ifb, Pmo_026655 (mRNA) Phagocata morgani

Overview
Nameifb
Unique NamePmo_026655
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1984
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of ifb vs. uniprot
Match: gi|266617|sp|Q01241|NF70_DORPE (RecName: Full=70 kDa neurofilament protein; Short=NF70 [Doryteuthis pealeii])

HSP 1 Score: 402.134 bits (1032), Expect = 2.14356e-129
Identity = 243/624 (38.94%), Postives = 392/624 (62.82%), Query Frame = 1
Query:   37 VTSTNVYKTSSSSNTQPISG-----------PRNV-VINRTA--PTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRR---ADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSKPPGSSDLECAESN--WGVGALIVTILINKNGEEKASHTQRTVYQ 1848
+++T Y+ S +P SG PR INR++ P S+G + R + SYG A G +NI +GV+ + RE+E+Q +++LN+RFANYI+KV+ LE +N+ L EL +LK++WGKET IK+ Y+ ++ RK +D+ K+ L++R+ + D L+ + +L E H D+E I R N QL D E E++ LRR + LE EK R + ++ DE+ +++ DL+ ET++H+ A+N Q+L +++EF K ++ E++EL +LAY+D + E+++FWR+E+AQA+RDIQ EYD + D M+ D+EA YN+K+Q++R +K + E + +E+NTKLK ++++RNRL +LEA+N +LE+ + L R+++E++R+ +LE ++E+ + +ESI ELQ L+D KLSLELEI AYRK+LEGEE RV K ++ VG R A+ +++TR+ G +Q+ ++G+++AKT++QRT+KG+V+I+E G F+ LE + EN++G+K+ R D+ ++ + IP N +L TG +KIWSK + D + N WG G+ +VTIL N+ GE+KA++TQ TVYQ
Sbjct: 10 ISTTTTYEGES----RPSSGMSGFSYSAKIHPRTSGYINRSSQSPFRSSMGSNAAY-TRSYDF--SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSTILTRSEGGYEATG----DSQISMKMMRGELAAKTTYQRTSKGSVSIKEADSQGCFIALETK--KEENLTGWKIVRKVDDNKVYT-YEIP-NLVL-KTGT--VVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNTVYQ 615
BLAST of ifb vs. uniprot
Match: gi|124235|sp|P23731|IFEB_ASCSU (RecName: Full=Intermediate filament protein B; Short=IF-B [Ascaris suum])

HSP 1 Score: 323.939 bits (829), Expect = 1.07407e-99
Identity = 206/604 (34.11%), Postives = 351/604 (58.11%), Query Frame = 1
Query:   55 YKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQK----NVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTG-GQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSK---GSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQRTV 1842
Y+ + S QP + R A S G S R ++M G + G + + + + + +KE++ +Q LNDR NYID+VK LE++NR L +L +L+ +WGK+T IK QY + + + RK +D K ++++++ + D L E +V +D+E I++ + D ++E+ LR R L +E+ R + + R+ +E+ + + DLD+ETL I QN+VQ+L +++EFL++++E EV+EL +L + P+++++F+++E+A A+RDI+ EYD + DME+ Y +K+ + + + ++ + E+ RE+ ++++ + D+R +L +LEAKN LEK ++ L ++++ R+Y+ + L + +++ AELQ LLD K L+ EI YRKMLEGEE RV + V+ + ++ + TDS TR V +G++S KT+FQR+AKGNVTI EC P+GKF+ LENT + EN+ ++ R DN R IV + IP NT+L+ R +KI+++ G P + + E+ WG+GA +VT LINK+G+E+A+HTQ+T+
Sbjct: 11 YEIAYRSTIQPRTAVRT---QSRQSGAYSTGAVSGGGGRVLKMVTEMGSASIGGISPALSANAAKSFLEATDKEKKEMQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGRWGKDTSEIKIQYSDSLRDARKEIDDGARRKAEIDVKVARLRDDLAELRNRYEDVQHRRESDREKINQWQHAIEDAQSELEMLRARWRQLTEEEKRLNGDNARIWEELQKARNDLDEETLGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDYIAKQGKQDMESWYKLKVSEVQGSANRANMESSYQREEVKRMRDNIGDLRGKLGDLEAKNALLEKEVQNLNYQLNDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEESRVGLRQMVEQVVKTHSLQQQEDTDS--TRNV--------------------RGEVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRSKDENLGEHRLKRKLDNRREIV-YTIPPNTVLKA---GRTMKIYARDQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|266616|sp|Q01240|NF60_DORPE (RecName: Full=60 kDa neurofilament protein; Short=NF60 [Doryteuthis pealeii])

HSP 1 Score: 318.931 bits (816), Expect = 7.71031e-99
Identity = 189/477 (39.62%), Postives = 305/477 (63.94%), Query Frame = 1
Query:   37 VTSTNVYKTSSSSNTQPISG-----------PRNV-VINRTA--PTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRR---ADATDSMVTRTVAG 1413
+++T Y+ S +P SG PR INR++ P S+G + R + SYG A G +NI +GV+ + RE+E+Q +++LN+RFANYI+KV+ LE +N+ L EL +LK++WGKET IK+ Y+ ++ RK +D+ K+ L++R+ + D L+ + +L E H D+E I R N QL D E E++ LRR + LE EK R + ++ DE+ +++ DL+ ET++H+ A+N Q+L +++EF K ++ E++EL +LAY+D + E+++FWR+E+AQA+RDIQ EYD + D M+ D+EA YN+K+Q++R +K + E + +E+NTKLK ++++RNRL +LEA+N +LE+ + L R+++E++R+ +LE ++E+ + +ESI ELQ L+D KLSLELEI AYRK+LEGEE RV K ++ VG R A+ +++TR+ G
Sbjct: 10 ISTTTTYEGES----RPSSGMSGFSYSAKIHPRTSGYINRSSQSPFRSSMGSNAAY-TRSYDF--SYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSTILTRSEGG 479
BLAST of ifb vs. uniprot
Match: gi|46576384|sp|Q19289|IFB1_CAEEL (RecName: Full=Intermediate filament protein ifb-1; AltName: Full=Cel IF B1; AltName: Full=Intermediate filament protein B1; Short=IF-B1)

HSP 1 Score: 315.849 bits (808), Expect = 1.23562e-96
Identity = 197/566 (34.81%), Postives = 336/566 (59.36%), Query Frame = 1
Query:  169 RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVG----RRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTG-GQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSK---GSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQRTV 1842
R ++M G G + + + + + +KE++ LQ LNDR NYID+VK LE++NR L +L +L+ +WGK+T IK +Y ++ RK +D A K ++++++ D L E ++ Q +D+E I + + + D ++EV LR R L DE+ R + R+ +E+ + + DLD ET+ I QN+VQ+L +++EFL++++E EV+EL +L + P+++++F+++E+A A+RDI+ EYD + DME+ Y +K+ + + + ++ + E+ R++ ++++ + D+R +L +LE KN+ LEK ++ L ++ + R+Y+ + L + +++ AELQ LLD K L+ EI YRKMLEGEE RV ++ V ++ + TDS TR+V +G++S KT+FQR+AKGNVTI EC P+GKF+ LEN+ + EN+ K+ R D R IV ++IP N +++P G+N L I+++ G P S + E+ WG+GA +VT L+NK+GEE+A+HTQ+T+
Sbjct: 46 RVLKMVTEMGSATVGGISPALSANAAKSFLEATDKEKKTLQGLNDRLGNYIDRVKKLEEQNRKLVADLDELRGKWGKDTSEIKIKYSESLSTARKDIDDAARRKAEVDVKVARHRDDLAEYRSRYEDIQQRRESDREKISQWTNAIADAQSEVEMLRARFKQLTDEEKRVTADNSRIWEELQKARSDLDDETIGRIDFQNQVQTLMEELEFLRRVHEQEVKELQALLAQAPADTREFFKNELALAIRDIKDEYDIIAKQGKQDMESWYKLKVSEVQGSANRANMESTYQRDEVKRMRDNIGDLRGKLGDLENKNSLLEKEVQNLNYQLTDDQRQYEAALNDRDATLRRMREECQTLVAELQALLDTKQMLDAEIAIYRKMLEGEETRVGLTQMVEQAVKTHSLQQQENTDS--TRSV--------------------RGEVSTKTTFQRSAKGNVTISECDPNGKFIKLENSHRNKDENVGEHKIRRKLDGRREIV-YSIPANVVIKP-GKN--LTIYARDQGGINNPPESLVFDGENTWGIGANVVTSLVNKDGEERATHTQKTI 585
BLAST of ifb vs. uniprot
Match: gi|46576376|sp|P90901|IFA1_CAEEL (RecName: Full=Intermediate filament protein ifa-1; AltName: Full=Cel IF A1; AltName: Full=Intermediate filament protein A1; Short=IF-A1)

HSP 1 Score: 302.368 bits (773), Expect = 1.03904e-91
Identity = 198/583 (33.96%), Postives = 350/583 (60.03%), Query Frame = 1
Query:  121 TAPTAPS-VGGQSVTNV----RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRA--DATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTG-GQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSK--GSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQR 1836
T P+A + +GG++ NV R +++ A SG S Q+ ST+ + RE+E++ + +LNDR A+YI+KV+ LE +NR L +L L+++WGK+T I++ Y+ ++ + +K +D + +E ++ ++D L E +L + + D+ ID + L++ E E++ L+RR+ LEDE R +E RL E+ + + DLD+ETL+ I QN+VQ+L ++I+FL++++++E++EL +LA +D + E+++F+++E++ A+RDI+ EYD+ + ++DME+ Y +K+Q+ + ++ + E +E+ +L+ QLSD+R +L +LE++N+ LEK ++ L ++++ R Y+ + ++ + +++ ELQ+LLD K +L+ EI YRKMLEGEE+R K ++ V A TD+ R V G++ +++ SFQR+AKGNV+I E SPDGKF++L+NT + E I +K+ R D R V + +P + +L + LKI+++ G P + AE ++G G + TIL NK GEE+A+H QR
Sbjct: 14 TTPSARAPLGGRTTGNVTSQDRMLKIVTEMRSGAGSG-LSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGLKQLVEQVVKTHAITQETDTETMRVVKGET--------------------ASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRA---GKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQR 571
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15011956 (SmedAsxldir_c69509_g1_i1|m.14946|m.134)

HSP 1 Score: 776.933 bits (2005), Expect = 0
Identity = 401/603 (66.50%), Postives = 503/603 (83.42%), Query Frame = 1
Query:   49 NVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPN-VGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQRTVYQM* 1854
N T++S QPISG RNVVI RT PT +VG Q +N+R IEM KSYG++++ GATSNIV +GV+ LMNGREKE+ LQ+LNDRFANYIDKV++LEDEN+ L+DELVDLK+QWGKET RIK YDNDM LR+SLD AEGAK Q+EM+IN++EDL+ E++ EL++ Q+H ADKETID+M S L+DYE+E+ +LR+RL GLE+EK RD+KEI RLK+E+ LK+DL+KETL+HI A NE+QSL D+IEFLKKI+ESEVREL SL YKD +E+KDFWR+EMAQALRDIQ+EYDR+LD++ +DMEAQY +KIQ+ R TQS+++ ET+QLRE+NT++K+QL++MRNRLPELEA+NNELE++LE+LRRE++E+NRE+DLE+ NLRKEL N++A LE I ELQ+LLDAKLSLELEI+AYRKMLEGEE+RVN+K+ + N GR D D VTRT Q AA S V+S +KG+MSAKTSFQRTAKGNVTIQECSPDGKF+ILENTG Q E+ISG+ + RNTDNGRI+++ IP TILEPTG+NR+ KIW++G++P GS D EC+ESNWG GA IVT+L N GEEKA+HTQRTVYQ+*
Sbjct: 12 NYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQTGRSVDTMDH-VTRTSISQQHAA--PSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATHTQRTVYQL* 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15038947 (dd_smedV4_3871_0_1|m.24747|m.30510)

HSP 1 Score: 496.508 bits (1277), Expect = 1.0976e-167
Identity = 262/586 (44.71%), Postives = 404/586 (68.94%), Query Frame = 1
Query:   91 SGPRNVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQRTVY 1845
S V IN+++P V+ EM++SY + + S + S VS+ + GRE+E++ +Q+LN+R ANYI+KV+ LE +N+ LT+EL L+ +WGKE ERI+ Y+ +M+ L+K LD AE A+ +L +IN +E+ L E + E N H D+E I+++N QL++ E E+ LRRR+ LE+E+ R K I RL+DE+ + + DLD+ET++HI +++EVQS +D+I+F+K +++E++EL +LAY+D + E++DFWR EM +LR++Q EYDR+L++M+ D+E +N+K+Q+ R + ++ E+I L+E+N +LK QLS++R++ PE+EAKN +LE+ LE LRRE+D + +++ ER LR +L Q L+SI E Q ++D KLSLELEI AYRK+LEGEE R +N+M + + + + + AG++ + + +K + +AK + QRTAKGNV I E S DGKF+ILENTG + E+ISGFK+ RN DN R I+++ IP++TIL+P GQ +FLKIWSKG++P GS+DLEC+ +NWG G I T L+NK+ EE+A+HTQ+T +
Sbjct: 6 SARSTVTINKSSPA-----------VKEYEMRQSYNFSGAPMGGSVQIHSNVSSAVEGREREKREMQDLNERLANYIEKVRFLEAQNKRLTNELNTLRERWGKEAERIRALYEIEMDQLKKLLDEAEAARSELLPKINKLEEQLHEYLQGIDEANNQHGMDQEMIEKLNRQLSECEGEIGLLRRRIAALEEERGRSKKTISRLRDEIKRTRMDLDQETMNHIASESEVQSRKDEIDFMKDSHDNEMKELAALAYRDSTAENRDFWRSEMGSSLRELQIEYDRKLEAMRGDLENHHNVKVQELRHSSPREGVESIHLKEENIRLKNQLSNLRSKCPEMEAKNAQLERFLEELRRELDRQINDFESERDKLRSDLQRTQDELDSIMKEFQNVMDMKLSLELEIAAYRKLLEGEESRSGLRNMMEQTIFKTSGGIEGNIISKTAGKTQMS----------NLMKNERNAKVNHQRTAKGNVIIHETSADGKFIILENTGKKDEDISGFKIIRNIDNDRSIIRYEIPNSTILKPEGQQKFLKIWSKGNRPTGSNDLECSSANWGTGTHIFTALLNKSNEERATHTQKTTF 570
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15013238 (SmedAsxldir_c85434_g1_i1|m.24146|m.11304)

HSP 1 Score: 354.369 bits (908), Expect = 3.96548e-112
Identity = 217/601 (36.11%), Postives = 365/601 (60.73%), Query Frame = 1
Query:   25 SSRTVTSTNVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQ-SMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEKA 1821
S +T+T N + S PIS R ++INRT PS Q +S+ + + V REK++ ++ LN++ A YI++V+ LE +N+ + EL +LK++WGK+TE +K +Y+ +M NL+K L AE + + E + ++E LQ+++ EL+ + N + I+ +L++ E ++ L++RL LE+ K +D EI +L+DE+ L++DL+ +T+ ++ + E+Q D++EFLK+I+++++ EL++LAY+D + ++KDFW+ E++ A++DIQS+YD R+ ++ +E+QY +++QD + +K E ++++N ++K + R+R+P+LE K LE+ L LR E +E R+Y++E ++ KEL + + +L+ LLD KLSL+LEI AYRK+LEGEE R K S V + T + +T Q + K Q +++ G++SAK++F RT KGNV+I EC+ DG+ +ILEN G E IS +NR+ D+GR +++F IP T ++ N+ +KIW+KG KP G++DLE E+NWG+G+ I TIL N GEE+A
Sbjct: 28 SLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQ-----------RSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDK---SSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERA 611
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15019274 (SmedSxldir_c108927_g2_i1|m.81594|m.27374)

HSP 1 Score: 242.662 bits (618), Expect = 1.3e-69
Identity = 156/435 (35.86%), Postives = 270/435 (62.07%), Query Frame = 1
Query:   61 TSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNI---------VQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVN 1335
T+S S +PIS PRN + + + S QS N+ G+ SNI +QSGV+++ GR +E++ LQ+LN+RFA+YI+K + LE +N+ L +E+ LK ++ +IK+ Y+ ++N LR ++ +E +K LE +++S+E + + L + I++ K TID+ ++ +E E+ LRR + ++ +E+ L+D++ +L++D +KE L H+ ++E+QSL++ +EF K+I+++EV+EL ++AY+DP+ E+ +W+ EM +ALRDIQ+EY+ +L ++ ++EA Y +++Q+ R ++++D+ ET +E+N+++K Q+ MR+R+ +LE +N E E L +R +E R +L+ NL+++L Q L ELQ LLDAKL LELEI AY K+LE EE RVN
Sbjct: 91 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQS---------------NSQQGS-SNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 509

HSP 2 Score: 70.8626 bits (172), Expect = 1.34631e-12
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1480 SAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQ 1833
S + F+RT KGN++I E G +ILEN G + E++ G + R D + F I L G+ + + +KG ++E +++WGVG +VT L + G EKA+H Q
Sbjct: 580 SKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNA-GEK--ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 694
BLAST of ifb vs. Smed Unigenes AA
Match: SMU15006730 (SmedAsxldir_c108652_g1_i6|m.91472|m.48315)

HSP 1 Score: 241.506 bits (615), Expect = 3.02973e-69
Identity = 156/435 (35.86%), Postives = 270/435 (62.07%), Query Frame = 1
Query:   61 TSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNI---------VQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPS-ESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVN 1335
T+S S +PIS PRN + + + S QS N+ G+ SNI +QSGV+++ GR +E++ LQ+LN+RFA+YI+K + LE +N+ L +E+ LK ++ +IK+ Y+ ++N LR L +E ++ LE++++S+E + + L + I++ K TID+ ++ +E E+ LRR + ++ +E+ L+D++ +L++D +KE L H+ ++E+QSL++ +EF K+I+++EV+EL ++AY+DP+ E+ +W+ EM +ALRDIQ+EY+ +L ++ ++EA Y +++Q+ R ++++D+ ET +E+N+++K Q+ MR+R+ +LE +N E E L +R +E R +L+ NL+++L Q L ELQ LLDAKL LELEI AY K+LE EE RVN
Sbjct: 91 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQS---------------NSQQGS-SNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 509

HSP 2 Score: 70.8626 bits (172), Expect = 1.39332e-12
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1480 SAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASHTQ 1833
S + F+RT KGN++I E G +ILEN G + E++ G + R D + F I L G+ + + +KG ++E +++WGVG +VT L + G EKA+H Q
Sbjct: 571 SKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRIVDGSENKISFTISGKVNLNA-GEK--ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 685
BLAST of ifb vs. RefSeq Human
Match: gi|27436946|ref|NP_733821.1| (lamin isoform A [Homo sapiens])

HSP 1 Score: 159.844 bits (403), Expect = 1.17586e-40
Identity = 150/539 (27.83%), Postives = 271/539 (50.28%), Query Frame = 1
Query:  265 REKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDS-------QETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVILENTGGQPENISGFKVNR-NTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGS----KPPGSSDLEC-AESNWGVGALIVTILINKNGEEKA 1821
R +E++ LQELNDR A YID+V+ LE EN L + + + +E IK Y+ ++ + RK+LDS + +L++ ++ + + +E + ++ A + + + + LN E +++ LE E ++ +L+ + + KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F +A AL++++++++ +++ + ++E Y+ K+ + R + ++S +E Q R L QLS ++ +L EAK +LE L R A +E+A +A ++ E Q LLD KL+L++EI AYRK+LEGEE R+ + SP R S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R N D+ + +F P T+ GQ + IW+ G+ PP +DL A++ WG G + T LIN GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLL-------AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERL--RLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE----------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP-PKFTL--KAGQ--VVTIWAAGAGATHSPP--TDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063468|ref|NP_001269555.1| (lamin isoform A-delta50 [Homo sapiens])

HSP 1 Score: 159.073 bits (401), Expect = 1.37083e-40
Identity = 150/539 (27.83%), Postives = 271/539 (50.28%), Query Frame = 1
Query:  265 REKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDS-------QETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVILENTGGQPENISGFKVNR-NTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGS----KPPGSSDLEC-AESNWGVGALIVTILINKNGEEKA 1821
R +E++ LQELNDR A YID+V+ LE EN L + + + +E IK Y+ ++ + RK+LDS + +L++ ++ + + +E + ++ A + + + + LN E +++ LE E ++ +L+ + + KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F +A AL++++++++ +++ + ++E Y+ K+ + R + ++S +E Q R L QLS ++ +L EAK +LE L R A +E+A +A ++ E Q LLD KL+L++EI AYRK+LEGEE R+ + SP R S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R N D+ + +F P T+ GQ + IW+ G+ PP +DL A++ WG G + T LIN GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLL-------AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERL--RLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE----------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP-PKFTL--KAGQ--VVTIWAAGAGATHSPP--TDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|5031875|ref|NP_005563.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 158.303 bits (399), Expect = 1.53788e-40
Identity = 150/539 (27.83%), Postives = 271/539 (50.28%), Query Frame = 1
Query:  265 REKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDS-------QETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVILENTGGQPENISGFKVNR-NTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGS----KPPGSSDLEC-AESNWGVGALIVTILINKNGEEKA 1821
R +E++ LQELNDR A YID+V+ LE EN L + + + +E IK Y+ ++ + RK+LDS + +L++ ++ + + +E + ++ A + + + + LN E +++ LE E ++ +L+ + + KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F +A AL++++++++ +++ + ++E Y+ K+ + R + ++S +E Q R L QLS ++ +L EAK +LE L R A +E+A +A ++ E Q LLD KL+L++EI AYRK+LEGEE R+ + SP R S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R N D+ + +F P T+ GQ + IW+ G+ PP +DL A++ WG G + T LIN GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLL-------AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERL--RLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE----------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP-PKFTL--KAGQ--VVTIWAAGAGATHSPP--TDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|544063466|ref|NP_001269554.1| (lamin isoform C [Homo sapiens])

HSP 1 Score: 158.303 bits (399), Expect = 1.53788e-40
Identity = 150/539 (27.83%), Postives = 271/539 (50.28%), Query Frame = 1
Query:  265 REKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDS-------QETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVILENTGGQPENISGFKVNR-NTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGS----KPPGSSDLEC-AESNWGVGALIVTILINKNGEEKA 1821
R +E++ LQELNDR A YID+V+ LE EN L + + + +E IK Y+ ++ + RK+LDS + +L++ ++ + + +E + ++ A + + + + LN E +++ LE E ++ +L+ + + KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F +A AL++++++++ +++ + ++E Y+ K+ + R + ++S +E Q R L QLS ++ +L EAK +LE L R A +E+A +A ++ E Q LLD KL+L++EI AYRK+LEGEE R+ + SP R S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R N D+ + +F P T+ GQ + IW+ G+ PP +DL A++ WG G + T LIN GEE A
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLL-------AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERL--RLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE----------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP-PKFTL--KAGQ--VVTIWAAGAGATHSPP--TDLVWKAQNTWGCGNSLRTALINSTGEEVA 539
BLAST of ifb vs. RefSeq Human
Match: gi|27436948|ref|NP_733822.1| (lamin isoform A-delta10 [Homo sapiens])

HSP 1 Score: 157.918 bits (398), Expect = 3.52676e-40
Identity = 150/542 (27.68%), Postives = 271/542 (50.00%), Query Frame = 1
Query:  265 REKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVREL-----TSLAYKDPSESKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDS-------QETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAK--GNVTIQECSPDGKFVILENTGGQPENISGFKVNR-NTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGS----KPPGSSDLEC-AESNWGVGALIVTILINKNGEEKASHT 1830
R +E++ LQELNDR A YID+V+ LE EN L + + + +E IK Y+ ++ + RK+LDS + +L++ ++ + + +E + ++ A + + + + LN E +++ LE E ++ +L+ + + KK L E L + A+N +Q+++++++F K IY E+RE T L D + ++F +A AL++++++++ +++ + ++E Y+ K+ + R + ++S +E Q R L QLS ++ +L EAK +LE L R A +E+A +A ++ E Q LLD KL+L++EI AYRK+LEGEE R+ + SP R S ++T G S+ ++ +++SF + A+ G V ++E +GKFV L N + +++ +++ R N D+ + +F P T+ GQ + IW+ G+ PP +DL A++ WG G + T LIN GE SH
Sbjct: 28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREF-ESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLL-------AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERL--RLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE----------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFP-PKFTL--KAGQ--VVTIWAAGAGATHSPP--TDLVWKAQNTWGCGNSLRTALINSTGE--GSHC 540
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|17136290|ref|NP_476616.1| (lamin, isoform A [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.13898e-34
Identity = 154/554 (27.80%), Postives = 267/554 (48.19%), Query Frame = 1
Query:  223 SNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETID-----RM----NSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHE----MAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSP--NVGRRADATDSM--VTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSK----PPGSSDLECAESNWGVGALIVTILINKNGEEKA 1821
S S +S + R E+ LQ LNDR A YID+V++LE EN LT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I+ L +E+E EL N++ KE RM ++LN+ N+ + R++L +E KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ S T + E+ + ++ + + ELE N +L + L R++D + E L KEL + + E Q L+D K+SL+LEI AY K+L GEE R+N ++P N + S+ TR + + + + V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + +EP G + +WS +K PP S L W TIL+N GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI---DIKRLWEENE-ELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLN----ITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSS--LVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769141|ref|NP_001245892.1| (lamin, isoform B [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.13898e-34
Identity = 154/554 (27.80%), Postives = 267/554 (48.19%), Query Frame = 1
Query:  223 SNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETID-----RM----NSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHE----MAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSP--NVGRRADATDSM--VTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSK----PPGSSDLECAESNWGVGALIVTILINKNGEEKA 1821
S S +S + R E+ LQ LNDR A YID+V++LE EN LT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I+ L +E+E EL N++ KE RM ++LN+ N+ + R++L +E KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ S T + E+ + ++ + + ELE N +L + L R++D + E L KEL + + E Q L+D K+SL+LEI AY K+L GEE R+N ++P N + S+ TR + + + + V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + +EP G + +WS +K PP S L W TIL+N GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI---DIKRLWEENE-ELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLN----ITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSS--LVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|386769143|ref|NP_001245893.1| (lamin, isoform C [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.13898e-34
Identity = 154/554 (27.80%), Postives = 267/554 (48.19%), Query Frame = 1
Query:  223 SNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETID-----RM----NSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHE----MAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSP--NVGRRADATDSM--VTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSK----PPGSSDLECAESNWGVGALIVTILINKNGEEKA 1821
S S +S + R E+ LQ LNDR A YID+V++LE EN LT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I+ L +E+E EL N++ KE RM ++LN+ N+ + R++L +E KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ S T + E+ + ++ + + ELE N +L + L R++D + E L KEL + + E Q L+D K+SL+LEI AY K+L GEE R+N ++P N + S+ TR + + + + V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + +EP G + +WS +K PP S L W TIL+N GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI---DIKRLWEENE-ELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLN----ITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSS--LVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|665404412|ref|NP_001285629.1| (lamin, isoform D [Drosophila melanogaster])

HSP 1 Score: 140.198 bits (352), Expect = 1.13898e-34
Identity = 154/554 (27.80%), Postives = 267/554 (48.19%), Query Frame = 1
Query:  223 SNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETID-----RM----NSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHE----MAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLERANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSP--NVGRRADATDSM--VTRTVAGQSMAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWSKGSK----PPGSSDLECAESNWGVGALIVTILINKNGEEKA 1821
S S +S + R E+ LQ LNDR A YID+V++LE EN LT E+ ++ +ET IK+ ++ ++ R+ LD + + E+ I+ L +E+E EL N++ KE RM ++LN+ N+ + R++L +E KE+ RL+ + + +K+L++ETL + +N +QSLR+++ F +I+ E+ E + + SE E + Q+L++++++Y+ ++ + ++++ Y KIQ + ++ S T + E+ + ++ + + ELE N +L + L R++D + E L KEL + + E Q L+D K+SL+LEI AY K+L GEE R+N ++P N + S+ TR + + + + V + A +AKGNV I+E P+GKFV L N G + I G+++ R + + + +EP G + +WS +K PP S L W TIL+N GE A
Sbjct: 37 SQTASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI---DIKRLWEENE-ELK--NKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL---KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLN----ITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNG---VITVWSADTKASHEPPSS--LVMKSQKWVSADNTRTILLNSEGEAVA 572
BLAST of ifb vs. RefSeq Drosophila melanogaster
Match: gi|24653664|ref|NP_523742.2| (lamin C, isoform A [Drosophila melanogaster])

HSP 1 Score: 130.954 bits (328), Expect = 1.71455e-31
Identity = 153/610 (25.08%), Postives = 284/610 (46.56%), Query Frame = 1
Query:  103 NVVINRTAPTAPSVGGQSVTNVRRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANYIDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSAEGAKVQLEMRINSI----EDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYENEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSE-----SKDFWRHEMAQALRDIQSEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQLSDMRNRLPELEAKXXXXXXXXXXXXXXXXXXXXXYDLER-------ANLRKELANQQAHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGRRADATDSMVTRTVAGQS---------------MAAXXXXXXXXXXXXXXGQMSAKTSFQRTAKGNVTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTILEPTGQNRFLKIWS----KGSKPPGSSDLECAESNWGVGALIVTILINKNGEEKASH 1827
N ++R + + P VGG S ++ R+ GATS S R++E++ LQ LNDR A YID++++LE+EN LT EL ++ +ET +K Y+ ++ RK LD K +LE+ I + +DL + + E N + +R N ++N N+ + R++ ED+ E RL+ ++ L+K L+ ETL + +N+ QSLR+++ F +++ E+ E S + SE S+ + ++ Q+L++++ +Y+ ++ + ++E Y+ +IQ+ + ++ +Q + E++ MR ++ L AK LE L + E D ER A+L EL + + E Q L+D K+SL+LEI AY K+L GEE R+N ++ P + S +T + + +S + + + V + + ++ S AKG++ I E +G+F+ L N G + N++G+++ R + + +F+ + + + IWS PP + + W V + ++L N + E+ AS+
Sbjct: 9 NTRVSRASTSTP-VGGASTSS--RV------------GATS-----PTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYN-EVNGKYNQSLADRKK---FEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQY-EAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQ-------GSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGAS-----VTIWSVDAGTAHDPPNNL---VMKKKWPVANSMRSVLANADKEDVASY 578
The following BLAST results are available for this feature:
BLAST of ifb vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|266617|sp|Q01241|NF70_DORPE2.143560e-12938.94RecName: Full=70 kDa neurofilament protein; Short=... [more]
gi|124235|sp|P23731|IFEB_ASCSU1.074070e-9934.11RecName: Full=Intermediate filament protein B; Sho... [more]
gi|266616|sp|Q01240|NF60_DORPE7.710310e-9939.62RecName: Full=60 kDa neurofilament protein; Short=... [more]
gi|46576384|sp|Q19289|IFB1_CAEEL1.235620e-9634.81RecName: Full=Intermediate filament protein ifb-1;... [more]
gi|46576376|sp|P90901|IFA1_CAEEL1.039040e-9133.96RecName: Full=Intermediate filament protein ifa-1;... [more]
back to top
BLAST of ifb vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150119560.000000e+066.50SmedAsxldir_c69509_g1_i1|m.14946|m.134[more]
SMU150389471.097600e-16744.71dd_smedV4_3871_0_1|m.24747|m.30510[more]
SMU150132383.965480e-11236.11SmedAsxldir_c85434_g1_i1|m.24146|m.11304[more]
SMU150192741.300000e-6935.86SmedSxldir_c108927_g2_i1|m.81594|m.27374[more]
SMU150067303.029730e-6935.86SmedAsxldir_c108652_g1_i6|m.91472|m.48315[more]
back to top
BLAST of ifb vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|27436946|ref|NP_733821.1|1.175860e-4027.83lamin isoform A [Homo sapiens][more]
gi|544063468|ref|NP_001269555.1|1.370830e-4027.83lamin isoform A-delta50 [Homo sapiens][more]
gi|5031875|ref|NP_005563.1|1.537880e-4027.83lamin isoform C [Homo sapiens][more]
gi|544063466|ref|NP_001269554.1|1.537880e-4027.83lamin isoform C [Homo sapiens][more]
gi|27436948|ref|NP_733822.1|3.526760e-4027.68lamin isoform A-delta10 [Homo sapiens][more]
back to top
BLAST of ifb vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136290|ref|NP_476616.1|1.138980e-3427.80lamin, isoform A [Drosophila melanogaster][more]
gi|386769141|ref|NP_001245892.1|1.138980e-3427.80lamin, isoform B [Drosophila melanogaster][more]
gi|386769143|ref|NP_001245893.1|1.138980e-3427.80lamin, isoform C [Drosophila melanogaster][more]
gi|665404412|ref|NP_001285629.1|1.138980e-3427.80lamin, isoform D [Drosophila melanogaster][more]
gi|24653664|ref|NP_523742.2|1.714550e-3125.08lamin C, isoform A [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_026655 ID=Pmo_026655|Name=ifb|organism=Phagocata morgani|type=mRNA|length=1984bp
CACTGATAGCCAATTAAAATGCAGTCGTCTAGAACAGTAACGAGCACAAA
CGTGTACAAGACATCTTCCTCTAGTAATACTCAACCGATTTCTGGCCCTA
GAAATGTAGTGATAAATAGAACCGCGCCCACAGCTCCGTCTGTCGGAGGT
CAAAGTGTTACTAATGTTCGACGAATCGAAATGAAGAAAAGCTACGGCGT
CAATGCCAGTTCAGGTGCTACGTCTAATATTGTACAATCAGGCGTCAGCA
CCTTAATGAACGGTCGTGAGAAAGAACGACAAGCACTTCAGGAGTTGAAT
GATCGATTCGCAAACTACATAGACAAGGTAAAGCATCTCGAGGATGAAAA
TAGAGCCCTGACCGACGAATTGGTGGACCTAAAAAATCAATGGGGCAAAG
AAACTGAACGAATCAAGGATCAGTATGATAATGATATGAATAACTTGCGG
AAATCTTTGGATTCTGCCGAAGGTGCAAAGGTGCAACTGGAGATGAGAAT
CAATTCTATTGAGGATTTGCTGCAGGAATCAGAGATTGAGCTTAGTGAAG
TGAATCAAATACATAATGCTGACAAAGAAACTATAGACAGAATGAATTCC
CAGCTTAATGACTACGAAAATGAAGTGACAAGTCTTCGTCGACGATTGAT
GGGTTTGGAAGACGAAAAAACACGAGACGATAAAGAGATTGGACGATTGA
AAGACGAAGTTACCCAATTGAAGAAGGACCTCGACAAAGAAACGCTTGAT
CACATAATGGCTCAAAATGAGGTGCAATCCTTACGAGACAAAATCGAATT
TCTAAAAAAGATCTACGAATCGGAGGTTCGCGAATTGACGTCATTGGCTT
ACAAAGATCCATCGGAGAGCAAAGACTTCTGGCGACATGAAATGGCACAG
GCCCTGCGAGATATTCAGTCTGAGTATGATCGTCGACTGGACTCTATGCA
GCATGATATGGAGGCGCAGTACAATATGAAAATCCAGGACTACCGGATAA
CGCAGTCTAAGGACAGCCAAGAGACGATTCAACTACGCGAAGACAACACG
AAGTTGAAAGAACAGTTGTCGGACATGCGTAATCGCCTCCCTGAATTGGA
AGCCAAGAATAACGAACTGGAAAAAATGTTGGAAATGTTACGACGTGAAA
TGGACGAACGTAATCGTGAATACGACCTGGAGAGGGCCAATTTAAGGAAA
GAATTGGCAAATCAACAAGCACATCTCGAGAGTATTTTCGCGGAATTACA
AGTTCTACTTGATGCAAAACTAAGCCTCGAGTTAGAAATTGTAGCATACA
GAAAAATGCTCGAAGGAGAAGAACACAGAGTAAACCAAAAGAACGTCATG
TCTCCAAATGTCGGACGAAGAGCCGACGCCACTGATTCCATGGTAACTCG
CACAGTTGCCGGCCAATCAATGGCGGCGGTTACAACGAGCAAAACACAAG
TGGTTAGCAGCACAGTAAAAGGTCAAATGTCTGCGAAGACGTCGTTTCAG
CGAACTGCCAAAGGAAATGTAACAATTCAAGAATGTTCCCCTGATGGGAA
ATTCGTTATTCTTGAGAATACCGGAGGCCAGCCCGAGAATATCTCCGGAT
TCAAAGTTAACAGAAATACCGATAATGGAAGAATAATAGTTCAGTTTGCA
ATTCCAGATAACACAATTCTGGAGCCAACTGGTCAAAATCGATTTCTAAA
AATTTGGTCAAAGGGCAGTAAACCTCCTGGTTCTAGCGATTTAGAATGCG
CGGAATCAAATTGGGGTGTCGGAGCATTGATTGTGACGATTCTTATCAAT
AAAAATGGCGAGGAAAAAGCCTCCCATACCCAACGAACAGTTTACCAGAT
GTAAGATGTCCATTCATTCTTGGGGAACATTGAGACACTCATCGATGACC
TATGCTAAATTCTTCATTTAGATTATTTTATGTTAAAAATTGTCTTTGTT
AAAATATAATAACGCTCTTATTCTTAAAAAAACA

Design Primers for ifb

back to top

protein sequence

>Pmo_026655-protein ID=Pmo_026655-protein|Name=ifb|organism=Phagocata morgani|type=polypeptide|length=612bp
MQSSRTVTSTNVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNV
RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANY
IDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSA
EGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYE
NEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQN
EVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQ
SEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQL
SDMRNRLPELEAKNNELEKMLEMLRREMDERNREYDLERANLRKELANQQ
AHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGR
RADATDSMVTRTVAGQSMAAVTTSKTQVVSSTVKGQMSAKTSFQRTAKGN
VTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTI
LEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEK
ASHTQRTVYQM*
back to top

coding sequence

>Pmo_026655.19.1854 ID=Pmo_026655.19.1854|Name=Pmo_026655.19.1854|organism=Phagocata morgani|type=CDS|length=1836bp
ATGCAGTCGTCTAGAACAGTAACGAGCACAAACGTGTACAAGACATCTTC
CTCTAGTAATACTCAACCGATTTCTGGCCCTAGAAATGTAGTGATAAATA
GAACCGCGCCCACAGCTCCGTCTGTCGGAGGTCAAAGTGTTACTAATGTT
CGACGAATCGAAATGAAGAAAAGCTACGGCGTCAATGCCAGTTCAGGTGC
TACGTCTAATATTGTACAATCAGGCGTCAGCACCTTAATGAACGGTCGTG
AGAAAGAACGACAAGCACTTCAGGAGTTGAATGATCGATTCGCAAACTAC
ATAGACAAGGTAAAGCATCTCGAGGATGAAAATAGAGCCCTGACCGACGA
ATTGGTGGACCTAAAAAATCAATGGGGCAAAGAAACTGAACGAATCAAGG
ATCAGTATGATAATGATATGAATAACTTGCGGAAATCTTTGGATTCTGCC
GAAGGTGCAAAGGTGCAACTGGAGATGAGAATCAATTCTATTGAGGATTT
GCTGCAGGAATCAGAGATTGAGCTTAGTGAAGTGAATCAAATACATAATG
CTGACAAAGAAACTATAGACAGAATGAATTCCCAGCTTAATGACTACGAA
AATGAAGTGACAAGTCTTCGTCGACGATTGATGGGTTTGGAAGACGAAAA
AACACGAGACGATAAAGAGATTGGACGATTGAAAGACGAAGTTACCCAAT
TGAAGAAGGACCTCGACAAAGAAACGCTTGATCACATAATGGCTCAAAAT
GAGGTGCAATCCTTACGAGACAAAATCGAATTTCTAAAAAAGATCTACGA
ATCGGAGGTTCGCGAATTGACGTCATTGGCTTACAAAGATCCATCGGAGA
GCAAAGACTTCTGGCGACATGAAATGGCACAGGCCCTGCGAGATATTCAG
TCTGAGTATGATCGTCGACTGGACTCTATGCAGCATGATATGGAGGCGCA
GTACAATATGAAAATCCAGGACTACCGGATAACGCAGTCTAAGGACAGCC
AAGAGACGATTCAACTACGCGAAGACAACACGAAGTTGAAAGAACAGTTG
TCGGACATGCGTAATCGCCTCCCTGAATTGGAAGCCAAGAATAACGAACT
GGAAAAAATGTTGGAAATGTTACGACGTGAAATGGACGAACGTAATCGTG
AATACGACCTGGAGAGGGCCAATTTAAGGAAAGAATTGGCAAATCAACAA
GCACATCTCGAGAGTATTTTCGCGGAATTACAAGTTCTACTTGATGCAAA
ACTAAGCCTCGAGTTAGAAATTGTAGCATACAGAAAAATGCTCGAAGGAG
AAGAACACAGAGTAAACCAAAAGAACGTCATGTCTCCAAATGTCGGACGA
AGAGCCGACGCCACTGATTCCATGGTAACTCGCACAGTTGCCGGCCAATC
AATGGCGGCGGTTACAACGAGCAAAACACAAGTGGTTAGCAGCACAGTAA
AAGGTCAAATGTCTGCGAAGACGTCGTTTCAGCGAACTGCCAAAGGAAAT
GTAACAATTCAAGAATGTTCCCCTGATGGGAAATTCGTTATTCTTGAGAA
TACCGGAGGCCAGCCCGAGAATATCTCCGGATTCAAAGTTAACAGAAATA
CCGATAATGGAAGAATAATAGTTCAGTTTGCAATTCCAGATAACACAATT
CTGGAGCCAACTGGTCAAAATCGATTTCTAAAAATTTGGTCAAAGGGCAG
TAAACCTCCTGGTTCTAGCGATTTAGAATGCGCGGAATCAAATTGGGGTG
TCGGAGCATTGATTGTGACGATTCTTATCAATAAAAATGGCGAGGAAAAA
GCCTCCCATACCCAACGAACAGTTTACCAGATGTAA
back to top
Gene Groups
ifb is similar in sequence to the genes of this group: GG6276
Gene NameGene ID
SMU15011956SMU15011956
ifbDdo_001875
ifbGsp_021856
ifbPgr_011052
ifbPmo_026655

Gene Group Protein Sequences

>SMU15011956

MLTSKTTTSKTNYKSTTNSPPIQPISGYRNVVITRTGPTVSTVGTQGGSN
IRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFAN
YIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQ
AEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDY
EHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAH
NELQSLVDQIEFLKKIFESEVRELASLVYKDSTENKDFWRNEMAQALRDI
QTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRIKDQ
LAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNR
KAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKSNQNLNQT
GRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNV
TIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTIL
EPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKA
THTQRTVYQL*
>Ddo_001875 ifb
PIYSEYIKSLSLYTNLIMQTSKTTSSKTTYSVLAQSNIQPISGPRNVVIT
RTGPTIAATGNQGTTNIRMIEMKKSYGVSANPGASTNIVHNGVNNLMNGR
EKEKNELQELNDRFANYIDKVRHLEDENKRLSEELMDLKDQWGKETARIK
ALYDNDMVLLRKSLDQAEASKAQLEMRINSIEDLIQEAQIELNDVNQLHI
SDKETIDKMTNQLSDYEHEISSLRRRLAGLEEEKVRDNKEIFRLKEEINQ
LKKDLDKETLEHITAQNEVQSLLDQIEFLKKIFESEIRELSSLIYKDASD
SKDFWRNEMAQALRDIQNEYDRKMETLQMEMEAQYTLKIQEFRTTQTKES
AETVQLREENARLKEQLVEMRNRLPELELRNNDLERMLDMLKREIDEKHR
EFESEKIHLRKELMNRQAELENIVLELQLLLDAKLSLELEIAAYRKMLEG
EEYRVNRKDAQFSQGGHSMDLTDHMTRSTISQQHTSPMTKTQITNVVKGE
MSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQQEDISGYVLNRNTDN
GRIVIKYVIPAKTILEPTGKNRYYKIWAKGQKPQGSSEAELSESNWGTGA
QILTTLQNSKGEEKATHTQRTVYQM*
>Gsp_021856 ifb
TTSKTNFKTTTNTANIQPISGYRNVVITRTGPAVSTTGNQNASSVRTIEM
KKSYGVSATPGATSNIVHSGVNNLMNGREKEKNELQELNDRFANYIDKVR
SLEDENKRLTDELNDLKDQWGKETARIKALYDSDMSQLRRSLDQAEASKA
QLEMKINTLEDLIQEAQMELNDATQLHSADKETIDKMSSTLADYEHEIGN
LRKRLSSLEEEKIRDNKEIIRLKEELNQLKKDLDKETLEHITAHNEVQSL
LDQIEFLKKIFESEIRELAALVYKDSSESKDFWRNEMAQALRDIQSEYDK
KMEALHYDMEAQYTLKIQEIRTNQSKENVETVQLREENTRLKDQLADMRN
RLPELEARNSELERLLELLRREIEEKNREFDMEKANLRKELMNRQSELES
ILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKNNISSSNSFNQAGR
NVDLMDHVTRSSISQQQAAPSTKTQVTSIVKGEMSAKTSFQRTAKGNVTI
QECSADGKFIILENTGSQDEDISGYILNRNTDNGRIIVKHVISPKTILEP
TGKNRYYKIWARGNKPQGSNDAECSESNWGYGAQIVTTLQNSKGEEKATH
TQRTVYQL*
>Pgr_011052 ifb
TSSTIIMQSSRTATSTNVYKTSSSNNIQPISGPRNVVINRTAPSVQQTGG
AGVTNIRRIEMKKSYGLNATPGATSNIVQSGVSSLMNGREKERHELQELN
DRFANYIDKVKHLEDENRRLTDELTELKNQWGKETERIKDQYDNDMNNLR
KSLDSAEGAKVQLEMRINSFEDFLQESEIELSEVNQIHNADKETIDKMNS
QLSDYENEITSLRRRLTGLEDEKIRDDKEISRLKDEVAQLKKDLDKETLD
HIMAQNEVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRNEMAQ
ALRDIQSEYDRRIDSIQHDMEAQYNLKIQDYRITQSKDTQETIQLREDNT
KLKEQLSEMRNRLPELEARNNELERMLEMLRREIDERSRDYDMERANLRK
ELSSRQAQLESIFAELQILLDAKLSLELEIVAYRKMLEGEEHRVNQKNAM
SLNAMSSNAMSSSSGQRMDFADSTITRTNVGQSMAAVTTSKTQVSSTVKG
QMSAKTSFQRTAKGNVTIQECSPDGKFVVLENTGGQPENISGFKVNRNTD
NGRIVVIFAIPENTILDPTGQNRFLKIWAKGSKPPGSDDMECAESNWGVG
TLIVTMLFNKKGEEKASHTQRTVYQM*
>Pmo_026655 ifb
MQSSRTVTSTNVYKTSSSSNTQPISGPRNVVINRTAPTAPSVGGQSVTNV
RRIEMKKSYGVNASSGATSNIVQSGVSTLMNGREKERQALQELNDRFANY
IDKVKHLEDENRALTDELVDLKNQWGKETERIKDQYDNDMNNLRKSLDSA
EGAKVQLEMRINSIEDLLQESEIELSEVNQIHNADKETIDRMNSQLNDYE
NEVTSLRRRLMGLEDEKTRDDKEIGRLKDEVTQLKKDLDKETLDHIMAQN
EVQSLRDKIEFLKKIYESEVRELTSLAYKDPSESKDFWRHEMAQALRDIQ
SEYDRRLDSMQHDMEAQYNMKIQDYRITQSKDSQETIQLREDNTKLKEQL
SDMRNRLPELEAKNNELEKMLEMLRREMDERNREYDLERANLRKELANQQ
AHLESIFAELQVLLDAKLSLELEIVAYRKMLEGEEHRVNQKNVMSPNVGR
RADATDSMVTRTVAGQSMAAVTTSKTQVVSSTVKGQMSAKTSFQRTAKGN
VTIQECSPDGKFVILENTGGQPENISGFKVNRNTDNGRIIVQFAIPDNTI
LEPTGQNRFLKIWSKGSKPPGSSDLECAESNWGVGALIVTILINKNGEEK
ASHTQRTVYQM*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.