W T+ E +Y I N QL++LKA SE A Q+++ C N II GK++ V + LL DDD+IL + HPK ++ VI D+CQY K SEAET++EV A+ PI+DVG+ I S + G++ EVC+S*
Sbjct: 1064 LRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWT-SLLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS* 1295

HSP 3 Score: 96.2857 bits (238), Expect = 2.30107e-19
Identity = 153/293 (52.22%), Postives = 179/293 (61.09%), Query Frame = 3
Query: 4386 GSTGFMGKDGVRGPPGLIGPAGKPXXXXXXXXXXXXXXXXXXXEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMXXXXXXXXXXXXXXXXNPGEVGPKGSEGDQGPIXXXXXXXXXXXXXXXXDRGRPGQIGENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNGV 5264
G++G GKDG G G++GP G PRGEPGL GS+G EG GP G GL G+KGD GL G G G G G G +GP G+ GP+G QG TG RG G DG G GPQG +GP G G PGE+GNKG +G G KG KG SG PGL K G G +G G PG DG+ G RG G +G G G GQRG RG GNPG GPKGS+G++GPIG+EGK G+ GP G KGD GRPG+ G+ GP G G+ G G KG RGE GP+GSPG PG +G+
Sbjct: 82 GASGIPGKDGTPGSHGVVGPIG------------------PRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGI 356

HSP 4 Score: 96.2857 bits (238), Expect = 2.30107e-19
Identity = 153/293 (52.22%), Postives = 179/293 (61.09%), Query Frame = -3
Query: 2897 GSTGFMGKDGVRGPPGLIGPAGKPXXXXXXXXXXXXXXXXXXGEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMXXXXXXXXXXXXXXXGNPGEVGPKGSEGDQGPIXXXXXXXXXXXXXXXGDRGRPGQIGENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNGV 3775
G++G GKDG G G++GP G PRGEPGL GS+G EG GP G GL G+KGD GL G G G G G G +GP G+ GP+G QG TG RG G DG G GPQG +GP G G PGE+GNKG +G G KG KG SG PGL K G G +G G PG DG+ G RG G +G G G GQRG RG GNPG GPKGS+G++GPIG+EGK G+ GP G KGD GRPG+ G+ GP G G+ G G KG RGE GP+GSPG PG +G+
Sbjct: 82 GASGIPGKDGTPGSHGVVGPIG------------------PRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGI 356

HSP 5 Score: 57.7658 bits (138), Expect = 1.06952e-07
Identity = 51/109 (46.79%), Postives = 64/109 (58.72%), Query Frame = 3
Query: 5463 AGILGKDGDLGKSGPAGIRGP---PGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPG---KSGPVGSPGAGGQRGFPGELGVH 5771
AGI+G G +GK G G RGP PG GP G +G+ G G+ G G GP G++G G+ G G EG +G G VGP+G G +SGP GSPG G G PG+ G+H
Sbjct: 255 AGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLH 363

HSP 6 Score: 57.7658 bits (138), Expect = 1.06952e-07
Identity = 51/109 (46.79%), Postives = 64/109 (58.72%), Query Frame = -3
Query: 2390 AGILGKDGDLGKSGPAGIRGP---PGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPG---KSGPVGSPGAGGQRGFPGELGVH 2698
AGI+G G +GK G G RGP PG GP G +G+ G G+ G G GP G++G G+ G G EG +G G VGP+G G +SGP GSPG G G PG+ G+H
Sbjct: 255 AGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGNPGTDGIPGKDGLH 363

HSP 7 Score: 55.8398 bits (133), Expect = 4.91219e-07
Identity = 48/124 (38.71%), Postives = 63/124 (50.81%), Query Frame = 3
Query: 5460 LAGILGKDGDLGKSGPAGIRGPPGELGPA---------------------GGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 5768
LAG+ G +G+ G GP G+RGP G +GPA G +G IG PG GIPG+ +G +G+ G+ G G +G G PG G +G G GP G PG G+ G GE G+
Sbjct: 137 LAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGE---IGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGI 257

HSP 8 Score: 55.8398 bits (133), Expect = 4.91219e-07
Identity = 48/124 (38.71%), Postives = 63/124 (50.81%), Query Frame = -3
Query: 2393 LAGILGKDGDLGKSGPAGIRGPPGELGPA---------------------GGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 2701
LAG+ G +G+ G GP G+RGP G +GPA G +G IG PG GIPG+ +G +G+ G+ G G +G G PG G +G G GP G PG G+ G GE G+
Sbjct: 137 LAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGE---IGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGI 257

HSP 9 Score: 55.4546 bits (132), Expect = 5.43462e-07
Identity = 74/187 (39.57%), Postives = 88/187 (47.06%), Query Frame = 3
Query: 5460 LAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGT---PGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGITGPSGVLGVPGTYGPNGAP---GPEGTLGKQGPIGK 6002
LAG +G +G G G G+ G G++G AG KG G PGL+G G GP G+ G AG +G G G QGT PG +GP G G G G PG G +G GE G+ G G GN G G TGPSG LG PG G +G P G G +G QGP+GK
Sbjct: 110 LAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLA------------------------------GKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGK 266

HSP 10 Score: 55.4546 bits (132), Expect = 5.43462e-07
Identity = 74/187 (39.57%), Postives = 88/187 (47.06%), Query Frame = -3
Query: 2159 LAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGT---PGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGARGITGPSGVLGVPGTYGPNGAP---GPEGTLGKQGPIGK 2701
LAG +G +G G G G+ G G++G AG KG G PGL+G G GP G+ G AG +G G G QGT PG +GP G G G G PG G +G GE G+ G G GN G G TGPSG LG PG G +G P G G +G QGP+GK
Sbjct: 110 LAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQGPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGIPGEIGNKGIRGESGIKGAKGDSGNPGLA------------------------------GKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGK 266

HSP 11 Score: 51.2174 bits (121), Expect = 9.84821e-06
Identity = 51/110 (46.36%), Postives = 58/110 (52.73%), Query Frame = 3
Query: 5463 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRG---IPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPV------GSPGAGGQRGFPGELG 5765
+GI G GD G G AG GP G LGP G G G PG+RG I G GPVGK G GQ+G G+ PG GP G G+ GP+ GS G GQ+G PG G
Sbjct: 213 SGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGN------PGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPG 316

HSP 12 Score: 51.2174 bits (121), Expect = 9.84821e-06
Identity = 51/110 (46.36%), Postives = 58/110 (52.73%), Query Frame = -3
Query: 2396 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRG---IPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPV------GSPGAGGQRGFPGELG 2698
+GI G GD G G AG GP G LGP G G G PG+RG I G GPVGK G GQ+G G+ PG GP G G+ GP+ GS G GQ+G PG G
Sbjct: 213 SGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPGVRGEAGIVGPQGPVGKVGQRGQRGPSGN------PGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGRPG 316
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15036469 (dd_smedV4_1070_0_1|m.1593|m.7941)

HSP 1 Score: 196.052 bits (497), Expect = 7.59918e-50
Identity = 91/239 (38.08%), Postives = 129/239 (53.97%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIIS--KNDSQFGLKFEEVCFS* 8075
V M R I+ DD + AK LG + I P GT + PA++C HL+ NP+ PDG YWIDPN G+IDDAV+V+CKI +++TCIKP+ I ++K FN W + YS+ Q++FLK S KA Q +T C N P+I N V R+ D+D IL + Y V+ D+CQ+ + T +E+++ PI+D+ V ++ SQ EEVCF *
Sbjct: 1066 VATMSNRQQGYMIIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQK---PKFN---WFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVI-----KNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCFY* 1293

HSP 2 Score: 196.052 bits (497), Expect = 7.59918e-50
Identity = 91/239 (38.08%), Postives = 129/239 (53.97%), Query Frame = -3
Query:   86 VMAMQMRSPTKGIMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIIS--KNDSQFGLKFEEVCFS* 796
V M R I+ DD + AK LG + I P GT + PA++C HL+ NP+ PDG YWIDPN G+IDDAV+V+CKI +++TCIKP+ I ++K FN W + YS+ Q++FLK S KA Q +T C N P+I N V R+ D+D IL + Y V+ D+CQ+ + T +E+++ PI+D+ V ++ SQ EEVCF *
Sbjct: 1066 VATMSNRQQGYMIIQADDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQK---PKFN---WFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVI-----KNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCFY* 1293

HSP 3 Score: 54.6842 bits (130), Expect = 9.31382e-07
Identity = 131/272 (48.16%), Postives = 155/272 (56.99%), Query Frame = 3
Query: 4404 GKDGVRGPPGLIGPAG---KPXXXXXXXXXXXXXXXXXXXEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMXXXXXXXXXXXXXXXXNPGEVGPKGSEGDQGPIXXXXXXXXXXXXXXXXDRGRPGQIGENGPEGPLGMEGKPGTKGV 5210
GKDG +G GLIGP G KPG DG G G G GP G G G G +G GP G G +GEKG G G GD+G +G + GP G G PGPSG+QG G RG+ G DG G PGP G G GPPG G G KG G +G G G G PG+N PG +G GI G+ GKDG G +G G +G++G QG SG G +G +G PG G KG+EG GP+G G PG+ G G G+RG G G GP+GP G+ G G KGV
Sbjct: 80 GKDGPQGVLGLIGPTGINGKPGVDGSIGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNPGDIGVLG---LPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGV 348

HSP 4 Score: 54.6842 bits (130), Expect = 9.31382e-07
Identity = 131/272 (48.16%), Postives = 155/272 (56.99%), Query Frame = -3
Query: 2951 GKDGVRGPPGLIGPAG---KPXXXXXXXXXXXXXXXXXXGEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMXXXXXXXXXXXXXXXGNPGEVGPKGSEGDQGPIXXXXXXXXXXXXXXXGDRGRPGQIGENGPEGPLGMEGKPGTKGV 3757
GKDG +G GLIGP G KPG DG G G G GP G G G G +G GP G G +GEKG G G GD+G +G + GP G G PGPSG+QG G RG+ G DG G PGP G G GPPG G G KG G +G G G G PG+N PG +G GI G+ GKDG G +G G +G++G QG SG G +G +G PG G KG+EG GP+G G PG+ G G G+RG G G GP+GP G+ G G KGV
Sbjct: 80 GKDGPQGVLGLIGPTGINGKPGVDGSIGAPGPVGPDGPSGPTGPVGMPGNQGPDGPSGSKGPVGEKGPDGPQGNPGDIGVLG---LPGPPGHKGAPGPSGRQGPQGPRGLQGVDGLPGQPGPLGPQGVPGPPGMMGPTGVKGYAGKQGVLGSSGDPGSPGVNGAPGPIGQPGIMGSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAGPKGV 348

HSP 5 Score: 52.7582 bits (125), Expect = 3.7066e-06
Identity = 44/94 (46.81%), Postives = 54/94 (57.45%), Query Frame = 3
Query: 5484 GDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G GK GP GI+G G LG G +G G PGL+G G GP G +G G+ G G G G+PG +G GE G++GP G+PG G RG G G
Sbjct: 251 GSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAG 344

HSP 6 Score: 52.7582 bits (125), Expect = 3.7066e-06
Identity = 44/94 (46.81%), Postives = 54/94 (57.45%), Query Frame = -3
Query: 2396 GDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2677
G GK GP GI+G G LG G +G G PGL+G G GP G +G G+ G G G G+PG +G GE G++GP G+PG G RG G G
Sbjct: 251 GSRGKDGPIGIKGENGPLGLLGPQGLSGPPGLQGSLGPPGPQGSKGNEGKIGPVGPAGSPGSPGLIGEIGERGENGPFGNPGPQGPRGLRGSAG 344

HSP 7 Score: 51.6026 bits (122), Expect = 7.51966e-06
Identity = 48/108 (44.44%), Postives = 55/108 (50.93%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQR------GFPGELGVH 5771
G++GK G G G G G G LGPAG GK G+PG G PG G L+G+ G DG G G PG GP G GK GP G PG GQ+ G PG G+
Sbjct: 491 GVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNG------LSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGIS 592

HSP 8 Score: 51.6026 bits (122), Expect = 7.51966e-06
Identity = 48/108 (44.44%), Postives = 55/108 (50.93%), Query Frame = -3
Query: 2390 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQR------GFPGELGVH 2695
G++GK G G G G G G LGPAG GK G+PG G PG G L+G+ G DG G G PG GP G GK GP G PG GQ+ G PG G+
Sbjct: 491 GVVGKPGQQGSEGKLGPEGLVGNLGPAGQPGKEGTPGPDGKPGTNG------LSGKDGEDGDSGPVGAPGADGPQGPKGKDGPPGFPGLIGQKGETGINGLPGRRGIS 592
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15029208 (SmedSxlregen_c102983_g1_i1|m.43148|m.11576)

HSP 1 Score: 190.274 bits (482), Expect = 4.87852e-48
Identity = 88/227 (38.77%), Postives = 126/227 (55.51%), Query Frame = 3
Query: 7404 MYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGH-SWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL-ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGV-TIISKNDSQFGLKFEEVCFS* 8075
+ DD++ K LG +V+K P GTKD+PA+TCK L +NPN DG Y+IDPN G+ DDA +V C+ ++++CI+P +K W ++ + SW +T + Y I SQL FLK +S A QR+T C ++GN P +L +D D + N KY+VI D C+ T +E+ +A PIRD+ + T SK QFGL +VCFS*
Sbjct: 1099 LLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNS------EHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS* 1319

HSP 2 Score: 190.274 bits (482), Expect = 4.87852e-48
Identity = 88/227 (38.77%), Postives = 126/227 (55.51%), Query Frame = -3
Query:   86 MYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGH-SWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL-ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGV-TIISKNDSQFGLKFEEVCFS* 757
+ DD++ K LG +V+K P GTKD+PA+TCK L +NPN DG Y+IDPN G+ DDA +V C+ ++++CI+P +K W ++ + SW +T + Y I SQL FLK +S A QR+T C ++GN P +L +D D + N KY+VI D C+ T +E+ +A PIRD+ + T SK QFGL +VCFS*
Sbjct: 1099 LLNDDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNS------EHPVILYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS* 1319

HSP 3 Score: 54.6842 bits (130), Expect = 8.81592e-07
Identity = 46/100 (46.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G+ G G G+ G GI GP G LGP +G G+PG RG G GPVG G G +G G G QG PG GP G PG GP G G+ G G G +G
Sbjct: 156 GVKGDKGQRGRMGKDGILGPRGNLGP---QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIG 252

HSP 4 Score: 54.6842 bits (130), Expect = 8.81592e-07
Identity = 46/100 (46.00%), Postives = 53/100 (53.00%), Query Frame = -3
Query: 2396 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2695
G+ G G G+ G GI GP G LGP +G G+PG RG G GPVG G G +G G G QG PG GP G PG GP G G+ G G G +G
Sbjct: 156 GVKGDKGQRGRMGKDGILGPRGNLGP---QGPTGAPGRRGTVGSPGPVGNAGHPGVQGISGRPGNQGEPGMQGPPGLPGLRGPEGEKGSQGGLGIKGSIG 252
BLAST of collagen vs. Smed Unigenes AA
Match: SMU15040144 (dd_smedV4_740_0_1|m.36260|m.3408)

HSP 1 Score: 184.496 bits (467), Expect = 2.67258e-46
Identity = 87/226 (38.50%), Postives = 126/226 (55.75%), Query Frame = 3
Query: 7404 MYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL-ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIISKND-SQFGLKFEEVCFS* 8075
MY DD+ A +LG + I P GTKD+PA++C HL ++ + DG Y+IDPN G+++DA +VFCK+ +TCI P + + N + L+ Y I N+QL FLK S +A Q + C+N + + K P ++ D++ L + L Y VI D+CQ S EAETV+ VS D+ PIRD +T+ S +D S+F LK +VCFS*
Sbjct: 1101 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAV------VEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRD--LTLGSDSDISEFRLKLSKVCFS* 1318

HSP 2 Score: 184.496 bits (467), Expect = 2.67258e-46
Identity = 87/226 (38.50%), Postives = 126/226 (55.75%), Query Frame = -3
Query:   86 MYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL-ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIRDVGVTIISKND-SQFGLKFEEVCFS* 757
MY DD+ A +LG + I P GTKD+PA++C HL ++ + DG Y+IDPN G+++DA +VFCK+ +TCI P + + N + L+ Y I N+QL FLK S +A Q + C+N + + K P ++ D++ L + L Y VI D+CQ S EAETV+ VS D+ PIRD +T+ S +D S+F LK +VCFS*
Sbjct: 1101 MYSDDANAANILGSDTISVPLGTKDLPARSCNHLKSTSSHLKDGTYFIDPNGGKMNDAFEVFCKMETGETCISPKQSSFSKISYSENPINKYISYGELSGIQRFDYVIDNTQLMFLKMVSTRANQEIKIACNNMAV------VEKTEYPAIIFTDNNRELTKDDHHLSYKVIKDECQNMSSEEAETVLLVSGDSKRLPIRD--LTLGSDSDISEFRLKLSKVCFS* 1318

HSP 3 Score: 55.8398 bits (133), Expect = 4.60885e-07
Identity = 57/116 (49.14%), Postives = 70/116 (60.34%), Query Frame = 3
Query: 4380 AAGSTGFMGKDGVRGPPGLIGPAGKPXXXXXXXXXXXXXXXXXXXEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGIT 4727
A G G GK+G+ PG +GP GKPG GK G G G GP GEPG G MG +G+ GPPG G G+ GDPG PG G G++G G+ GPKGP GP+G+ G+ G G+T
Sbjct: 954 AEGPVGPAGKEGL---PGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPT---GPNGEMGLMGPMGVT 1063

HSP 4 Score: 55.8398 bits (133), Expect = 4.60885e-07
Identity = 57/116 (49.14%), Postives = 70/116 (60.34%), Query Frame = -3
Query: 3434 AAGSTGFMGKDGVRGPPGLIGPAGKPXXXXXXXXXXXXXXXXXXGEPGLTGSMGQEGVAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQGITGNRGIT 3781
A G G GK+G+ PG +GP GKPG GK G G G GP GEPG G MG +G+ GPPG G G+ GDPG PG G G++G G+ GPKGP GP+G+ G+ G G+T
Sbjct: 954 AEGPVGPAGKEGL---PGKVGPLGKPGKPGKEGKPGKDGKTGPVGEPGHPGWMGPQGLLGPPGPQGDRGKPGDPGSPGIEGSPGDVGDQGVPGPKGPT---GPNGEMGLMGPMGVT 1063

HSP 5 Score: 52.7582 bits (125), Expect = 3.75162e-06
Identity = 51/118 (43.22%), Postives = 61/118 (51.69%), Query Frame = 3
Query: 5460 LAGILGKDGDLGKSGPAGIRG---------PPGELGPAGGKG------KIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 5768
L G++G G G SGP G+ G PPG LGP G G +IG+PG RGIPG G G G G G+ G +G G PG G +G+PG GP GS G G PG+ GV
Sbjct: 308 LDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGL---AGLPGKDGV 422

HSP 6 Score: 52.7582 bits (125), Expect = 3.75162e-06
Identity = 51/118 (43.22%), Postives = 61/118 (51.69%), Query Frame = -3
Query: 2393 LAGILGKDGDLGKSGPAGIRG---------PPGELGPAGGKG------KIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 2701
L G++G G G SGP G+ G PPG LGP G G +IG+PG RGIPG G G G G G+ G +G G PG G +G+PG GP GS G G PG+ GV
Sbjct: 308 LDGMIGIQGVKGDSGPQGLNGRSGIIGSVGPPGSLGPIGNPGNRGDPGRIGTPGTRGIPGTKGSQGPNGPPGINGSPGADGRDGLPGIDGANGKPGSRGPRGSQGL---AGLPGKDGV 422
BLAST of collagen vs. RefSeq Human
Match: gi|48762934|ref|NP_000080.2| (collagen alpha-2(I) chain precursor [Homo sapiens])

HSP 1 Score: 138.658 bits (348), Expect = 1.38886e-31
Identity = 62/220 (28.18%), Postives = 111/220 (50.45%), Query Frame = 3
Query: 7446 NVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFN-GHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL--ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
+ P+G++ PA+TC+ L +S+P G YWIDPN G DA+KV+C S +TCI+ +I K W+ ++ + H W+ T+ ++ +Y++ +QL+F++ + A Q +T+ C N I D + + +L ++D ++ + + YTV+ D C + +T+IE +N + P D+ I D +F + VCF
Sbjct: 1147 ETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNS-IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365

HSP 2 Score: 138.658 bits (348), Expect = 1.38886e-31
Identity = 62/220 (28.18%), Postives = 111/220 (50.45%), Query Frame = -3
Query:   92 NVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFN-GHSWI-HTLTKKNEVKYSIPN-------SQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLL--ADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 715
+ P+G++ PA+TC+ L +S+P G YWIDPN G DA+KV+C S +TCI+ +I K W+ ++ + H W+ T+ ++ +Y++ +QL+F++ + A Q +T+ C N I D + + +L ++D ++ + + YTV+ D C + +T+IE +N + P D+ I D +F + VCF
Sbjct: 1147 ETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNS-IAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365

HSP 3 Score: 58.9214 bits (141), Expect = 2.49572e-07
Identity = 50/110 (45.45%), Postives = 62/110 (56.36%), Query Frame = 3
Query: 5463 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGH------EGGQGTPGFV------GPSGEPGKSGPVGSPGAGGQRGFPG 5756
AG++G G G SGPAG+RGP G+ G G G +G GL G PG+ GP GK+G G G DG G +G PG + GP+G+PGK+G G G G RG PG
Sbjct: 414 AGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPG 523

HSP 4 Score: 58.9214 bits (141), Expect = 2.49572e-07
Identity = 50/110 (45.45%), Postives = 62/110 (56.36%), Query Frame = -3
Query: 2405 AGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGH------EGGQGTPGFV------GPSGEPGKSGPVGSPGAGGQRGFPG 2698
AG++G G G SGPAG+RGP G+ G G G +G GL G PG+ GP GK+G G G DG G +G PG + GP+G+PGK+G G G G RG PG
Sbjct: 414 AGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPG 523

HSP 5 Score: 56.9954 bits (136), Expect = 1.0097e-06
Identity = 48/106 (45.28%), Postives = 59/106 (55.66%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDG------HEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G GK G+ G++GP+G GP G +GP G G G G +G PG+ GP G GL G G G H G QG PG VGP+G G +GP G G G+ G PG +G
Sbjct: 970 GPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVG 1075

HSP 6 Score: 56.9954 bits (136), Expect = 1.0097e-06
Identity = 48/106 (45.28%), Postives = 59/106 (55.66%), Query Frame = -3
Query: 2396 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDG------HEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2695
G GK G+ G++GP+G GP G +GP G G G G +G PG+ GP G GL G G G H G QG PG VGP+G G +GP G G G+ G PG +G
Sbjct: 970 GPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVG 1075

HSP 7 Score: 54.299 bits (129), Expect = 7.3635e-06
Identity = 49/114 (42.98%), Postives = 61/114 (53.51%), Query Frame = 3
Query: 5460 LAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQ------------GLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G G+ G+ G++GPAG RGP GP G G+ G PG G PG+ G VG Q G G +G++G +G +G PG G GEPG G G+PG G RG PGE G
Sbjct: 113 FQGPAGEPGEPGQTGPAGARGP---AGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERG 223

HSP 8 Score: 54.299 bits (129), Expect = 7.3635e-06
Identity = 49/114 (42.98%), Postives = 61/114 (53.51%), Query Frame = -3
Query: 2396 LAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQ------------GLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2701
G G+ G+ G++GPAG RGP GP G G+ G PG G PG+ G VG Q G G +G++G +G +G PG G GEPG G G+PG G RG PGE G
Sbjct: 113 FQGPAGEPGEPGQTGPAGARGP---AGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERG 223
BLAST of collagen vs. RefSeq Human
Match: gi|111118974|ref|NP_149162.2| (collagen alpha-1(II) chain isoform 2 precursor [Homo sapiens])

HSP 1 Score: 137.887 bits (346), Expect = 2.54357e-31
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 1167 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1417

HSP 2 Score: 137.887 bits (346), Expect = 2.54357e-31
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = -3
Query:   92 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 796
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 1167 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1417
BLAST of collagen vs. RefSeq Human
Match: gi|111118976|ref|NP_001835.3| (collagen alpha-1(II) chain isoform 1 precursor [Homo sapiens])

HSP 1 Score: 135.576 bits (340), Expect = 1.21456e-30
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 1236 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1486

HSP 2 Score: 135.576 bits (340), Expect = 1.21456e-30
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = -3
Query:   92 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 796
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 1236 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1486
BLAST of collagen vs. RefSeq Human
Match: gi|767973253|ref|XP_011536237.1| (PREDICTED: collagen alpha-1(II) chain isoform X3 [Homo sapiens])

HSP 1 Score: 135.576 bits (340), Expect = 1.2618e-30
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 932 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1182

HSP 2 Score: 135.576 bits (340), Expect = 1.2618e-30
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = -3
Query:   92 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 796
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 932 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1182
BLAST of collagen vs. RefSeq Human
Match: gi|767973251|ref|XP_011536236.1| (PREDICTED: collagen alpha-1(II) chain isoform X2 [Homo sapiens])

HSP 1 Score: 135.576 bits (340), Expect = 1.57126e-30
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = 3
Query: 7365 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 8069
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 1283 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1533

HSP 2 Score: 135.576 bits (340), Expect = 1.57126e-30
Identity = 67/251 (26.69%), Postives = 113/251 (45.02%), Query Frame = -3
Query:   92 VMAMQMRSPTKGIMYGDDSMTAKLLGGN----VIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWIDPNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNF--NGHSW--------IHTLTKKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSPRLLADDDSILRIN-HPKLKYTVITDDCQYGKSSEAETVIEV-SNDANIFPIRDVGVTIISKNDSQFGLKFEEVCF 796
+ M+ G+ D + A L N I++P+G++ PA+TC+ L + +P G+YWIDPN G DA+KVFC + +TC+ P ++ K W ++ H W H + + + N Q++FL+ S + Q +T+ C N ++ N + + +D +R + + YT + D C +TVIE S + PI D+ I + +FG+ VCF
Sbjct: 1283 LQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1533
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|386765914|ref|NP_001247142.1| (CG42342, isoform K [Drosophila melanogaster])

HSP 1 Score: 53.9138 bits (128), Expect = 2.41198e-06
Identity = 43/97 (44.33%), Postives = 56/97 (57.73%), Query Frame = 3
Query: 5484 GDLGKSGPAGIRGPPGELGPAGGKGKIGSPG---LRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G G+ G G +G PGE G G +G +G PG +RG G +GP GK G+ G +G GH+G +G PG G G PG+ GP G G+ G G PG+ G
Sbjct: 610 GSQGERGLDGRKGDPGEKGHKGDQGPMGLPGPMGMRGESGPSGPSGKAGIPGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRG 706

HSP 2 Score: 53.9138 bits (128), Expect = 2.41198e-06
Identity = 43/97 (44.33%), Postives = 56/97 (57.73%), Query Frame = -3
Query: 2396 GDLGKSGPAGIRGPPGELGPAGGKGKIGSPG---LRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2677
G G+ G G +G PGE G G +G +G PG +RG G +GP GK G+ G +G GH+G +G PG G G PG+ GP G G+ G G PG+ G
Sbjct: 610 GSQGERGLDGRKGDPGEKGHKGDQGPMGLPGPMGMRGESGPSGPSGKAGIPGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRG 706
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581820|ref|NP_723044.1| (collagen type IV, isoform A [Drosophila melanogaster])

HSP 1 Score: 53.9138 bits (128), Expect = 2.53521e-06
Identity = 46/101 (45.54%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 5768
GI+G+ GD+G GPAG+ GPPG G G +G+ G+ G G PG G G +G G GNDG +G F G +G PGK GP G PG G +G G G+
Sbjct: 905 GIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKG------FAGVTGAPGKRGPAGIPGVSGAKGDKGATGL 999

HSP 2 Score: 53.9138 bits (128), Expect = 2.53521e-06
Identity = 46/101 (45.54%), Postives = 58/101 (57.43%), Query Frame = -3
Query: 2393 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 2695
GI+G+ GD+G GPAG+ GPPG G G +G+ G+ G G PG G G +G G GNDG +G F G +G PGK GP G PG G +G G G+
Sbjct: 905 GIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKG------FAGVTGAPGKRGPAGIPGVSGAKGDKGATGL 999
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581822|ref|NP_723045.1| (collagen type IV, isoform B [Drosophila melanogaster])

HSP 1 Score: 53.9138 bits (128), Expect = 2.53521e-06
Identity = 46/101 (45.54%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 5768
GI+G+ GD+G GPAG+ GPPG G G +G+ G+ G G PG G G +G G GNDG +G F G +G PGK GP G PG G +G G G+
Sbjct: 905 GIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKG------FAGVTGAPGKRGPAGIPGVSGAKGDKGATGL 999

HSP 2 Score: 53.9138 bits (128), Expect = 2.53521e-06
Identity = 46/101 (45.54%), Postives = 58/101 (57.43%), Query Frame = -3
Query: 2393 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 2695
GI+G+ GD+G GPAG+ GPPG G G +G+ G+ G G PG G G +G G GNDG +G F G +G PGK GP G PG G +G G G+
Sbjct: 905 GIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKG------FAGVTGAPGKRGPAGIPGVSGAKGDKGATGL 999
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|24581824|ref|NP_723046.1| (collagen type IV, isoform C [Drosophila melanogaster])

HSP 1 Score: 53.9138 bits (128), Expect = 2.53521e-06
Identity = 46/101 (45.54%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 5466 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 5768
GI+G+ GD+G GPAG+ GPPG G G +G+ G+ G G PG G G +G G GNDG +G F G +G PGK GP G PG G +G G G+
Sbjct: 905 GIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKG------FAGVTGAPGKRGPAGIPGVSGAKGDKGATGL 999

HSP 2 Score: 53.9138 bits (128), Expect = 2.53521e-06
Identity = 46/101 (45.54%), Postives = 58/101 (57.43%), Query Frame = -3
Query: 2393 GILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELGV 2695
GI+G+ GD+G GPAG+ GPPG G G +G+ G+ G G PG G G +G G GNDG +G F G +G PGK GP G PG G +G G G+
Sbjct: 905 GIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKG------FAGVTGAPGKRGPAGIPGVSGAKGDKGATGL 999
BLAST of collagen vs. RefSeq Drosophila melanogaster
Match: gi|221379525|ref|NP_001138061.1| (CG42342, isoform D [Drosophila melanogaster])

HSP 1 Score: 53.9138 bits (128), Expect = 2.60749e-06
Identity = 43/97 (44.33%), Postives = 56/97 (57.73%), Query Frame = 3
Query: 5484 GDLGKSGPAGIRGPPGELGPAGGKGKIGSPG---LRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 5765
G G+ G G +G PGE G G +G +G PG +RG G +GP GK G+ G +G GH+G +G PG G G PG+ GP G G+ G G PG+ G
Sbjct: 633 GSQGERGLDGRKGDPGEKGHKGDQGPMGLPGPMGMRGESGPSGPSGKAGIPGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRG 729

HSP 2 Score: 53.9138 bits (128), Expect = 2.60749e-06
Identity = 43/97 (44.33%), Postives = 56/97 (57.73%), Query Frame = -3
Query: 2396 GDLGKSGPAGIRGPPGELGPAGGKGKIGSPG---LRGIPGDTGPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGFPGELG 2677
G G+ G G +G PGE G G +G +G PG +RG G +GP GK G+ G +G GH+G +G PG G G PG+ GP G G+ G G PG+ G
Sbjct: 633 GSQGERGLDGRKGDPGEKGHKGDQGPMGLPGPMGMRGESGPSGPSGKAGIPGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRG 729
The following BLAST results are available for this feature:
BLAST of collagen vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|18202250|sp|O93484|CO1A2_ONCMY4.045250e-3432.42RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|8039779|sp|P02465|CO1A2_BOVIN3.761800e-3329.48RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|8134352|sp|O46392|CO1A2_CANFA3.336630e-3228.69RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|18202034|sp|O42350|CO1A2_LITCT1.430000e-3130.45RecName: Full=Collagen alpha-2(I) chain; AltName: ... [more]
gi|82202407|sp|Q6P4Z2|CO2A1_XENTR2.397400e-3130.90RecName: Full=Collagen alpha-1(II) chain; AltName:... [more]
back to top
BLAST of collagen vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150400333.350570e-10564.56dd_smedV4_702_0_1|m.35199|m.6295[more]
SMU150022719.941340e-7048.50Asxlregen_comp67208_c0_seq1|m.27270|m.10319[more]
SMU150364697.599180e-5038.08dd_smedV4_1070_0_1|m.1593|m.7941[more]
SMU150292084.878520e-4838.77SmedSxlregen_c102983_g1_i1|m.43148|m.11576[more]
SMU150401442.672580e-4638.50dd_smedV4_740_0_1|m.36260|m.3408[more]
back to top
BLAST of collagen vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|48762934|ref|NP_000080.2|1.388860e-3128.18collagen alpha-2(I) chain precursor [Homo sapiens][more]
gi|111118974|ref|NP_149162.2|2.543570e-3126.69collagen alpha-1(II) chain isoform 2 precursor [Ho... [more]
gi|111118976|ref|NP_001835.3|1.214560e-3026.69collagen alpha-1(II) chain isoform 1 precursor [Ho... [more]
gi|767973253|ref|XP_011536237.1|1.261800e-3026.69PREDICTED: collagen alpha-1(II) chain isoform X3 [... [more]
gi|767973251|ref|XP_011536236.1|1.571260e-3026.69PREDICTED: collagen alpha-1(II) chain isoform X2 [... [more]
back to top
BLAST of collagen vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|386765914|ref|NP_001247142.1|2.411980e-644.33CG42342, isoform K [Drosophila melanogaster][more]
gi|24581820|ref|NP_723044.1|2.535210e-645.54collagen type IV, isoform A [Drosophila melanogast... [more]
gi|24581822|ref|NP_723045.1|2.535210e-645.54collagen type IV, isoform B [Drosophila melanogast... [more]
gi|24581824|ref|NP_723046.1|2.535210e-645.54collagen type IV, isoform C [Drosophila melanogast... [more]
gi|221379525|ref|NP_001138061.1|2.607490e-644.33CG42342, isoform D [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_027332 ID=Pmo_027332|Name=collagen|organism=Phagocata morgani|type=mRNA|length=8160bp
TTTTTTTTTAAAAATAAGCAACATATAATATAACTTACAATACCATGCAC
ACCATTATACACAGAACACTGTCATTGTTATTATTTTATGAAAAACAGAC
TTCTTCAAATTTCAATCCAAATTGGCTGTCATTCTTACTGATAATAGTTA
CGCCGACATCACGGATGGGAAATATGTTGGCATCGTTTGATACTTCTATT
ACAGTTTCGGCTTCACTGGATTTTCCATACTGACAGTCGTCCGTGATAAC
TGTGTACTTCAATTTGGGATGGTTTATTCTCAAAATACTATCGTCATCCG
CAAGAAGACGTGGAGATGTAACTTTGTTAATTTTTCCATCATTTCCAATA
ATTGGATGATTGTCACACGTAAATGTTACCCGCTGAATAGCCTTTTCACT
GTAAGCTTTTAAAAATGATAGTTGACTGTTAGGTATGGAATATTTGACCT
CATTTTTCTTCGTCAAAGTGTGAATCCAAGAATGCCCATTAAAATTAGTG
GTGTGCCATTTCTTAATTGCGATATCCCCATCGATTGGTTTAATACACGT
TTGCTGTTTGGATATTTTGCAGAATACTTTAACTGCATCGTCAATTCGTC
CACTATTAGGATCGATCCAATATTCTCCGTCTGGTTTATTAGGATTACTC
ACACTCAAATGCTTGCATGTTTTCGCTGGTACATCTTTTGTTCCTTGAGG
ATTTTTAATAACGTTTCCCCCAAGTAACTTCGCGGTCATTGAATCATCTC
CATACATTATTCCTTTAGTTGGTGATCTCATTTGCATGGCCATTACTCCA
CCTGGTGGTCCAGGGGGCCCTGGTGGACCAATAGGACCCCTCTGGCCAAT
AGGGCCACTTTCTCCTTGTCTCCCCGGTAATCCGGGAACACCTATAGGTC
CAAGAACACCAGGATCTCCACGCGGACCAATCACTCCCGTGGGACCAGTT
GGTCCTTCTGTACCTGATGGACCAGGAGGTCCGTCGGGACCTGAGAAACC
AGTTGGTCCTCTGTCACCATCTGATCCTGTTGGTCCATCAAAACCGGGAC
TTCCTTTAGGTCCTTTAACTCCCGGAAGCCCTCGTGAACCTGGACGTCCA
GCTTGTCCTGGTTTTCCATTTGCTCCTGAAACTCCTTTATCGCCGACCAA
GCCAGCTTCTCCTAATGCTCCATTAGGTCCTAGTTCCCCAGCATCTCCTG
GATCGCCAGAGGGACCGGGTTTACCCAGAGCACCTCTAGAACCAGGCACT
CCTGGAAATCCTCCAGATCCAGCTTTTCCAGGTTTCCCTTTTGCACCAGG
TTTGCCTTTTCCACCCGGTCCCCCAGGTGGGCCTGGTGCTCCAACAGTTC
CAGGATTTCCGGGTGGACCATCCATTCCAACTGGCCCGGGAACACCAAGT
TCGCCATAATCGCCAGTTAAACCCTCACTACCAGGGAGACCCGGTTTTCC
TGGTTTACCTAGACTTCCTTGTGGGCCAGAAGGACCAGGCGATCCCATTA
CTCCAGGGTCTCCTGTAGTTCCATCAGGGCCTGGCTTGCCATCAGTTCCA
GGGGCTCCTGTCTTTCCTTTATCACCCTGTGGACCTCTAAGGCCTAATGG
ACCTTTGCGTCCATTTGCCCCATTCATTCCAGGTACACCTGGAACGCCTA
GTCCTCCAGGTTTTCCAACTGGTCCTTCTTTACCAGGATCGCCTTGCTTT
CCTTGTTTTCCAGGTAAACCTAGATTGCCATCTCGTCCTGGTAAACCAAC
TGGTCCAGGAGCTCCTGAAATACCAGAATCTCCTGCTTCTCCGGCAGGTC
CAGGGGCACCTACACTTCCTTCTAATCCCATTGGTCCTAAAAGTCCTGGC
TTTCCAGGAGCTCCCAGAGCACCTGATTTCCCTTCTTCGCCGTCAGGCCC
AGGAGCTCCGGCATCGCCAGGATCACCAGCATCTCCATCAGGACCAGTTG
CGCCAGGTTTACCACTTGGACCAACTTCTCCTGGAACGCCATCAAGCCCC
GGTTTACCAGTTTCCCCCTTCGGACCTGCAGGGCCTGCTCCTCTGGGCTG
TGGTTTGCTTATTCGAGGATTGCCTGGTGGTCCAGGATCACCACTTTCTC
CTGGAGGTCCCTTTGGACCAGGTAAACCAGGTAGACCTGGAATTCCATCA
AGACCAGATTTTCCAATTGGTCCTTGTTTACCAAGTGTTCCCTCGGGACC
GGGTGCACCGTTTGGGCCATATGTGCCGGGAACTCCAAGAACGCCACTTG
GTCCAGTTATTCCTCTTGCTCCAATAGGTCCATTATCACCTCTATCACCG
TCAGGACCTGGTGCTCCGATTATTCCTACCGGACCAGGTGCACCAGGCTT
TCCTGGTTTACCATTATTTCCAGGGGCTCCATTTTTACCATGAACTCCAA
GTTCTCCAGGAAATCCTCGTTGTCCTCCTGCTCCGGGAGAACCAACAGGA
CCACTTTTCCCTGGCTCACCAGATGGCCCAACAAATCCTGGAGTACCCTG
ACCACCTTCGTGACCATCATTGCCTTTCTGTCCAGCTAAACCTTGCTTCC
CCACGGGACCAGTATCTCCTGGAATTCCTCGTAGTCCTGGCGAACCAATT
TTACCTTTTCCTCCAGCCGGTCCTAGTTCACCCGGTGGTCCCCTTATTCC
AGCTGGTCCGGATTTTCCTAGATCTCCATCCTTCCCAAGAATTCCCGCTA
ATCCTGGCTGTCCTGGGGGACCCGGGGGACCTGGACTTCCTTTAGCTCCA
GGCATGCCATCATTACCACCAGGTCCTGGCTCGCCTCTAGGTCCCGGAGT
TCCGTTTGGTCCTGGACGACCAAGTGGGCCTGGTTGACCAGTTGGTCCAG
TACCACCTGGATTCCCTGAAGTTCCTGGAGGGCCATTTTTTCCCAATACT
CCATTCTGTCCTGGAGTTCCAGGACTACCATTTGGTCCAATTTCTCCTCT
AACTCCTTTTGTACCAGGTTTGCCTTCCATTCCCAATGGTCCTTCTGGAC
CATTTTCACCGATTTGACCTGGCCGACCTCTGTCACCTTTCAATCCATTT
GGTCCTTTATTTCCGGGTTTCCCTTCTAGACCGATAGGACCTTGATCCCC
CTCTGATCCTTTTGGTCCAACTTCACCGGGATTTCCAATGATGCCTCTTG
AGCCTCTTTGTCCAGATGGACCCTGAGAACCCATTACGCCGATATTGCCT
GGATTGCCTCTTCTTCCCTGTTGGCCGTCTTTACCAGGTGTTCCAGCTAT
TCCAATCGGACCCAGCTTTCCAGGCTTCGCATTTAATCCCGGCTTTCCAG
AACTACCTTTTCCTCCTTTTCGGCCTTCACTTCCCTTTTCCCCCTTATTA
CCCATTTCTCCAGGATTTCCTGGAGGTCCTTTAGGGCCCATCTTACCTTG
TGGACCCGGAGGACCAACCTTTCCATCTGGTCCAGTTATACCACGATTGC
CTGTAATTCCTTGCTTTCCGCTTGGCCCAGGCTGGCCAATTGGACCTTTT
GGCCCTACGATACCAGTTGGGCCAATATTACCAACGTCACCCATTTCTCC
AGGAAGACCCGGATCACCCTTTTCTCCTATTAATCCAGGATATCCAGGAG
GTCCCGCAACTCCTTCTTGGCCCATTGATCCTGTTAAACCGGGTTCCCCA
CGAGGACCAGGAGATCCGGCAACACCAGCAACACCTGCCTTCCCATCACT
TCCTGGCTTACCCGCCGGTCCAATAAGTCCTGGAGGTCCTCTAACTCCAT
CCTTTCCCATGAACCCCGTTGATCCGGCTGCTCCTATATCACCATCTGGT
CCTGGTTTTCCTTGTGGACCCGGATTTCCTCTTATCCCTGGTGGCCCCAC
TGCCTCTTGTAAAGATTTAAATTGACCAAACGCAATTTGGATGCAGCTAA
GAATGCCCAAAAAAAACACCGAGCCAGAAGGTGTGAATGAGCATTTAATT
AAATTCCGTGATAAATATAATATAGATCCACGTATTAAATTATCGTAATA
TTATTAAGAGCAATCTATGGACGATGCAGCTTAATCCAAATGGAGAAAAT
TTCTTCACCAATCATAAGGGCACATTTTAGCTAAAATGTGCCCTTATGAT
TGGTGAAGAAATTTTCTCCATTTGGATTAAGCTGCATCGTCCATAGATTG
CTCTTAATAATATTACGATAATTTAATACGTGGATCTATATTATATTTAT
CACGGAATTTAATTAAATGCTCATTCACACCTTCTGGCTCGGTGTTTTTT
TTGGGCATTCTTAGCTGCATCCAAATTGCGTTTGGTCAATTTAAATCTTT
ACAAGAGGCAGTGGGGCCACCAGGGATAAGAGGAAATCCGGGTCCACAAG
GAAAACCAGGACCAGATGGTGATATAGGAGCAGCCGGATCAACGGGGTTC
ATGGGAAAGGATGGAGTTAGAGGACCTCCAGGACTTATTGGACCGGCGGG
TAAGCCAGGAAGTGATGGGAAGGCAGGTGTTGCTGGTGTTGCCGGATCTC
CTGGTCCTCGTGGGGAACCCGGTTTAACAGGATCAATGGGCCAAGAAGGA
GTTGCGGGACCTCCTGGATATCCTGGATTAATAGGAGAAAAGGGTGATCC
GGGTCTTCCTGGAGAAATGGGTGACGTTGGTAATATTGGCCCAACTGGTA
TCGTAGGGCCAAAAGGTCCAATTGGCCAGCCTGGGCCAAGCGGAAAGCAA
GGAATTACAGGCAATCGTGGTATAACTGGACCAGATGGAAAGGTTGGTCC
TCCGGGTCCACAAGGTAAGATGGGCCCTAAAGGACCTCCAGGAAATCCTG
GAGAAATGGGTAATAAGGGGGAAAAGGGAAGTGAAGGCCGAAAAGGAGGA
AAAGGTAGTTCTGGAAAGCCGGGATTAAATGCGAAGCCTGGAAAGCTGGG
TCCGATTGGAATAGCTGGAACACCTGGTAAAGACGGCCAACAGGGAAGAA
GAGGCAATCCAGGCAATATCGGCGTAATGGGTTCTCAGGGTCCATCTGGA
CAAAGAGGCTCAAGAGGCATCATTGGAAATCCCGGTGAAGTTGGACCAAA
AGGATCAGAGGGGGATCAAGGTCCTATCGGTCTAGAAGGGAAACCCGGAA
ATAAAGGACCAAATGGATTGAAAGGTGACAGAGGTCGGCCAGGTCAAATC
GGTGAAAATGGTCCAGAAGGACCATTGGGAATGGAAGGCAAACCTGGTAC
AAAAGGAGTTAGAGGAGAAATTGGACCAAATGGTAGTCCTGGAACTCCAG
GACAGAATGGAGTATTGGGAAAAAATGGCCCTCCAGGAACTTCAGGGAAT
CCAGGTGGTACTGGACCAACTGGTCAACCAGGCCCACTTGGTCGTCCAGG
ACCAAACGGAACTCCGGGACCTAGAGGCGAGCCAGGACCTGGTGGTAATG
ATGGCATGCCTGGAGCTAAAGGAAGTCCAGGTCCCCCGGGTCCCCCAGGA
CAGCCAGGATTAGCGGGAATTCTTGGGAAGGATGGAGATCTAGGAAAATC
CGGACCAGCTGGAATAAGGGGACCACCGGGTGAACTAGGACCGGCTGGAG
GAAAAGGTAAAATTGGTTCGCCAGGACTACGAGGAATTCCAGGAGATACT
GGTCCCGTGGGGAAGCAAGGTTTAGCTGGACAGAAAGGCAATGATGGTCA
CGAAGGTGGTCAGGGTACTCCAGGATTTGTTGGGCCATCTGGTGAGCCAG
GGAAAAGTGGTCCTGTTGGTTCTCCCGGAGCAGGAGGACAACGAGGATTT
CCTGGAGAACTTGGAGTTCATGGTAAAAATGGAGCCCCTGGAAATAATGG
TAAACCAGGAAAGCCTGGTGCACCTGGTCCGGTAGGAATAATCGGAGCAC
CAGGTCCTGACGGTGATAGAGGTGATAATGGACCTATTGGAGCAAGAGGA
ATAACTGGACCAAGTGGCGTTCTTGGAGTTCCCGGCACATATGGCCCAAA
CGGTGCACCCGGTCCCGAGGGAACACTTGGTAAACAAGGACCAATTGGAA
AATCTGGTCTTGATGGAATTCCAGGTCTACCTGGTTTACCTGGTCCAAAG
GGACCTCCAGGAGAAAGTGGTGATCCTGGACCACCAGGCAATCCTCGAAT
AAGCAAACCACAGCCCAGAGGAGCAGGCCCTGCAGGTCCGAAGGGGGAAA
CTGGTAAACCGGGGCTTGATGGCGTTCCAGGAGAAGTTGGTCCAAGTGGT
AAACCTGGCGCAACTGGTCCTGATGGAGATGCTGGTGATCCTGGCGATGC
CGGAGCTCCTGGGCCTGACGGCGAAGAAGGGAAATCAGGTGCTCTGGGAG
CTCCTGGAAAGCCAGGACTTTTAGGACCAATGGGATTAGAAGGAAGTGTA
GGTGCCCCTGGACCTGCCGGAGAAGCAGGAGATTCTGGTATTTCAGGAGC
TCCTGGACCAGTTGGTTTACCAGGACGAGATGGCAATCTAGGTTTACCTG
GAAAACAAGGAAAGCAAGGCGATCCTGGTAAAGAAGGACCAGTTGGAAAA
CCTGGAGGACTAGGCGTTCCAGGTGTACCTGGAATGAATGGGGCAAATGG
ACGCAAAGGTCCATTAGGCCTTAGAGGTCCACAGGGTGATAAAGGAAAGA
CAGGAGCCCCTGGAACTGATGGCAAGCCAGGCCCTGATGGAACTACAGGA
GACCCTGGAGTAATGGGATCGCCTGGTCCTTCTGGCCCACAAGGAAGTCT
AGGTAAACCAGGAAAACCGGGTCTCCCTGGTAGTGAGGGTTTAACTGGCG
ATTATGGCGAACTTGGTGTTCCCGGGCCAGTTGGAATGGATGGTCCACCC
GGAAATCCTGGAACTGTTGGAGCACCAGGCCCACCTGGGGGACCGGGTGG
AAAAGGCAAACCTGGTGCAAAAGGGAAACCTGGAAAAGCTGGATCTGGAG
GATTTCCAGGAGTGCCTGGTTCTAGAGGTGCTCTGGGTAAACCCGGTCCC
TCTGGCGATCCAGGAGATGCTGGGGAACTAGGACCTAATGGAGCATTAGG
AGAAGCTGGCTTGGTCGGCGATAAAGGAGTTTCAGGAGCAAATGGAAAAC
CAGGACAAGCTGGACGTCCAGGTTCACGAGGGCTTCCGGGAGTTAAAGGA
CCTAAAGGAAGTCCCGGTTTTGATGGACCAACAGGATCAGATGGTGACAG
AGGACCAACTGGTTTCTCAGGTCCCGACGGACCTCCTGGTCCATCAGGTA
CAGAAGGACCAACTGGTCCCACGGGAGTGATTGGTCCGCGTGGAGATCCT
GGTGTTCTTGGACCTATAGGTGTTCCCGGATTACCGGGGAGACAAGGAGA
AAGTGGCCCTATTGGCCAGAGGGGTCCTATTGGTCCACCAGGGCCCCCTG
GACCACCAGGTGGAGTAATGGCCATGCAAATGAGATCACCAACTAAAGGA
ATAATGTATGGAGATGATTCAATGACCGCGAAGTTACTTGGGGGAAACGT
TATTAAAAATCCTCAAGGAACAAAAGATGTACCAGCGAAAACATGCAAGC
ATTTGAGTGTGAGTAATCCTAATAAACCAGACGGAGAATATTGGATCGAT
CCTAATAGTGGACGAATTGACGATGCAGTTAAAGTATTCTGCAAAATATC
CAAACAGCAAACGTGTATTAAACCAATCGATGGGGATATCGCAATTAAGA
AATGGCACACCACTAATTTTAATGGGCATTCTTGGATTCACACTTTGACG
AAGAAAAATGAGGTCAAATATTCCATACCTAACAGTCAACTATCATTTTT
AAAAGCTTACAGTGAAAAGGCTATTCAGCGGGTAACATTTACGTGTGACA
ATCATCCAATTATTGGAAATGATGGAAAAATTAACAAAGTTACATCTCCA
CGTCTTCTTGCGGATGACGATAGTATTTTGAGAATAAACCATCCCAAATT
GAAGTACACAGTTATCACGGACGACTGTCAGTATGGAAAATCCAGTGAAG
CCGAAACTGTAATAGAAGTATCAAACGATGCCAACATATTTCCCATCCGT
GATGTCGGCGTAACTATTATCAGTAAGAATGACAGCCAATTTGGATTGAA
ATTTGAAGAAGTCTGTTTTTCATAAAATAATAACAATGACAGTGTTCTGT
GTATAATGGTGTGCATGGTATTGTAAGTTATATTATATGTTGCTTATTTT
TAAAAAAAAA

Design Primers for collagen

back to top

protein sequence

>Pmo_027332-protein ID=Pmo_027332-protein|Name=collagen|organism=Phagocata morgani|type=polypeptide|length=1225bp
MGKDGVRGPPGLIGPAGKPGSDGKAGVAGVAGSPGPRGEPGLTGSMGQEG
VAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQ
GITGNRGITGPDGKVGPPGPQGKMGPKGPPGNPGEMGNKGEKGSEGRKGG
KGSSGKPGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMGSQGPSG
QRGSRGIIGNPGEVGPKGSEGDQGPIGLEGKPGNKGPNGLKGDRGRPGQI
GENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNGVLGKNGPPGTSGN
PGGTGPTGQPGPLGRPGPNGTPGPRGEPGPGGNDGMPGAKGSPGPPGPPG
QPGLAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDT
GPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGF
PGELGVHGKNGAPGNNGKPGKPGAPGPVGIIGAPGPDGDRGDNGPIGARG
ITGPSGVLGVPGTYGPNGAPGPEGTLGKQGPIGKSGLDGIPGLPGLPGPK
GPPGESGDPGPPGNPRISKPQPRGAGPAGPKGETGKPGLDGVPGEVGPSG
KPGATGPDGDAGDPGDAGAPGPDGEEGKSGALGAPGKPGLLGPMGLEGSV
GAPGPAGEAGDSGISGAPGPVGLPGRDGNLGLPGKQGKQGDPGKEGPVGK
PGGLGVPGVPGMNGANGRKGPLGLRGPQGDKGKTGAPGTDGKPGPDGTTG
DPGVMGSPGPSGPQGSLGKPGKPGLPGSEGLTGDYGELGVPGPVGMDGPP
GNPGTVGAPGPPGGPGGKGKPGAKGKPGKAGSGGFPGVPGSRGALGKPGP
SGDPGDAGELGPNGALGEAGLVGDKGVSGANGKPGQAGRPGSRGLPGVKG
PKGSPGFDGPTGSDGDRGPTGFSGPDGPPGPSGTEGPTGPTGVIGPRGDP
GVLGPIGVPGLPGRQGESGPIGQRGPIGPPGPPGPPGGVMAMQMRSPTKG
IMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWID
PNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLT
KKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSP
RLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIR
DVGVTIISKNDSQFGLKFEEVCFS*
back to top

coding sequence

>Pmo_027332.4401.8075 ID=Pmo_027332.4401.8075|Name=Pmo_027332.4401.8075|organism=Phagocata morgani|type=CDS|length=3675bp
ATGGGAAAGGATGGAGTTAGAGGACCTCCAGGACTTATTGGACCGGCGGG
TAAGCCAGGAAGTGATGGGAAGGCAGGTGTTGCTGGTGTTGCCGGATCTC
CTGGTCCTCGTGGGGAACCCGGTTTAACAGGATCAATGGGCCAAGAAGGA
GTTGCGGGACCTCCTGGATATCCTGGATTAATAGGAGAAAAGGGTGATCC
GGGTCTTCCTGGAGAAATGGGTGACGTTGGTAATATTGGCCCAACTGGTA
TCGTAGGGCCAAAAGGTCCAATTGGCCAGCCTGGGCCAAGCGGAAAGCAA
GGAATTACAGGCAATCGTGGTATAACTGGACCAGATGGAAAGGTTGGTCC
TCCGGGTCCACAAGGTAAGATGGGCCCTAAAGGACCTCCAGGAAATCCTG
GAGAAATGGGTAATAAGGGGGAAAAGGGAAGTGAAGGCCGAAAAGGAGGA
AAAGGTAGTTCTGGAAAGCCGGGATTAAATGCGAAGCCTGGAAAGCTGGG
TCCGATTGGAATAGCTGGAACACCTGGTAAAGACGGCCAACAGGGAAGAA
GAGGCAATCCAGGCAATATCGGCGTAATGGGTTCTCAGGGTCCATCTGGA
CAAAGAGGCTCAAGAGGCATCATTGGAAATCCCGGTGAAGTTGGACCAAA
AGGATCAGAGGGGGATCAAGGTCCTATCGGTCTAGAAGGGAAACCCGGAA
ATAAAGGACCAAATGGATTGAAAGGTGACAGAGGTCGGCCAGGTCAAATC
GGTGAAAATGGTCCAGAAGGACCATTGGGAATGGAAGGCAAACCTGGTAC
AAAAGGAGTTAGAGGAGAAATTGGACCAAATGGTAGTCCTGGAACTCCAG
GACAGAATGGAGTATTGGGAAAAAATGGCCCTCCAGGAACTTCAGGGAAT
CCAGGTGGTACTGGACCAACTGGTCAACCAGGCCCACTTGGTCGTCCAGG
ACCAAACGGAACTCCGGGACCTAGAGGCGAGCCAGGACCTGGTGGTAATG
ATGGCATGCCTGGAGCTAAAGGAAGTCCAGGTCCCCCGGGTCCCCCAGGA
CAGCCAGGATTAGCGGGAATTCTTGGGAAGGATGGAGATCTAGGAAAATC
CGGACCAGCTGGAATAAGGGGACCACCGGGTGAACTAGGACCGGCTGGAG
GAAAAGGTAAAATTGGTTCGCCAGGACTACGAGGAATTCCAGGAGATACT
GGTCCCGTGGGGAAGCAAGGTTTAGCTGGACAGAAAGGCAATGATGGTCA
CGAAGGTGGTCAGGGTACTCCAGGATTTGTTGGGCCATCTGGTGAGCCAG
GGAAAAGTGGTCCTGTTGGTTCTCCCGGAGCAGGAGGACAACGAGGATTT
CCTGGAGAACTTGGAGTTCATGGTAAAAATGGAGCCCCTGGAAATAATGG
TAAACCAGGAAAGCCTGGTGCACCTGGTCCGGTAGGAATAATCGGAGCAC
CAGGTCCTGACGGTGATAGAGGTGATAATGGACCTATTGGAGCAAGAGGA
ATAACTGGACCAAGTGGCGTTCTTGGAGTTCCCGGCACATATGGCCCAAA
CGGTGCACCCGGTCCCGAGGGAACACTTGGTAAACAAGGACCAATTGGAA
AATCTGGTCTTGATGGAATTCCAGGTCTACCTGGTTTACCTGGTCCAAAG
GGACCTCCAGGAGAAAGTGGTGATCCTGGACCACCAGGCAATCCTCGAAT
AAGCAAACCACAGCCCAGAGGAGCAGGCCCTGCAGGTCCGAAGGGGGAAA
CTGGTAAACCGGGGCTTGATGGCGTTCCAGGAGAAGTTGGTCCAAGTGGT
AAACCTGGCGCAACTGGTCCTGATGGAGATGCTGGTGATCCTGGCGATGC
CGGAGCTCCTGGGCCTGACGGCGAAGAAGGGAAATCAGGTGCTCTGGGAG
CTCCTGGAAAGCCAGGACTTTTAGGACCAATGGGATTAGAAGGAAGTGTA
GGTGCCCCTGGACCTGCCGGAGAAGCAGGAGATTCTGGTATTTCAGGAGC
TCCTGGACCAGTTGGTTTACCAGGACGAGATGGCAATCTAGGTTTACCTG
GAAAACAAGGAAAGCAAGGCGATCCTGGTAAAGAAGGACCAGTTGGAAAA
CCTGGAGGACTAGGCGTTCCAGGTGTACCTGGAATGAATGGGGCAAATGG
ACGCAAAGGTCCATTAGGCCTTAGAGGTCCACAGGGTGATAAAGGAAAGA
CAGGAGCCCCTGGAACTGATGGCAAGCCAGGCCCTGATGGAACTACAGGA
GACCCTGGAGTAATGGGATCGCCTGGTCCTTCTGGCCCACAAGGAAGTCT
AGGTAAACCAGGAAAACCGGGTCTCCCTGGTAGTGAGGGTTTAACTGGCG
ATTATGGCGAACTTGGTGTTCCCGGGCCAGTTGGAATGGATGGTCCACCC
GGAAATCCTGGAACTGTTGGAGCACCAGGCCCACCTGGGGGACCGGGTGG
AAAAGGCAAACCTGGTGCAAAAGGGAAACCTGGAAAAGCTGGATCTGGAG
GATTTCCAGGAGTGCCTGGTTCTAGAGGTGCTCTGGGTAAACCCGGTCCC
TCTGGCGATCCAGGAGATGCTGGGGAACTAGGACCTAATGGAGCATTAGG
AGAAGCTGGCTTGGTCGGCGATAAAGGAGTTTCAGGAGCAAATGGAAAAC
CAGGACAAGCTGGACGTCCAGGTTCACGAGGGCTTCCGGGAGTTAAAGGA
CCTAAAGGAAGTCCCGGTTTTGATGGACCAACAGGATCAGATGGTGACAG
AGGACCAACTGGTTTCTCAGGTCCCGACGGACCTCCTGGTCCATCAGGTA
CAGAAGGACCAACTGGTCCCACGGGAGTGATTGGTCCGCGTGGAGATCCT
GGTGTTCTTGGACCTATAGGTGTTCCCGGATTACCGGGGAGACAAGGAGA
AAGTGGCCCTATTGGCCAGAGGGGTCCTATTGGTCCACCAGGGCCCCCTG
GACCACCAGGTGGAGTAATGGCCATGCAAATGAGATCACCAACTAAAGGA
ATAATGTATGGAGATGATTCAATGACCGCGAAGTTACTTGGGGGAAACGT
TATTAAAAATCCTCAAGGAACAAAAGATGTACCAGCGAAAACATGCAAGC
ATTTGAGTGTGAGTAATCCTAATAAACCAGACGGAGAATATTGGATCGAT
CCTAATAGTGGACGAATTGACGATGCAGTTAAAGTATTCTGCAAAATATC
CAAACAGCAAACGTGTATTAAACCAATCGATGGGGATATCGCAATTAAGA
AATGGCACACCACTAATTTTAATGGGCATTCTTGGATTCACACTTTGACG
AAGAAAAATGAGGTCAAATATTCCATACCTAACAGTCAACTATCATTTTT
AAAAGCTTACAGTGAAAAGGCTATTCAGCGGGTAACATTTACGTGTGACA
ATCATCCAATTATTGGAAATGATGGAAAAATTAACAAAGTTACATCTCCA
CGTCTTCTTGCGGATGACGATAGTATTTTGAGAATAAACCATCCCAAATT
GAAGTACACAGTTATCACGGACGACTGTCAGTATGGAAAATCCAGTGAAG
CCGAAACTGTAATAGAAGTATCAAACGATGCCAACATATTTCCCATCCGT
GATGTCGGCGTAACTATTATCAGTAAGAATGACAGCCAATTTGGATTGAA
ATTTGAAGAAGTCTGTTTTTCATAA
back to top
Gene Groups
collagen is similar in sequence to the genes of this group: GG1008
Gene NameGene ID
SMU15002271SMU15002271
SMU15040033SMU15040033
Ddo_001537Ddo_001537
collagenDdo_024746
collagenGsp_012135
Gsp_016934Gsp_016934
Pgr_004907Pgr_004907
collagenPgr_010667
Pmo_000089Pmo_000089
collagenPmo_027332

Gene Group Protein Sequences

>SMU15002271

MWNSIFFSLLFVLCVSINARAEEKLNRLKRQATSPNQAKGSQGPRGDPGP
MGKPGPPGDPGALGPIGPPGRDGARGKSGKPGASGIPGKDGTPGSHGVVG
PIGPRGEPGLAGSIGPEGGTGPQGNRGLTGDKGDIGLAGLKGSNGEPGLQ
GPQGLRGPAGRVGPAGIQGPTGERGKQGTDGVPGSLGPQGAIGPPGQSGI
PGEIGNKGIRGESGIKGAKGDSGNPGLAGKTGPSGSLGPPGYPGVDGRPG
VRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQ
GSAGPKGQKGDPGRPGETGDEGPRGERGVVGPAGNKGSRGESGPDGSPGN
PGTDGIPGKDGLHGNPGSQGEVGSRGSPGAMGKLGLNGAPGPRGENGVFG
TNGHPGAKGAVGPKGNMGSPGVRGLPGNTGTMGVMGPGGIRGPLGPVGSP
GDKGSKGRTGITGVAGDSGDLGEQGPPGEDGSEGPSGSPGPMGFPGIAGK
IGQPGPIGPDGPPGPAGFEGTPGTNGKDGKAGKDGKPGPPGEVGPPGVKG
SIGPVGETGLMGKIGLRGPKGLDGIMGPPGTFGMNGPPGPSGEAGPSGAP
GKLGPVGITGSRGRPGPIGSSGEPGEKGPQGLPEVEKPLAGRSVGGVSGP
RGERGSPGDDGLPGPNGDPGPPGPIGMDGGRGDTGDRGLPGPAGDPGKDG
KPGEPGTPGIDGPPGQVGPEGPRGPSGETGEQGPQGLPGKPGDPGAEGPR
GSSGKQGFQGPTGPIGPTGKQGKQGRAGKSGKNGLTGRKGPAGQRGSIGA
RGKDGQTGENGRAGSAGADGFPGFPGPNGPPGPTGPDGKMGPIGPPGEIG
EHGEMGDPGPTGKEGLVGPQGNVGPPGPIGSPGNPGIAGPPGPQGKRGNR
GNTGFVGPAGPRGKRGPVGPGGEKGIPGSPGLEGQRGQIGVSGARGNNGN
NGKPGRTGRAGPAGTMGQKGVRGVKGFTGPNGLKGPQGPSGYPGEDGSPG
PMGLIGERGPQGITGKRGDRGDPGLLGPLGPPGNDGEFGRPGPQGPMGPP
GPPGPPGSSMPMGLRSPTKGLTFSDDPSVAHSFGNNAIITPRGTKEVPAR
SCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIY
KTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISL
NCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEK
FSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS*
>SMU15040033
MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPD
GDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGE
QGPPGPVGKEGLTGPNGYSGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLG
PPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKK
GEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGD
IGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKG
QKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKP
GATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGR
KGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIG
PPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPP
GSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGD
VGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPG
LAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGM
DGFPGDVGPPGKQGPEGGPGDPGDPGDMGPIGNSGDPGPDGKPGKNGAPG
KQGPEGLPGSEGASGPPGDVGDPGKSGPTGPRGGPGRIGSPGGQGKQGKS
GNQGKLGPSGKPGPVGSPGVTGLDGTIGRKGPLGLRGPSGPKGKSGAPGV
DGKVGTQGVNGYPGYLGPPGPPGPQGPNGKPGKPGPPGNVGQIGDHGEMG
NPGPQGSVGPPGATGPVGPRGDAGEPGRKGPIGPQGKNGTSGGKGYDGQS
GTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGR
PGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDGLQG
PVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGI
MAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKH
PNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHS
ANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIG
NEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIE
VRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS*
>Ddo_001537 Ddo_001537
MHKFTFLFAIGVLCFSVFAENEKLHRLKRQATSPNQAKGSQGPRGDPGPM
GKPGPEGDSGMMGPVGPPGRDGARGKSGKPGLPGIPGKDGTPGSHGVSGP
MGPPGEIGVSGPVGPEGANGKQGNRGPTGDKGDMGLTGLKGSSGEPGLQG
PQGLRGPIGRVGPTGPTGPTGDRGKQGPDGIPGSVGPQGAIGPPGQPGIA
GEIGNKGVRGEAGIKGSKGDHGNPGMGGKLGSIGQPGPPGLPGVDGRPGI
RGEVGVPGLQGPEGKAGQRGQRGAPGNPGSQGPKGSQGEEGSPGIEGKPG
PPGIKGQKGDNGRPGENGDEGPRGERGLNGPSGNKGSQGESGPDGSPGNP
GTDGIPGKDGIAGSPGNEGEAGPKGPPGPMGKPGLNGAPGPRGENGVYGV
NGHPGAKGSVGPKGSIGSPGPRGLPGNNGPMGSMGPGGIRGPLGPVGSPG
EKGGKGRNGIPGASGDAGDIGELGPPGEDGSEGSSGSPGPAGFPGVSGKM
GQIGPIGVDGPPGPPGFEGTPGINGKDGKSGKDGKPGPPGEIGPPGINGS
TGPVGEIGPTGKIGLKGLKGADGIMGPPGTFGINGPPGLSGPMGPVGING
KRGPPGTPGKEGVPGAIGPQGIPGKRGSKGGDGVDKPLAGRSGGGPPGPK
GERGPQGEDGLSGPNGNPGPVGPPGIDGGRGDTGDRGLPGPIGDVGKDGK
PGEPGTPGQDGPPGPVGPEGPRGPPGETGDQGPQGLPGRPGESGLEGPRG
SPGKQGSQGSSGPVGAVGKPGKPGKPGKPGKDGMIGRKGPVGQRGPTGPR
GKDGPAGENGKPGSPGPDGFSGFPGSSGPPGPIGPDGKGGPPGPPGETGE
VGEMGDIGPLGKEGPQGPQGNDGPPGPIGSPGVPGNAGPPGPPGKRGNRG
NTGFVGGVGPRGKRGPVGADGEKGIPGQPGANGAKGQIGIPGPRGKLGNN
GKPGKIGRVGPPGTTGQKGTRGVKGFTGPNGLRGPQGLSGYPGEDGPPGP
IGLIGERGPQGVTGKRGDRGDPGAAGPNGPQGNDGEYGRPGPQGPVGPPG
PPGPPGSSMPMGLRSPTKGLTLADDPSVALSFGNNAIHTPRGTKDVPARS
CKLLSEINPTLPDGEYWIDPNGGRIDDAVKVYCKMSLAQTCIKPISKSFK
AKQWIRKYSKDHIWFQTTHEAGEFQYDIENYQLTYLKVHSDTATQQISLS
CINQAIVLDKNGKLSNASTSLLGDDDTILSLRHPKRRFKVVKDDCQYEKS
SEAETILEIRGKASRLPIRDVGLLVDDNPERKIGIELSEVCYS*
>Ddo_024746 collagen
MLKISILSGCVFLILLFIGNSYGQFRTLNEAVGPAGIRGNPGKPGKPGPD
GDPGPTGPPGPTGKDGLRGQPGAPGPNGNAGPDGKPGSTGVTGPPGARGE
QGPAGPVGKEGLSGAPGFVGPTGEKGDTGPPGEQGDLGDIGPPGRAGPIG
PPGQSGPTGPQGNVGERGPVGPDGMIGPPGPEGKIGSPGSPGRPGEVGKK
GEGGDEGIKGGKGEAGKTGLDGKSGKPGTRGPIGPVGINGRPGKKGELGD
IGLTGPQGISGPRGKRGRVGNPGEGGPKGSQGDQGPIGLEGRAGVLGPKG
QKGDRGRPGELGEAGPLGPIGPIGPDGVKGSRGESGPNGAPGDPGLNGKP
GAIGPPGIPGTPGDAGPGGQTGPMGRPGPNGAPGPRGEVGPNGPDGKSGN
KGAIGPTGQPGVRGSIGNPGKDGALGPMGTSGMRGPPGNIGVEGSKGNKG
PPGSRGKVGSAGKVGPPGKPGVNGSEGPVGNMGNPGFPGSSGDPGAPGPK
GPVGLIGPVGYAGSQGVNGKNGDPGNVGKPGKVGPPGAPGKPGIPGPDGD
RGSLGPPGPTGLKGSPGIIGVPGNYGPNGPPGSLGVIGKQGLEGELGPPG
TPGSPGGTGPRGPPGPAGTPGNAGGEGVDKQKPRSVGSAGIRGPIGKPGA
DGIPGDVGPVGKQGSEGPPGDPGDPGDMGSVGAIGDSGKDGNPGKPGAAG
KPGPSGVDGPEGPAGLPGDIGEPGKSGPSGPRGDPGRVGSAGGPGKQGKS
GNQGKQGPSGKPGPTGPPGLAGLDAANGRKGPLGLRGPPGPKGKSGGPGI
DGKVGTPGTDGFPGYLGPPGQPGPQGIAGKPGKPGPTGGIGLQGDHGEMG
KPGPQGPLGVPGLTGPVGPRGDPGPPGSKGAAGKPGKDGTSGGKGYDGQT
GTSGKSGKIGAPGEKGADGKPGPNGLLGDTGLRGAKGKKGTDGTPGREGK
PGPRGAKGTKGPKGVPGYPGRPGIEGDPGPPGYSGPDGPTGPKGPDGLQG
PVGIFGPRGDPGIPGAIGPTGPPGKPGGTGPAGQRGPLGPPGPPGPPGGV
MAMQMRSPTKGVVYGDDPKAAELLGNNAIKNPQGTKEVPARTCKHLSSVN
PQAPDGEYWIDPNGGRIEDAVKVYCKISEQKTCIKSIDNNLSIRSWNSPI
LNGPTWLQKLINKNEIQYSVPNNQLAFLKVYSDNAVQRVTFNCENHPIIG
NEKIFNKVTAPRLLADDDSIIKMTHPKLKYSVIKDECQYSKSSEAESVIE
VKDVANLLPIRDVGIHIINNRKSKFGLTIEDVCFS*
>Gsp_012135 collagen
MLKISIISGAILLVLIYIECVHGQFRTLNEATGPMGIRGNPGKRGKPGPD
GDPGAQGPTGPPGNDGQRGAPGLQGPPGSVGPEGKSGAGGVSGPPGSRGE
QGPPGPIGKEGLTGPVGYPGPSGEKGDSGGTGEQGDTGDIGPPGPPGPIG
QPGQNGPTGPQGPVGERGTHGPDGIVGPPGPEGRIGSPGLPGRPGEIGKK
GEGGDEGAKGGKGESGKTGINGKSGKPGLRGRTGPDGNNGKQGRKGEIGD
VGLLGPQGLTGPRGLRGSSGNPGDSGPKGSQGDQGPIGLEGKSGPFGPKG
QKGDRGRPGPQGEAGLIGPTGPIGPDGVKGSRGESGPNGSPGSPGPNGKP
GADGPPGNPGHPGNSGPGGSTGALGRPGPNGAPGPRGEIGPPGPDGKSGN
KGALGPIGPSGLRGPPGNPGKDGMIGPLGLPGLRGPPGNVGAPGNKGNIG
EPGPKGKTGNSGKPGPAGKNGADGSEGLSGNIGSPGFPGPNGDPGASGPP
GPAGAIGIPGYPGNQGISGKNGAPGTEGNPGKSGPVGPVGKAGVPGPIGD
SGNPGPPGPNGLKGAPGIVGIPGNYGPNGPPGALGPLGKQGPEGPVGAPG
LLGSPGPDGPRGPPGDNGSPGSAGGEGVEKHKPRSVGAAGIRGPVGKPGM
DGLPGDLGPPGKQGPEGNPGDPGDPGDMGPIGASGDSGPDGKPGKPGAPG
KQGPEGLSGPEGASGPPGDVGDPGKSGPGGPRGGPGRQGSPGGPGKQGKS
GIQGKPGPAGKPGPLGPQGVTGLDGSGGRKGPLGLRGPVGPKGKPGAPGT
DGKVGTSGPDGYPGYLGPPGPSGPQGITGKPGKKGPPGNRGPIGDNGEMG
KPGPVGVVGDPGITGPVGPRGDPGPPGSKGAAGSPGKDGTSGGKGYDGQG
GTSGKSGKLGTPGDKGADGKPGPGGVLGDVGLRGAKGKKGKDGVPGREGR
PGPRGAKGVKGPKGVPGYPGLIGIEGDPGPPGFPGPDGPVGPKGPDGIQG
PVGITGPRGDPGIPGAIGPTGLSGKKGSNGPLGQLGPLGPPGPPGPPGGI
MAMQLRSPTKGVVYGDDPAAAELLGNNAIKNPQGTKEVPARTCKQLSSEN
PNIPDGEYWIDPNGGRTSDAVKVFCKISEEKTCIKPLNQEISIRSWNSPI
TKGHTWLKSLLNSDEIQYSIPNGQLAFLKIYSDTATQRITFACENHPIIG
SEEKLNKVMAPRLLADDDTIIKMTQSKLKYTVIKDECQYSKSSEAESIIE
LKHLASLLPIRDIGINIINNRKSKFGLTIEEVCFS*
>Gsp_016934 Gsp_016934
MYNLIRLFIAILCVLSVPVIVNGEAKLNRIKRQATSPRQAKGSQGPRGDP
GPMGKPGPQGDPGPLGPVGPPGRDGARGKSGRPGASGVPGKDGTPGSHGV
IGPIGPRGEPGIAGSIGPEGASGPQGNRGYPGDKGDIGLNGLKGSNGEPG
LQGPQGIRGTSGRVGPTGPQGPPGERGKQGPDGIPGSPGPQGTIGPPGQS
GITGEMGNKGIRGEGGIKGSKGDVGNPGLSGKVGPAGPTGPPGFPGVDGR
PGVRGESGVVGQQGPVGKVGQQGQRGKTGNIGPPGPKGAQGDEGPMGIEG
KQGPPGPKGQKGDPGRPGETGDEGPRGERGIVGPSGNKGARGETGQDGSP
GNPGTDGIPGKDGLHGSPGSEGEVGSVGPPGEVGKPGLNGAPGIRGENGA
FGVNGKPGAKGSVGPKGNIGSPGPRGLSGNNGAMGVMGPGGIRGPIGPVG
SPGEKGGKGRVGIPGVSGDAGDIGEQGPPGEDGAEGSSGNPGPIGFPGIA
GKIGQAGPLGVDGPPGPPGFEGLPGVNGKDGKAGKDGKPGPPGEVGPPGV
KGSIGQFGETGPMGKIGIRGPKGMDGIMGPPGVFGMNGPPGPSGEAGPEG
APGKLGPVGIAGRPGRPGAIGPQGIAGEKGPKGLPEVDKPLAGRSSGGPP
GPKGERGPPGDDGLPGPNGNQGPPGPVGMDGGRGDTGDRGLPGPVGDPGK
DGKPGEQGVPGTDGPQGPLGPEGPRGPSGETGEQGPRGLPGKPGEPGGEG
PRGSPGKQGLQGPTGPVGPTGKQGKQGKPGKSGKNGVTGQKGPVGSRGPL
GPRGKDGPLGESGKPGSPGADGFSGFPGPIGPPGAIGPDGKQGPVGQPGE
PGEHGEMGDAGPNGNEGPLGPQGNVGPPGPTGPPGNPGNIGTPGPQGKRG
NRGNTGFVGAAGQRGKRGPLGPPGDKGIPGSPGMAGLKGQTGVQGPRGKN
GNNGKPGRIGRSGPPGSMGQKGVRGVKGFTGPNGLKGPQGSSGYPGEDGP
PGPIGLIGERGPQGITGKRGDRGDPGLLGPPGPLGNDGEYGRPGPQGPMG
PPGPPGPPGSSMPMGLRSPTKGLTMADDPTAAISFGNNAIITPRGTKDVP
ARSCKHLSEHNPDLPDGEYWIDPNGGRIDDAIPVFCRIELQQTCIKPISK
IFKPVQWIRKYARGHIWFQTVNEIGEFEYDIESHQLNFLKALSETATQQI
TFTCINQAIILDKTGKLSNASTKLLGDDDTFLTFHHPKRRYKVVKDECQY
EKFSEAETVLQIQGKASRLPIKDVGLITDSNTSRKVGIELSEVCYS*
>Pgr_004907 Pgr_004907
MLRLVCFFLISSVCLTTVLSKEELINRIKRQATSPNQAIGPQGPRGDPGP
RGKIGQIGDTGAIGPPGPPGRDGAAGKSGKPGPPGLPGKDGRPGTPGNSG
ARGTRGEPGVAGPLGPEGGTGKQGSKGAPGDKGDIGPNGLKGSNGEAGLQ
GIRGPRGSPGPVGPNGPPGSAGDRGKRGPDGRMGGAGPQGPIGPPGIPGL
LGDMGDKGERGDGGPKGVKGEAGNAGVSGKPGPTGPKGPQGSPGVDGRPG
IRGELGNIGPLGPPGVAGPRGQTGAPGNSGKLGPKGAQGEQGPVGLEGKI
GLIGDKGQKGDQGRPGDIGDPGVRGERGVEGIGGNKGPRGEMGPDGSPGN
GGTDGIPGRDGEQGQPGSIGPVGPRGPQGPQGKTGLNGSPGGRGENGPFG
LNGMPGGKGEPGVRGPPGLPGSRGSAGNNGLQGVMGPVGMRGPAGQVGEG
GDKGSPGTAGIAGMPGEAGDVGLQGPPGEEGVEGPSGSPGPAGFSGAVGK
IGQVGPIGINGPPGPPGYEGAPGVNGKDGKSGKDGKPGTPGDTGPVGPKG
ASGPLGERGPLGPLGIKGIKGFEGVMGIPGSFGTNGPPGLSGNIGAEGPV
GKPGTAGLPGLAGAPGQRGPIGDSGEPGSSGAQGVEKPPAGRSSGPPGPK
GNRGPPGDNGTPGAVGTQGPPGPPGIDGDRGDPGDRGLPGPIGEPGKDGK
LGKVGGSGKNGPPGQDGPEGPRGAPGDVGEPGRQGPEGKPGPDGPEGPRG
IPGLQGKRGPSGPIGPIGPPGKQGKTGSPGSDGVIGRKGPPGARGPQGPR
GKDGVAGENGKSGTPGPDGFAGFPGPSGPQGIIGGVGKPGNPGSPGETGE
QGEFGDIGPPGPPGPDGLNGNPGPPGPSGIPGSIGERGPPGPGGKKGPMG
NTGFIGMPGPRGGRGKPGLIGPMGLVGGVGLQGPKGPPGEPGDRGKDGVD
GKPGGPGRPGPTGSIGIKGARGFKGFTGPTGIRGNPGPSGYPGENGMPGP
MGLIGERGPQGAPGQRGERGDTGPAGMIGPQGNDGEYGRPGPQGPMGPSG
PPGPPGSSTLMNLRAPKKNLIYGDDPSSALILGNSVIKTPRGTKEVPART
CKHLAEHNPKIPDGEYWIDPNGGRIQDAVKVFCKIDNYQTCIESTTKKFK
LQSWIRKYPKGPIWFQTTNNVGDFEYDVSDDQLSYLKALSDKASQQITIK
CFNKAIIRDKNGALLKTSPSLLGDDDTILTLEHPKRQYTIVRDDCQYEKN
SEAETVLEVNGKASRLPIKDIGLVIDSDKKVGIELSEVCYS*
>Pgr_010667 collagen
MLTNTFLIGVFLGILSSTEFVSGQFKSLQEAVGPPGIRGNPGPQGKPGPD
GDDGAAGPTGFMGKDGFRGPPGPVGPAGKPGTDGKAGNAGVTGSPGSRGE
PGLTGGMGQEGVAGPPGYPGLIGDKGDPGLPGEQGDVGPIGPVGPVGPKG
PIGQPGPTGKQGGTGNRGITGPDGKVGPPGPQGRMGSQGPPGNPGEMGNK
GEKGSEGRKGGKGSVGKPGLNAKPGKLGPTGQAGTPGKDGQQGRRGNPGN
IGVTGSQGPAGQRGPRGLIGNPGEVGPKGSEGDQGPIGVEGKPGNKGPNG
QKGDRGRPGQIGDNGPEGPIGVVGKPGTKGVRGEIGPNGRPGTPGQNGAP
GKNGPPGTPGNPGGTGPAGQPGSLGRPGPNGTPGPRGEPGPSGNDGTPGA
KGSPGPPGPPGQTGLAGNLGKDGDMGKSGPAGIRGPPGELGPDGAKGKTG
SPGLRGIPGDNGPVGKQGPPGLKGNDGNEGGQGSPGFAGPSGEVGKLGPV
GIPGAAGQRGYPGELGVHGKNGAPGSNGKPGKPGADGSVGKIGAPGPDGD
RGDSGPIGARGVTGQVGILGVPGSYGPNGASGPDGILGKPGPSGKPGEDG
APGIPGSPGPKGPPGEGGDPGNPGMPRISKPQPRGAGPAGPKGEAGKPGL
DGIPGEIGPSGKPGAPGPDGDPGDPGETGAPGQDGEEGKEGAPGAPGKPG
LLGPQGLEGNIGSPGPSGEAGDPGATGAPGPVGAPGRDGSLGLPGRQGKP
GEPGKEGAVGKVGSPGVIGAPGNNGADGRKGPLGPRGPPGDKGKPGGPGT
EGKPGSDGSPGDPGFMGSPGPSGPQGSLGKPGKPGPAGSDGLPGDYGEMG
VPGPAGPDGAPGNSGTAGARGPSGLPGGKGKPGPAGKAGKPGNGGFAGIP
GARGASGTPGPAGDAGPLGAPGSNGAIGETGLAGDKGVSGANGKPGQAGR
PGPRGPAGTKGPKGSPGFDGPTGADGDRGAIGYPGPNGPPGPSGPAGLTG
PTGVIGPRGDPGVLGPVGVAGLPGRQGESGPIGQRGPIGPPGPPGPPGGV
MAMQMRSPTKGIMYGDDSKTAKLLGGNAIKNPQGTKDIPAKTCKHLSVSY
PNKPDGEYWIDPNSGRIDDAVKVFCKISAQQTCIRPINGETPLKTWPSSS
VNGHSWIQALTMNNEVQYSIPNSQLSFLKAYSDSAIQRVTFSCDNHPIIG
INGKINKVTSPRLLADDDSVMRINHQKLKYTVISDDCQYGKASEAETIIE
VSNDASLFPIRDVGVTIISKSNSKFGLKFEEVCFS*
>Pmo_000089 Pmo_000089
MLRIVSLILICAIYIIAVMANEELVQRVKRQATSPNQAIGPQGPRGDPGP
RGKAGIPGDTGVLGPPGPPGRDGAAGKSGQSGPSGLPGKDGRPGTPGNVG
SRGPRGEAGVPGPIGPEGGTGKQGSKGPPGEKGDIGPNGLKGSNGESGLQ
GIRGPRGPPGPIGPNGPSGSAGERGKPGPDGRVGGAGPQGPIGPPGVPGL
PGDMGDKGERGDNGPKGVKGEAGNAGLSGKSGPIGPKGPQGSPGVDGRPG
IRGELGNVGPTGPPGSGGPRGQTGAPGNSGHMGPKGAQGEQGPVGLEGKL
GPAGMKGQKGDQGRPGDIGDPGLRGERGVGGIGGNKGPRGEMGPEGSPGN
SGTDGIPGRDGEPGQPGSAGPPGPRGPQGSQGNTGLNGSPGARGENGPFG
SNGIPGNKGEPGVKGPPGLPGSRGSTGNNGVQGIIGPTGIRGPAGQVGEG
GDKGVPGSTGIGGVPGEAGDAGIQGPPGEEGNEGPSGSPGPAGFSGSVGK
IGQTGPVGIDGPPGPPGYEGAPGPNGKDGKSGKDGKPGVPGDTGPSGQKG
TSGPVGERGPSGPSGVKGVKGFDGIMGIPGSFGANGPPGLSGNFGAEGPV
GKSGAPGLPGLPGTQGQRGPIGDSGDPGSSGAQGVEKPPAGRSAGPPGPK
GNRGPPGDNGQPGATGVQGPPGPPGIDGDRGDPGDRGLPGPIGEPGKDGK
AGKVGVAGKDGPPGQDGPEGPRGAPGDVGEPGRQGPEGKPGLDGPEGPRG
QSGLQGKRGPSGNVGPIGKPGKQGKTGSPGTDGSLGRKGPAGARGPQGPR
GKDGPVGESGKTGSPGSDGFAGFPGPSGPQGAIGPEGKPGISGSPGEAGE
QGEFGDIGVPGPPGNDGLPGNAGPPGPMGVPGSLGERGPPGPIGKKGPMG
NTGFVGMPGPRGGRGKPGLLGPMGLVGGVGLQGPKGPPGEPGERGKDGVD
GKAGGAGRPGPPGNLGIKGARGLKGFTGPTGMRGNSGPSGYPGEDGMQGP
IGLIGERGPQGIAGARGERGDTGPSGLIGPTGNDGEYGRPGPQGPMGPVG
PPGPPGSATLMNLRTPKKNLIYGDDPSAALILGNSVIKTPRGTKEVPART
CKHLAEHNPKLTDGEYWIDPNGGRIADAVKVFCKIDKYQTCIESSTKKFK
LQTWVRKYPKGPIWFQTTNGIGEFEYDVPDDQLSYLKALSDKASQQITVK
CMAQAIIRDKNGQLLKSTPSLLGDDDTILTLDHPKRQYTIVKDDCQYEKN
SDAETILEMSGKSSRLPIKDIGLVIDSDKKVGIELSEVCFS*
>Pmo_027332 collagen
MGKDGVRGPPGLIGPAGKPGSDGKAGVAGVAGSPGPRGEPGLTGSMGQEG
VAGPPGYPGLIGEKGDPGLPGEMGDVGNIGPTGIVGPKGPIGQPGPSGKQ
GITGNRGITGPDGKVGPPGPQGKMGPKGPPGNPGEMGNKGEKGSEGRKGG
KGSSGKPGLNAKPGKLGPIGIAGTPGKDGQQGRRGNPGNIGVMGSQGPSG
QRGSRGIIGNPGEVGPKGSEGDQGPIGLEGKPGNKGPNGLKGDRGRPGQI
GENGPEGPLGMEGKPGTKGVRGEIGPNGSPGTPGQNGVLGKNGPPGTSGN
PGGTGPTGQPGPLGRPGPNGTPGPRGEPGPGGNDGMPGAKGSPGPPGPPG
QPGLAGILGKDGDLGKSGPAGIRGPPGELGPAGGKGKIGSPGLRGIPGDT
GPVGKQGLAGQKGNDGHEGGQGTPGFVGPSGEPGKSGPVGSPGAGGQRGF
PGELGVHGKNGAPGNNGKPGKPGAPGPVGIIGAPGPDGDRGDNGPIGARG
ITGPSGVLGVPGTYGPNGAPGPEGTLGKQGPIGKSGLDGIPGLPGLPGPK
GPPGESGDPGPPGNPRISKPQPRGAGPAGPKGETGKPGLDGVPGEVGPSG
KPGATGPDGDAGDPGDAGAPGPDGEEGKSGALGAPGKPGLLGPMGLEGSV
GAPGPAGEAGDSGISGAPGPVGLPGRDGNLGLPGKQGKQGDPGKEGPVGK
PGGLGVPGVPGMNGANGRKGPLGLRGPQGDKGKTGAPGTDGKPGPDGTTG
DPGVMGSPGPSGPQGSLGKPGKPGLPGSEGLTGDYGELGVPGPVGMDGPP
GNPGTVGAPGPPGGPGGKGKPGAKGKPGKAGSGGFPGVPGSRGALGKPGP
SGDPGDAGELGPNGALGEAGLVGDKGVSGANGKPGQAGRPGSRGLPGVKG
PKGSPGFDGPTGSDGDRGPTGFSGPDGPPGPSGTEGPTGPTGVIGPRGDP
GVLGPIGVPGLPGRQGESGPIGQRGPIGPPGPPGPPGGVMAMQMRSPTKG
IMYGDDSMTAKLLGGNVIKNPQGTKDVPAKTCKHLSVSNPNKPDGEYWID
PNSGRIDDAVKVFCKISKQQTCIKPIDGDIAIKKWHTTNFNGHSWIHTLT
KKNEVKYSIPNSQLSFLKAYSEKAIQRVTFTCDNHPIIGNDGKINKVTSP
RLLADDDSILRINHPKLKYTVITDDCQYGKSSEAETVIEVSNDANIFPIR
DVGVTIISKNDSQFGLKFEEVCFS*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.