opsin-like, Pmo_026986 (mRNA) Phagocata morgani

Overview
Nameopsin-like
Unique NamePmo_026986
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1598
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of opsin-like vs. uniprot
Match: gi|129211|sp|P09241|OPSD_ENTDO (RecName: Full=Rhodopsin [Enteroctopus dofleini])

HSP 1 Score: 230.335 bits (586), Expect = 2.64569e-67
Identity = 119/261 (45.59%), Postives = 180/261 (68.97%), Query Frame = 1
Query:  799 MMYSNSTVNSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGA 1581
M+ S + VN T W + +HP+W +FD +P+ +Y VG++I +VGI G+LGN +V+Y+F+ TKSL+T N+F+++LA+ DL+FSA+NGFPL TIS+F +W +GK+ C++YG +GG+FGF+SINTMA+IS+DR+ VI +P + +S ++A +M++ VW++S +W+ P + +G YVPEG TSC+FDYL+ F + MY C F+ P+ II FCY+ IV SV HE EM MA+++NA + GA
Sbjct: 1 MVESTTLVNQT-------WWYNPTVDIHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA 254

HSP 2 Score: 230.335 bits (586), Expect = 2.64569e-67
Identity = 119/261 (45.59%), Postives = 180/261 (68.97%), Query Frame = -1
Query:   18 MMYSNSTVNSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGA 800
M+ S + VN T W + +HP+W +FD +P+ +Y VG++I +VGI G+LGN +V+Y+F+ TKSL+T N+F+++LA+ DL+FSA+NGFPL TIS+F +W +GK+ C++YG +GG+FGF+SINTMA+IS+DR+ VI +P + +S ++A +M++ VW++S +W+ P + +G YVPEG TSC+FDYL+ F + MY C F+ P+ II FCY+ IV SV HE EM MA+++NA + GA
Sbjct: 1 MVESTTLVNQT-------WWYNPTVDIHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA 254
BLAST of opsin-like vs. uniprot
Match: gi|3024254|sp|O15973|OPSD1_MIZYE (RecName: Full=Rhodopsin, GQ-coupled; AltName: Full=GQ-rhodopsin [Mizuhopecten yessoensis])

HSP 1 Score: 228.794 bits (582), Expect = 2.76903e-66
Identity = 119/258 (46.12%), Postives = 182/258 (70.54%), Query Frame = 1
Query:  811 NSTVNSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAK 1584
N T+N ++T W+ ++ VH +W QF V E +HY++GVYI+IVG+ G++GN V+YIF++TKSLR+ NLFV++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+ IS+DR+ VI +P Q + ++ +K +M+V VW+ S + + PPF+G+G Y+PEGFQTSCTFDYLT++ + + +Y+ F+ P+ II CY I++ VR H+ +ML + + M + + A+
Sbjct: 15 NGTLNRSMT-PNTGWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRAR 271

HSP 2 Score: 228.794 bits (582), Expect = 2.76903e-66
Identity = 119/258 (46.12%), Postives = 182/258 (70.54%), Query Frame = -1
Query:   15 NSTVNSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAK 788
N T+N ++T W+ ++ VH +W QF V E +HY++GVYI+IVG+ G++GN V+YIF++TKSLR+ NLFV++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+ IS+DR+ VI +P Q + ++ +K +M+V VW+ S + + PPF+G+G Y+PEGFQTSCTFDYLT++ + + +Y+ F+ P+ II CY I++ VR H+ +ML + + M + + A+
Sbjct: 15 NGTLNRSMT-PNTGWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRAR 271
BLAST of opsin-like vs. uniprot
Match: gi|2499376|sp|Q17094|OPSD_ALLSU (RecName: Full=Rhodopsin, partial [Alloteuthis subulata])

HSP 1 Score: 206.453 bits (524), Expect = 1.80243e-58
Identity = 110/235 (46.81%), Postives = 157/235 (66.81%), Query Frame = 1
Query:  877 VHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGA 1581
+H +W+QFD VP +Y +G++I+I GI G GN +V+Y+F TKSL+T N+F+++LA D TFS VNGFP++TIS F W +G+ C++YG IGG+FG SI TM +IS+DR+ VI +P + +S +KA IM+V VWI+S IWA P +G+G Y EG +C+FDY+T+ + MYI F+FP+ +I FCY+ IV SV HE EM MA+++NA + GA
Sbjct: 12 IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA 246

HSP 2 Score: 206.453 bits (524), Expect = 1.80243e-58
Identity = 110/235 (46.81%), Postives = 157/235 (66.81%), Query Frame = -1
Query:   18 VHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGA 722
+H +W+QFD VP +Y +G++I+I GI G GN +V+Y+F TKSL+T N+F+++LA D TFS VNGFP++TIS F W +G+ C++YG IGG+FG SI TM +IS+DR+ VI +P + +S +KA IM+V VWI+S IWA P +G+G Y EG +C+FDY+T+ + MYI F+FP+ +I FCY+ IV SV HE EM MA+++NA + GA
Sbjct: 12 IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA 246
BLAST of opsin-like vs. uniprot
Match: gi|129209|sp|P24603|OPSD_LOLFO (RecName: Full=Rhodopsin [Loligo forbesii])

HSP 1 Score: 206.068 bits (523), Expect = 3.44182e-58
Identity = 110/236 (46.61%), Postives = 158/236 (66.95%), Query Frame = 1
Query:  877 VHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAK 1584
+HP+W+QFD VP +Y +G++I+I GI G +GN +V+Y+F TKSL+T N+F+++LA D TFS VNGFPL+TIS F W +G C++YG IGG+FG +SI TM +IS+DR+ VI +P + +S +KA IM++ VWI+S IWA P +G+G Y EG +C+FDY+T+ + MYI F+ P+ +I FCY+ IV SV HE EM MA+++NA + GA
Sbjct: 19 IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNILCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGAN 254

HSP 2 Score: 206.068 bits (523), Expect = 3.44182e-58
Identity = 110/236 (46.61%), Postives = 158/236 (66.95%), Query Frame = -1
Query:   15 VHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAK 722
+HP+W+QFD VP +Y +G++I+I GI G +GN +V+Y+F TKSL+T N+F+++LA D TFS VNGFPL+TIS F W +G C++YG IGG+FG +SI TM +IS+DR+ VI +P + +S +KA IM++ VWI+S IWA P +G+G Y EG +C+FDY+T+ + MYI F+ P+ +I FCY+ IV SV HE EM MA+++NA + GA
Sbjct: 19 IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNILCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGAN 254
BLAST of opsin-like vs. uniprot
Match: gi|3024292|sp|O16005|OPSD_SEPOF (RecName: Full=Rhodopsin [Sepia officinalis])

HSP 1 Score: 186.037 bits (471), Expect = 8.13878e-51
Identity = 108/235 (45.96%), Postives = 161/235 (68.51%), Query Frame = 1
Query:  877 VHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGA 1581
VHP+W+QF+ VP+ +Y +G++I I GI G GN +V+Y+F TKSL+T N+F+++LA D TFS VNGFPL+TIS F +W +G C++YGFIGG+FG +SI TM++IS+DR+ VI +P + +S ++A +M++ VW++S +W+ P +G+G YV EG +C+FDY+T+ + MYI F FP+ II FCY+ IV +V HE EM MA+++NA + GA
Sbjct: 19 VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA 253

HSP 2 Score: 186.037 bits (471), Expect = 8.13878e-51
Identity = 108/235 (45.96%), Postives = 161/235 (68.51%), Query Frame = -1
Query:   18 VHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGA 722
VHP+W+QF+ VP+ +Y +G++I I GI G GN +V+Y+F TKSL+T N+F+++LA D TFS VNGFPL+TIS F +W +G C++YGFIGG+FG +SI TM++IS+DR+ VI +P + +S ++A +M++ VW++S +W+ P +G+G YV EG +C+FDY+T+ + MYI F FP+ II FCY+ IV +V HE EM MA+++NA + GA
Sbjct: 19 VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA 253
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15026624 (SmedSxldir_c84693_g1_i1|m.24953|m.19106)

HSP 1 Score: 443.351 bits (1139), Expect = 7.23957e-151
Identity = 222/258 (86.05%), Postives = 246/258 (95.35%), Query Frame = 1
Query:  823 NSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKADI 1596
N ++T + WHWD EFE+IVHPYWR FD+VPE YHY+VGVYISIVGISGVLGNLLVLYIFAS KSLRT PN+F+MSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDR+FVIAQPFQTM++L++K+AIIMLV VW+YS IW++PPF+GYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYI NF+ PVGIIIFCYYQIVK+VR+HELEMLKMAQKMNA++PTSMKTGAKKAD+
Sbjct: 33 NESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADV 290

HSP 2 Score: 443.351 bits (1139), Expect = 7.23957e-151
Identity = 222/258 (86.05%), Postives = 246/258 (95.35%), Query Frame = -1
Query:    3 NSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKADI 776
N ++T + WHWD EFE+IVHPYWR FD+VPE YHY+VGVYISIVGISGVLGNLLVLYIFAS KSLRT PN+F+MSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDR+FVIAQPFQTM++L++K+AIIMLV VW+YS IW++PPF+GYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYI NF+ PVGIIIFCYYQIVK+VR+HELEMLKMAQKMNA++PTSMKTGAKKAD+
Sbjct: 33 NESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADV 290
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15028515 (SmedSxldir_c96785_g1_i5|m.39594|m.45818)

HSP 1 Score: 111.694 bits (278), Expect = 1.49013e-26
Identity = 69/214 (32.24%), Postives = 118/214 (55.14%), Query Frame = 1
Query:  910 PEFY-HYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQ 1539
PE Y +Y + YI ++GI G N+LV+ +F +KS+ T N+F+ LA+ DL + GFP LTIS F W + + C Y F + G SI + +++++R VI++P + ++ +S K++ ++++ W ++ + PP G+ YV EG SC++D +SK I+F IG+++ + IIIFCY + V+ M M +
Sbjct: 19 PETYVYYALASYILVIGIIGTAENMLVMLVFIRSKSMWTPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGIFLVVLL----IIIFCYLALFLKVQRQATSMRVMIK 227

HSP 2 Score: 111.694 bits (278), Expect = 1.49013e-26
Identity = 69/214 (32.24%), Postives = 118/214 (55.14%), Query Frame = -1
Query:   60 PEFY-HYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQ 689
PE Y +Y + YI ++GI G N+LV+ +F +KS+ T N+F+ LA+ DL + GFP LTIS F W + + C Y F + G SI + +++++R VI++P + ++ +S K++ ++++ W ++ + PP G+ YV EG SC++D +SK I+F IG+++ + IIIFCY + V+ M M +
Sbjct: 19 PETYVYYALASYILVIGIIGTAENMLVMLVFIRSKSMWTPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGIFLVVLL----IIIFCYLALFLKVQRQATSMRVMIK 227
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15032968 (SmedSxlregen_c81464_g11_i1|m.21191|m.10162)

HSP 1 Score: 100.523 bits (249), Expect = 6.04378e-23
Identity = 72/209 (34.45%), Postives = 108/209 (51.67%), Query Frame = 1
Query:  910 PEFYHYMV-GVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEM 1524
PE + Y + GVYI +G+ G + N V+ +F +K L T N+FV L D + GFP L +SSF W + C +Y F + G SI + +I+++RF + P QT++ +++K++I ++ W I + PP G+ YV EG Q SC+FD QSK I+ IG F+ + II CY +I VR EM
Sbjct: 15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIG----TFLLILTAIIICYVKIFFKVRDQIKEM 218

HSP 2 Score: 100.523 bits (249), Expect = 6.04378e-23
Identity = 72/209 (34.45%), Postives = 108/209 (51.67%), Query Frame = -1
Query:   75 PEFYHYMV-GVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEM 689
PE + Y + GVYI +G+ G + N V+ +F +K L T N+FV L D + GFP L +SSF W + C +Y F + G SI + +I+++RF + P QT++ +++K++I ++ W I + PP G+ YV EG Q SC+FD QSK I+ IG F+ + II CY +I VR EM
Sbjct: 15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIG----TFLLILTAIIICYVKIFFKVRDQIKEM 218
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15030838 (SmedSxlregen_c54053_g1_i1|m.6668|m.37854)

HSP 1 Score: 87.4261 bits (215), Expect = 1.0669e-18
Identity = 59/197 (29.95%), Postives = 107/197 (54.31%), Query Frame = 1
Query:  919 YHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIM-LVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVR 1506
++Y + IS I GVL N +++ F ++L++ NL +M++ I + A+ G P+ +SSF W + + C YGF G S+ M +I++DRFFVIA+P TM A K I + + G +YS I+ PP G+ Y + +TSC+ ++ ++ + I + + ++ P+ + ++CY+ I ++R
Sbjct: 12 FYYSKAIVISFFLIFGVLLNGTIMFTFFHNRALKSPTNLLIMAIIINNFLL-AIFGIPMDIVSSFYQYWIFSDVGCRFYGFAMFFTGLNSVAIMTVIAIDRFFVIAKP--TMAAHITKNVIYLSICGCLVYSLIFTIPPLIGWNEYKLDKSKTSCSVNFESRDPIFYSYTIVILVFCYIIPIIVNLYCYFYIYMTIR 205

HSP 2 Score: 87.4261 bits (215), Expect = 1.0669e-18
Identity = 59/197 (29.95%), Postives = 107/197 (54.31%), Query Frame = -1
Query:   93 YHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIM-LVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVR 680
++Y + IS I GVL N +++ F ++L++ NL +M++ I + A+ G P+ +SSF W + + C YGF G S+ M +I++DRFFVIA+P TM A K I + + G +YS I+ PP G+ Y + +TSC+ ++ ++ + I + + ++ P+ + ++CY+ I ++R
Sbjct: 12 FYYSKAIVISFFLIFGVLLNGTIMFTFFHNRALKSPTNLLIMAIIINNFLL-AIFGIPMDIVSSFYQYWIFSDVGCRFYGFAMFFTGLNSVAIMTVIAIDRFFVIAKP--TMAAHITKNVIYLSICGCLVYSLIFTIPPLIGWNEYKLDKSKTSCSVNFESRDPIFYSYTIVILVFCYIIPIIVNLYCYFYIYMTIR 205
BLAST of opsin-like vs. Smed Unigenes AA
Match: SMU15010993 (SmedAsxldir_c46418_g1_i1|m.8227|m.22320)

HSP 1 Score: 82.4185 bits (202), Expect = 8.10064e-17
Identity = 72/234 (30.77%), Postives = 123/234 (52.56%), Query Frame = 1
Query:  928 MVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNG-FPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASP--PFWGYGNY-VPEGFQTSCTFDYLT--QSKGNIIFNIGMYICNFVFPVGIIIFCY---YQIVKSVRLHELEMLKMAQKMNATNPTSMK--TGAKKADI 1596
+V YI+++ I G LG+ LV+Y+ +K+LRT N+F+++LAI DL A + F ++ + SF+ W +G+ C++ G G +S ++ I+LDR+ VI P T +L + AI +++G+WI S I ASP F G + + T CT + K + ++I + +V P+ I+ Y Y+I+K R++ L + + N M+ T +K DI
Sbjct: 61 LVLSYIAMIVI-GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQ-RMNNLHKKDLESSNSLPNSHKMELLTDKQKYDI 290

HSP 2 Score: 82.4185 bits (202), Expect = 8.10064e-17
Identity = 72/234 (30.77%), Postives = 123/234 (52.56%), Query Frame = -1
Query:    3 MVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNG-FPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASP--PFWGYGNY-VPEGFQTSCTFDYLT--QSKGNIIFNIGMYICNFVFPVGIIIFCY---YQIVKSVRLHELEMLKMAQKMNATNPTSMK--TGAKKADI 671
+V YI+++ I G LG+ LV+Y+ +K+LRT N+F+++LAI DL A + F ++ + SF+ W +G+ C++ G G +S ++ I+LDR+ VI P T +L + AI +++G+WI S I ASP F G + + T CT + K + ++I + +V P+ I+ Y Y+I+K R++ L + + N M+ T +K DI
Sbjct: 61 LVLSYIAMIVI-GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQ-RMNNLHKKDLESSNSLPNSHKMELLTDKQKYDI 290
BLAST of opsin-like vs. RefSeq Human
Match: gi|15150803|ref|NP_150598.1| (melanopsin isoform 1 [Homo sapiens])

HSP 1 Score: 137.887 bits (346), Expect = 1.74897e-34
Identity = 76/183 (41.53%), Postives = 115/183 (62.84%), Query Frame = 1
Query:  907 VPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVF 1455
VP+ HY +G I +VG++G+LGNL V+Y F ++SLRT N+F+++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDR+ VI +P T S ++A +L+GVW+Y+ W+ PPF+G+ YVPEG TSC++DY++ + + M +C FVF
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYT--MLLCCFVF 244

HSP 2 Score: 137.887 bits (346), Expect = 1.74897e-34
Identity = 76/183 (41.53%), Postives = 115/183 (62.84%), Query Frame = -1
Query:  144 VPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVF 692
VP+ HY +G I +VG++G+LGNL V+Y F ++SLRT N+F+++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDR+ VI +P T S ++A +L+GVW+Y+ W+ PPF+G+ YVPEG TSC++DY++ + + M +C FVF
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYT--MLLCCFVF 244
BLAST of opsin-like vs. RefSeq Human
Match: gi|71999143|ref|NP_001025186.1| (melanopsin isoform 2 [Homo sapiens])

HSP 1 Score: 129.413 bits (324), Expect = 1.26397e-31
Identity = 76/194 (39.18%), Postives = 115/194 (59.28%), Query Frame = 1
Query:  907 VPEFYHYMVGVYISIVGISGVLGNLLVLYIFA-----------STKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVF 1455
VP+ HY +G I +VG++G+LGNL V+Y F ++SLRT N+F+++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDR+ VI +P T S ++A +L+GVW+Y+ W+ PPF+G+ YVPEG TSC++DY++ + + M +C FVF
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYT--MLLCCFVF 255

HSP 2 Score: 129.413 bits (324), Expect = 1.26397e-31
Identity = 76/194 (39.18%), Postives = 115/194 (59.28%), Query Frame = -1
Query:  144 VPEFYHYMVGVYISIVGISGVLGNLLVLYIFA-----------STKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVF 692
VP+ HY +G I +VG++G+LGNL V+Y F ++SLRT N+F+++LA+ D S P+ SS +W +G+ CE Y F G LFG S+ T+ I+LDR+ VI +P T S ++A +L+GVW+Y+ W+ PPF+G+ YVPEG TSC++DY++ + + M +C FVF
Sbjct: 65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYT--MLLCCFVF 255
BLAST of opsin-like vs. RefSeq Human
Match: gi|38678524|ref|NP_859528.1| (opsin-5 [Homo sapiens])

HSP 1 Score: 102.834 bits (255), Expect = 4.15849e-23
Identity = 74/217 (34.10%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  928 MVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFD-YLTQ-SKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMK 1572
+ G Y++I+GI GN VLY+ + K + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDR+ I L K A I L +W Y+ W + P G G+YVPE F TSCT D +L Q S G +F + + + P +I+F Y +I+ V+ E+ ++++++ MK
Sbjct: 35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMK 249

HSP 2 Score: 102.834 bits (255), Expect = 4.15849e-23
Identity = 74/217 (34.10%), Postives = 111/217 (51.15%), Query Frame = -1
Query:   27 MVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFD-YLTQ-SKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMK 671
+ G Y++I+GI GN VLY+ + K + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDR+ I L K A I L +W Y+ W + P G G+YVPE F TSCT D +L Q S G +F + + + P +I+F Y +I+ V+ E+ ++++++ MK
Sbjct: 35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMK 249
BLAST of opsin-like vs. RefSeq Human
Match: gi|5730019|ref|NP_006574.1| (visual pigment-like receptor peropsin [Homo sapiens])

HSP 1 Score: 100.138 bits (248), Expect = 3.34646e-22
Identity = 54/197 (27.41%), Postives = 105/197 (53.30%), Query Frame = 1
Query:  922 HYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLH 1512
H +V Y+ + G+ ++ N++VL IF K LRT N +++LA+ D+ S++ G+P+ S W +G C++Y + FG SI + ++++DR+ I P R ++ I +++G WI WA P G+ +Y P+ +CT ++ + + + + + NF+ P+ ++ +CYY + S++ H
Sbjct: 25 HNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVTDIGVSSI-GYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLP-DVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHH 219

HSP 2 Score: 100.138 bits (248), Expect = 3.34646e-22
Identity = 54/197 (27.41%), Postives = 105/197 (53.30%), Query Frame = -1
Query:   87 HYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLH 677
H +V Y+ + G+ ++ N++VL IF K LRT N +++LA+ D+ S++ G+P+ S W +G C++Y + FG SI + ++++DR+ I P R ++ I +++G WI WA P G+ +Y P+ +CT ++ + + + + + NF+ P+ ++ +CYY + S++ H
Sbjct: 25 HNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVTDIGVSSI-GYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLP-DVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHH 219
BLAST of opsin-like vs. RefSeq Human
Match: gi|767939388|ref|XP_011512653.1| (PREDICTED: opsin-5 isoform X4 [Homo sapiens])

HSP 1 Score: 92.8189 bits (229), Expect = 8.21811e-20
Identity = 70/207 (33.82%), Postives = 103/207 (49.76%), Query Frame = 1
Query:  958 ISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFD-YLTQ-SKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMK 1572
I GN VLY+ + K + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDR+ I L K A I L +W Y+ W + P G G+YVPE F TSCT D +L Q S G +F + + + P +I+F Y +I+ V+ E+ ++++++ MK
Sbjct: 7 ILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMK 211

HSP 2 Score: 92.8189 bits (229), Expect = 8.21811e-20
Identity = 70/207 (33.82%), Postives = 103/207 (49.76%), Query Frame = -1
Query:   27 ISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFD-YLTQ-SKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMK 641
I GN VLY+ + K + ++LA+ DL S V G P IS F RW +G + C YG+ G FG S+ TM +SLDR+ I L K A I L +W Y+ W + P G G+YVPE F TSCT D +L Q S G +F + + + P +I+F Y +I+ V+ E+ ++++++ MK
Sbjct: 7 ILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMK 211
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17738051|ref|NP_524407.1| (neither inactivation nor afterpotential E [Drosophila melanogaster])

HSP 1 Score: 127.487 bits (319), Expect = 4.84554e-32
Identity = 89/262 (33.97%), Postives = 139/262 (53.05%), Query Frame = 1
Query:  808 SNSTVNSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD 1593
SN +V VT + ++ PYW QF + + ++ Y+ ++G+ GN +V+YIFA+TKSLRT NL V++LAI D N P++ I+ + W G + C+IY +G FG SI +M +ISLDR+ VI + R +++ A+ + +W S IW P +G+ YVPEG TSC DYL + + I I + P+ +I + Y+ I+ +V HE M + A+KMN + S + K A+
Sbjct: 19 SNGSVVDKVT-------PDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAE 271

HSP 2 Score: 127.487 bits (319), Expect = 4.84554e-32
Identity = 89/262 (33.97%), Postives = 139/262 (53.05%), Query Frame = -1
Query:    6 SNSTVNSTVTIAPWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD 791
SN +V VT + ++ PYW QF + + ++ Y+ ++G+ GN +V+YIFA+TKSLRT NL V++LAI D N P++ I+ + W G + C+IY +G FG SI +M +ISLDR+ VI + R +++ A+ + +W S IW P +G+ YVPEG TSC DYL + + I I + P+ +I + Y+ I+ +V HE M + A+KMN + S + K A+
Sbjct: 19 SNGSVVDKVT-------PDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAE 271
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17137098|ref|NP_477096.1| (rhodopsin 5, isoform A [Drosophila melanogaster])

HSP 1 Score: 127.487 bits (319), Expect = 5.49831e-32
Identity = 83/232 (35.78%), Postives = 139/232 (59.91%), Query Frame = 1
Query:  862 EFEAIVHPYWRQFDIVPEFYHYMVGVYIS--IVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPP-FWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMN 1548
E++ +VH +WR F P +YH G YI+ ++ +S + GN LV++IF+++KSLRT NL +++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DR+ I+ P LS + +++++ W+++ ++ P F +G Y PEGF T+C+FDYLT + N +F +++ ++V P+ +I+ YY++ VR+HE + + A+KMN
Sbjct: 32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGR--LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMN 257

HSP 2 Score: 127.487 bits (319), Expect = 5.49831e-32
Identity = 83/232 (35.78%), Postives = 139/232 (59.91%), Query Frame = -1
Query:   51 EFEAIVHPYWRQFDIVPEFYHYMVGVYIS--IVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPP-FWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMN 737
E++ +VH +WR F P +YH G YI+ ++ +S + GN LV++IF+++KSLRT NL +++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DR+ I+ P LS + +++++ W+++ ++ P F +G Y PEGF T+C+FDYLT + N +F +++ ++V P+ +I+ YY++ VR+HE + + A+KMN
Sbjct: 32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGR--LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMN 257
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|665407712|ref|NP_001285859.1| (rhodopsin 5, isoform B [Drosophila melanogaster])

HSP 1 Score: 127.487 bits (319), Expect = 5.49831e-32
Identity = 83/232 (35.78%), Postives = 139/232 (59.91%), Query Frame = 1
Query:  862 EFEAIVHPYWRQFDIVPEFYHYMVGVYIS--IVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPP-FWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMN 1548
E++ +VH +WR F P +YH G YI+ ++ +S + GN LV++IF+++KSLRT NL +++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DR+ I+ P LS + +++++ W+++ ++ P F +G Y PEGF T+C+FDYLT + N +F +++ ++V P+ +I+ YY++ VR+HE + + A+KMN
Sbjct: 32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGR--LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMN 257

HSP 2 Score: 127.487 bits (319), Expect = 5.49831e-32
Identity = 83/232 (35.78%), Postives = 139/232 (59.91%), Query Frame = -1
Query:   51 EFEAIVHPYWRQFDIVPEFYHYMVGVYIS--IVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPP-FWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMN 737
E++ +VH +WR F P +YH G YI+ ++ +S + GN LV++IF+++KSLRT NL +++LAI DL F N P I++ G L C+IY GG+ G + T A I+ DR+ I+ P LS + +++++ W+++ ++ P F +G Y PEGF T+C+FDYLT + N +F +++ ++V P+ +I+ YY++ VR+HE + + A+KMN
Sbjct: 32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGR--LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMN 257
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|28571739|ref|NP_524368.3| (rhodopsin 6, partial [Drosophila melanogaster])

HSP 1 Score: 127.102 bits (318), Expect = 7.18407e-32
Identity = 86/243 (35.39%), Postives = 132/243 (54.32%), Query Frame = 1
Query:  862 EFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKA 1590
E +V PYW Q+ + + ++G I+I+G + GN +V+YIF S+K LRT N+FV++LA D FP + ++ F W G CE+YG G LFG +SI +M LI+ DR+ VI + + L+ A++ L+ VW WA P +G+ YVPEG T+C DY + N + I + ++ P+ IIF Y+ I+K+V HE M + A+KMN + + + KA
Sbjct: 27 EIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMM-MFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMAR-KPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSKA 267

HSP 2 Score: 127.102 bits (318), Expect = 7.18407e-32
Identity = 86/243 (35.39%), Postives = 132/243 (54.32%), Query Frame = -1
Query:    9 EFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKA 737
E +V PYW Q+ + + ++G I+I+G + GN +V+YIF S+K LRT N+FV++LA D FP + ++ F W G CE+YG G LFG +SI +M LI+ DR+ VI + + L+ A++ L+ VW WA P +G+ YVPEG T+C DY + N + I + ++ P+ IIF Y+ I+K+V HE M + A+KMN + + + KA
Sbjct: 27 EIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMM-MFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMAR-KPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSKA 267
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Match: gi|17136434|ref|NP_476701.1| (rhodopsin 4 [Drosophila melanogaster])

HSP 1 Score: 121.324 bits (303), Expect = 8.84968e-30
Identity = 85/253 (33.60%), Postives = 135/253 (53.36%), Query Frame = 1
Query:  844 PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPP---FWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD 1593
P HW + E P HYM+GV+ + + +GN +V++IF+++KSLRT N+FV++LA+ DL P+ +SF+ +A G C+I+ IG G + T A I DR+ VI +P R ++ KA+IM + +W+Y W P FW +VPEG+ TSC+FDYL+ + +F ++ +FV P +I++ Y QIV V HE + + A+KMN S+++ K+
Sbjct: 40 PEHWLTQLEP------------PASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKA--PIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMN--RNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWD--RFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNV---ESLRSNVDKSK 271

HSP 2 Score: 121.324 bits (303), Expect = 8.84968e-30
Identity = 85/253 (33.60%), Postives = 135/253 (53.36%), Query Frame = -1
Query:    6 PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLYIFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLVGVWIYSFIWASPP---FWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD 755
P HW + E P HYM+GV+ + + +GN +V++IF+++KSLRT N+FV++LA+ DL P+ +SF+ +A G C+I+ IG G + T A I DR+ VI +P R ++ KA+IM + +W+Y W P FW +VPEG+ TSC+FDYL+ + +F ++ +FV P +I++ Y QIV V HE + + A+KMN S+++ K+
Sbjct: 40 PEHWLTQLEP------------PASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKA--PIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMN--RNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWD--RFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNV---ESLRSNVDKSK 271
The following BLAST results are available for this feature:
BLAST of opsin-like vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|129211|sp|P09241|OPSD_ENTDO2.645690e-6745.59RecName: Full=Rhodopsin [Enteroctopus dofleini][more]
gi|3024254|sp|O15973|OPSD1_MIZYE2.769030e-6646.12RecName: Full=Rhodopsin, GQ-coupled; AltName: Full... [more]
gi|2499376|sp|Q17094|OPSD_ALLSU1.802430e-5846.81RecName: Full=Rhodopsin, partial [Alloteuthis subu... [more]
gi|129209|sp|P24603|OPSD_LOLFO3.441820e-5846.61RecName: Full=Rhodopsin [Loligo forbesii][more]
gi|3024292|sp|O16005|OPSD_SEPOF8.138780e-5145.96RecName: Full=Rhodopsin [Sepia officinalis][more]
back to top
BLAST of opsin-like vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150266247.239570e-15186.05SmedSxldir_c84693_g1_i1|m.24953|m.19106[more]
SMU150285151.490130e-2632.24SmedSxldir_c96785_g1_i5|m.39594|m.45818[more]
SMU150329686.043780e-2334.45SmedSxlregen_c81464_g11_i1|m.21191|m.10162[more]
SMU150308381.066900e-1829.95SmedSxlregen_c54053_g1_i1|m.6668|m.37854[more]
SMU150109938.100640e-1730.77SmedAsxldir_c46418_g1_i1|m.8227|m.22320[more]
back to top
BLAST of opsin-like vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|15150803|ref|NP_150598.1|1.748970e-3441.53melanopsin isoform 1 [Homo sapiens][more]
gi|71999143|ref|NP_001025186.1|1.263970e-3139.18melanopsin isoform 2 [Homo sapiens][more]
gi|38678524|ref|NP_859528.1|4.158490e-2334.10opsin-5 [Homo sapiens][more]
gi|5730019|ref|NP_006574.1|3.346460e-2227.41visual pigment-like receptor peropsin [Homo sapien... [more]
gi|767939388|ref|XP_011512653.1|8.218110e-2033.82PREDICTED: opsin-5 isoform X4 [Homo sapiens][more]
back to top
BLAST of opsin-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17738051|ref|NP_524407.1|4.845540e-3233.97neither inactivation nor afterpotential E [Drosoph... [more]
gi|17137098|ref|NP_477096.1|5.498310e-3235.78rhodopsin 5, isoform A [Drosophila melanogaster][more]
gi|665407712|ref|NP_001285859.1|5.498310e-3235.78rhodopsin 5, isoform B [Drosophila melanogaster][more]
gi|28571739|ref|NP_524368.3|7.184070e-3235.39rhodopsin 6, partial [Drosophila melanogaster][more]
gi|17136434|ref|NP_476701.1|8.849680e-3033.60rhodopsin 4 [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_026986 ID=Pmo_026986|Name=opsin-like|organism=Phagocata morgani|type=mRNA|length=1598bp
TGTATATCGGCCTTTTTTGCACCCGTTTTCATCGAAGTAGGATTGGTGGC
ATTCATTTTCTGCGCCATTTTAAGCATTTCCAATTCGTGGAGTCTGACGG
ATTTGACGATTTGATAATAACAAAATATTATTATTCCGACAGGGAACACG
AAGTTGCAAATATACATTCCAATATTGAATATAATATTCCCTTTGCTCTG
GGTCAAATAATCAAAAGTGCACGATGTTTGGAATCCTTCTGGCACATAGT
TGCCGTATCCCCAGAATGGAGGCGAGGCCCAAATGAACGAATAGATCCAG
ACACCGACCAGCATAATGATCGCTTTCTTCATCGACAGAGCTCGCATCGT
CTGGAACGGCTGCGCAATGACGAAGAAGCGATCTAACGAAATCAAGGCCA
TCGTATTGATGGAAATGAATCCGAACAGTCCGCCAATGAAGCCGTAGATC
TCGCACGTCAATTTCCCCCAAGCCCATCTCGTATTAAAACTCGAAATTGT
CAATAAAGGGAATCCATTAACGGCAGAGAACGTCAAATCCCCGATGGCGA
GACTCATGACAAACAAATTTGGTGCTGTTCGAAGACTTTTGGTGCTTGCA
AATATGTACAAGACCAGTAAGTTACCAAGCACTCCTGAGATGCCAACTAT
GGAAATGTATACTCCGACCATGTAATGATAGAACTCAGGAACTATGTCGA
ATTGTCTCCAGTATGGATGGACGATTGCTTCAAACTCATGGTCCCAATGC
CATGGAGCAATGGTAACCGTACTATTGACGGTACTATTCGAATACATCAT
GATGTATTCGAATAGTACCGTCAATAGTACGGTTACCATTGCTCCATGGC
ATTGGGACCATGAGTTTGAAGCAATCGTCCATCCATACTGGAGACAATTC
GACATAGTTCCTGAGTTCTATCATTACATGGTCGGAGTATACATTTCCAT
AGTTGGCATCTCAGGAGTGCTTGGTAACTTACTGGTCTTGTACATATTTG
CAAGCACCAAAAGTCTTCGAACAGCACCAAATTTGTTTGTCATGAGTCTC
GCCATCGGGGATTTGACGTTCTCTGCCGTTAATGGATTCCCTTTATTGAC
AATTTCGAGTTTTAATACGAGATGGGCTTGGGGGAAATTGACGTGCGAGA
TCTACGGCTTCATTGGCGGACTGTTCGGATTCATTTCCATCAATACGATG
GCCTTGATTTCGTTAGATCGCTTCTTCGTCATTGCGCAGCCGTTCCAGAC
GATGCGAGCTCTGTCGATGAAGAAAGCGATCATTATGCTGGTCGGTGTCT
GGATCTATTCGTTCATTTGGGCCTCGCCTCCATTCTGGGGATACGGCAAC
TATGTGCCAGAAGGATTCCAAACATCGTGCACTTTTGATTATTTGACCCA
GAGCAAAGGGAATATTATATTCAATATTGGAATGTATATTTGCAACTTCG
TGTTCCCTGTCGGAATAATAATATTTTGTTATTATCAAATCGTCAAATCC
GTCAGACTCCACGAATTGGAAATGCTTAAAATGGCGCAGAAAATGAATGC
CACCAATCCTACTTCGATGAAAACGGGTGCAAAAAAGGCCGATATACA

Design Primers for opsin-like

back to top

protein sequence

>Pmo_026986-protein ID=Pmo_026986-protein|Name=opsin-like|organism=Phagocata morgani|type=polypeptide|length=301bp
MSNCLQYGWTIASNSWSQCHGAMVTVLLTVLFEYIMMYSNSTVNSTVTIA
PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLY
IFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLT
CEIYGFIGGLFGFISINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLV
GVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIC
NFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD
I
back to top

coding sequence

>Pmo_026986.694.1596 ID=Pmo_026986.694.1596|Name=Pmo_026986.694.1596|organism=Phagocata morgani|type=CDS|length=903bp
ATGTCGAATTGTCTCCAGTATGGATGGACGATTGCTTCAAACTCATGGTC
CCAATGCCATGGAGCAATGGTAACCGTACTATTGACGGTACTATTCGAAT
ACATCATGATGTATTCGAATAGTACCGTCAATAGTACGGTTACCATTGCT
CCATGGCATTGGGACCATGAGTTTGAAGCAATCGTCCATCCATACTGGAG
ACAATTCGACATAGTTCCTGAGTTCTATCATTACATGGTCGGAGTATACA
TTTCCATAGTTGGCATCTCAGGAGTGCTTGGTAACTTACTGGTCTTGTAC
ATATTTGCAAGCACCAAAAGTCTTCGAACAGCACCAAATTTGTTTGTCAT
GAGTCTCGCCATCGGGGATTTGACGTTCTCTGCCGTTAATGGATTCCCTT
TATTGACAATTTCGAGTTTTAATACGAGATGGGCTTGGGGGAAATTGACG
TGCGAGATCTACGGCTTCATTGGCGGACTGTTCGGATTCATTTCCATCAA
TACGATGGCCTTGATTTCGTTAGATCGCTTCTTCGTCATTGCGCAGCCGT
TCCAGACGATGCGAGCTCTGTCGATGAAGAAAGCGATCATTATGCTGGTC
GGTGTCTGGATCTATTCGTTCATTTGGGCCTCGCCTCCATTCTGGGGATA
CGGCAACTATGTGCCAGAAGGATTCCAAACATCGTGCACTTTTGATTATT
TGACCCAGAGCAAAGGGAATATTATATTCAATATTGGAATGTATATTTGC
AACTTCGTGTTCCCTGTCGGAATAATAATATTTTGTTATTATCAAATCGT
CAAATCCGTCAGACTCCACGAATTGGAAATGCTTAAAATGGCGCAGAAAA
TGAATGCCACCAATCCTACTTCGATGAAAACGGGTGCAAAAAAGGCCGAT
ATA
back to top
Gene Groups
opsin-like is similar in sequence to the genes of this group: GG7488
Gene NameGene ID
SMU15026624SMU15026624
opsin-likeDdo_008381
opsin-likeGsp_022660
opsin-likePgr_015173
opsin-likePmo_026986

Gene Group Protein Sequences

>SMU15026624

MILYLTLKIFIFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESI
VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTP
PNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLF
GFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWST
PPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIF
CYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIV
FLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI
NHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMS
QLDPEDDKQVVETTKNQTTSGHTNEAYESEQK*
>Ddo_008381 opsin-like
LQMSVQSFLSIGQKLIENKTANVSKVPWHWDSDFESIVHPYWREFELVPE
VYHYLVGVYISFVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDL
TFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISL
DRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGFGNYVPEG
FQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVAIIIFCYYQIVKAVRLHE
LEMLKMAQKMNASHPASMKTGAKKADVQAAKISVIIVFLYLISWTPYAVI
ALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKF
PCLICCCPPKPKERDTTSVASATKPSKYQSEKESSMSQLDSEDDKQNVET
NKGQAASGHTNEAYESEK*
>Gsp_022660 opsin-like
VLFMNLHSLVGLGQKILENSTADNASLSKSPWHWDPEFESIVHPYWRTFD
MVPEVYHYLVGVYISIVGIAGVLGNLLVLYIFASAKSLRTPPNMFIMSLA
IGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMA
LISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNY
VPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFVIPVGTIIFCYYQIVKAV
RVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLISWTP
YAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL
EKKFPCLICCCPPKPKERDTTSAASATKPSKYQSEKESSMSQLDSEDDKQ
ATETSKVQATSGHTNDAYENEQK*
>Pgr_015173 opsin-like
LSIAGDMSLQYANTIGPGMFSNSTVNVSATTAPWHWDHEFESIVHPYWRQ
FDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASTKSLRTPPNLFVMS
LAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINT
MALIALDRYFVIAQPFQTMRALTMKKAIIMLVFVWLYSFVWASPPFWGFG
HYVPEGFQTSCTFDYLTQSKGNVIFNIGMYICNFVFPVGIIIFCYYQIVK
AVRLHELEMLKMAQKMNATNPTSIKTGAKKADIQAAKISIIIVFLYLLSW
TPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRL
QLEKKVPCLICCCPPKAKERETTSVASATKPSRYQSEKESSMSQLDSDGP
QKQDEGKNAGKTNPAYEDGEK*
>Pmo_026986 opsin-like
MSNCLQYGWTIASNSWSQCHGAMVTVLLTVLFEYIMMYSNSTVNSTVTIA
PWHWDHEFEAIVHPYWRQFDIVPEFYHYMVGVYISIVGISGVLGNLLVLY
IFASTKSLRTAPNLFVMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLT
CEIYGFIGGLFGFISINTMALISLDRFFVIAQPFQTMRALSMKKAIIMLV
GVWIYSFIWASPPFWGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIC
NFVFPVGIIIFCYYQIVKSVRLHELEMLKMAQKMNATNPTSMKTGAKKAD
I

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.