tnxb, Pmo_024144 (mRNA) Phagocata morgani

Overview
Nametnxb
Unique NamePmo_024144
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length1653
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of tnxb vs. Smed Unigenes AA
Match: SMU15000337 (Asxlregen_comp45583_c0_seq1|m.3077|m.30111)

HSP 1 Score: 561.992 bits (1447), Expect = 0
Identity = 296/534 (55.43%), Postives = 364/534 (68.16%), Query Frame = 2
Query:   17 FTMLLVIRLLHSFVVLFILLQW------------HSTIAKLY-GGMACKLNGQCMSGLCVKSLNRWFCSKESKYDKSKIAGGGFCMEDWQCFSSLCLQMGTFKFCAKESRRQGRVAERGRCREHNNCFSGSCLAINSNSTMKFCSKDSNVIGRVGEGGLCTLDKQCHSGYCALLEDKKMYCSKDSRAVDKIGQGGPCLIDSQCYSGVCFKFKGKLRCARESKEINKVGSGGSCLKRQQCFSNYCVVDKVSKRQFCAKVSRLQGLVGGGGQCKRDDMCFSGFCVKLGNINVCAKDSSKRNKIGGGGPCRRPDECFSGHCVKKSRAKMGFCSKDAPTFNHIGGGGPCKFHAQCYSLYCHKLNNKTKACAKDSFYPGKVGGGGPCRDDFDCASNYCYQARGVKFCVQESKSKLGFIAEGGLCMIHRSCNSGFCVKNNSTGFCAKESRMDGKIGGGGPCKMDYQCFSGYCFNNGSMMYCAKDGHKYNRVGISGPCRKNSECSSKRCVEMNLKTAINNSTKAKVCLEKKKHSTKKGNTI 1579
+ ++ I+L H +V+ L W H T A + GG C+ N C S CVK RWFC+ +S+ + KIAGGG C D QCFS +CL MG+FKFC+KE++ Q +VAERGRCRE +NCFSG C + SNSTMKFC+KDS + G++G GG+C D QCHSG+C + +CSKDSR + +GQGGPC D+QC+SGVCFK +G++ CARESK+ VGSGG C+K +QCFSN+CV D++ K +FCAKVSR LVGGGGQC D MCFSG CV LG + VCAKDS N +GGGG CRR ECFSG CVK+ K+GFCSKD+ F IGGGG C+ +AQC+S YCHK++ KTK CAKDS + GKV GGGPC DF CASN+C+ G K+CVQES K G+IAEGG C+ H C SG+CVK FCAKES+ KIGGGGPC D+QCFS YC+ NG + YCAKDG ++ VGISGPCR+N +CSS RCV M K+ KVC KK NTI
Sbjct: 21 ISFVIFIQLHHQLIVMNSYLLWIIFTAAFSIYYIHRTEAVVRPGGYKCQKNEDCASKFCVKVTKRWFCAPQSRNGRGKIAGGGICEADDQCFSGVCLNMGSFKFCSKETKIQNKVAERGRCREDSNCFSGFCNPVRSNSTMKFCAKDSLIAGKIGGGGICKNDNQCHSGFCVQVAGITRHCSKDSRRIGLVGQGGPCQNDAQCFSGVCFKHQGQMVCARESKKKGLVGSGGRCIKDEQCFSNFCVKDRLGKYKFCAKVSRNPKLVGGGGQCLHDKMCFSGVCVTLGTMQVCAKDSKFNNIVGGGGACRRHVECFSGLCVKQENTKIGFCSKDSSIFKSIGGGGICRNNAQCFSRYCHKVDAKTKICAKDSKFRGKVAGGGPCNSDFYCASNFCHDNNGTKYCVQESSQKPGYIAEGGFCVNHHLCYSGYCVKIGKESFCAKESKKIEKIGGGGPCVRDWQCFSRYCYFNGKLKYCAKDGQRFGEVGISGPCRRNKDCSSSRCVSMKTKSVNGTEGTVKVCQNSKKQKNPLYNTI 554
The following BLAST results are available for this feature:
BLAST of tnxb vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tnxb vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 1
Match NameE-valueIdentityDescription
SMU150003370.000000e+055.43Asxlregen_comp45583_c0_seq1|m.3077|m.30111[more]
back to top
BLAST of tnxb vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tnxb vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_024144 ID=Pmo_024144|Name=tnxb|organism=Phagocata morgani|type=mRNA|length=1653bp
TCATTATCATTTATTATTTACGATGTTACTTGTAATACGACTGCTGCATT
CATTCGTCGTCCTTTTCATACTACTTCAATGGCACTCAACTATCGCCAAA
TTATATGGAGGTATGGCATGCAAACTTAACGGACAGTGCATGTCAGGACT
ATGTGTCAAGTCCTTAAATCGTTGGTTTTGTTCGAAGGAGTCAAAGTATG
ACAAATCAAAGATCGCCGGTGGTGGATTCTGTATGGAGGACTGGCAATGC
TTCTCTAGCCTCTGTCTGCAGATGGGCACCTTCAAGTTCTGTGCCAAAGA
GTCCAGACGACAGGGTCGAGTGGCTGAGAGAGGCCGATGCCGAGAACACA
ATAATTGCTTCTCTGGCAGCTGTCTTGCGATAAATTCTAACTCTACGATG
AAGTTTTGTTCGAAAGACTCCAACGTTATTGGTCGGGTTGGCGAAGGAGG
ACTCTGCACTCTGGATAAACAGTGCCACTCAGGCTACTGTGCTCTGCTTG
AAGACAAGAAGATGTATTGCAGCAAAGACTCCCGAGCAGTGGACAAAATA
GGGCAAGGAGGACCTTGTTTGATCGACTCGCAGTGCTATTCAGGAGTCTG
TTTCAAGTTCAAAGGAAAACTGCGATGTGCTCGTGAATCAAAAGAAATAA
ACAAAGTTGGCAGTGGCGGAAGTTGTCTCAAGCGGCAGCAATGTTTTTCG
AATTATTGCGTCGTAGACAAAGTGTCCAAAAGGCAATTCTGTGCCAAAGT
ATCGCGACTTCAGGGACTCGTCGGAGGGGGCGGACAGTGCAAACGCGATG
ACATGTGCTTCTCCGGGTTTTGTGTAAAACTTGGAAACATAAATGTCTGT
GCAAAAGATTCCTCGAAAAGAAATAAAATTGGCGGCGGAGGACCGTGCAG
AAGACCGGATGAGTGCTTTTCGGGACATTGTGTAAAAAAAAGTCGCGCTA
AGATGGGGTTTTGTTCAAAAGATGCACCGACATTTAACCACATTGGCGGA
GGGGGTCCTTGCAAATTCCATGCCCAATGTTACTCCTTATACTGTCACAA
ACTCAATAATAAGACGAAAGCATGTGCCAAGGATTCGTTCTATCCTGGGA
AAGTCGGGGGAGGAGGACCATGCCGAGATGATTTTGACTGTGCTTCGAAT
TACTGCTACCAAGCAAGGGGAGTCAAATTCTGTGTTCAAGAGTCAAAATC
AAAACTTGGATTTATCGCAGAGGGAGGGCTGTGCATGATTCATAGATCGT
GTAATTCTGGATTTTGTGTGAAGAATAATTCAACAGGTTTCTGTGCCAAA
GAGTCTCGGATGGATGGGAAAATCGGAGGAGGTGGTCCTTGCAAGATGGA
CTACCAATGCTTCTCTGGCTATTGCTTCAATAATGGCAGCATGATGTACT
GTGCTAAGGATGGCCATAAATACAACAGAGTGGGTATCAGTGGTCCATGT
AGAAAAAATTCCGAGTGCAGCTCCAAACGGTGCGTAGAAATGAACCTGAA
GACTGCTATCAACAACAGCACCAAAGCGAAAGTGTGTTTGGAAAAGAAAA
AACATAGCACGAAAAAAGGGAACACAATTAAATGAACTAATTTCGTAAAT
TGAAAAAATAATGATTTAATTTAATAATGTGTAATAATTGTGGCGGATAT
ATA

Design Primers for tnxb

back to top

protein sequence

>Pmo_024144-protein ID=Pmo_024144-protein|Name=tnxb|organism=Phagocata morgani|type=polypeptide|length=528bp
HYHLLFTMLLVIRLLHSFVVLFILLQWHSTIAKLYGGMACKLNGQCMSGL
CVKSLNRWFCSKESKYDKSKIAGGGFCMEDWQCFSSLCLQMGTFKFCAKE
SRRQGRVAERGRCREHNNCFSGSCLAINSNSTMKFCSKDSNVIGRVGEGG
LCTLDKQCHSGYCALLEDKKMYCSKDSRAVDKIGQGGPCLIDSQCYSGVC
FKFKGKLRCARESKEINKVGSGGSCLKRQQCFSNYCVVDKVSKRQFCAKV
SRLQGLVGGGGQCKRDDMCFSGFCVKLGNINVCAKDSSKRNKIGGGGPCR
RPDECFSGHCVKKSRAKMGFCSKDAPTFNHIGGGGPCKFHAQCYSLYCHK
LNNKTKACAKDSFYPGKVGGGGPCRDDFDCASNYCYQARGVKFCVQESKS
KLGFIAEGGLCMIHRSCNSGFCVKNNSTGFCAKESRMDGKIGGGGPCKMD
YQCFSGYCFNNGSMMYCAKDGHKYNRVGISGPCRKNSECSSKRCVEMNLK
TAINNSTKAKVCLEKKKHSTKKGNTIK*
back to top

coding sequence

>Pmo_024144.2.1585 ID=Pmo_024144.2.1585|Name=Pmo_024144.2.1585|organism=Phagocata morgani|type=CDS|length=1584bp
CATTATCATTTATTATTTACGATGTTACTTGTAATACGACTGCTGCATTC
ATTCGTCGTCCTTTTCATACTACTTCAATGGCACTCAACTATCGCCAAAT
TATATGGAGGTATGGCATGCAAACTTAACGGACAGTGCATGTCAGGACTA
TGTGTCAAGTCCTTAAATCGTTGGTTTTGTTCGAAGGAGTCAAAGTATGA
CAAATCAAAGATCGCCGGTGGTGGATTCTGTATGGAGGACTGGCAATGCT
TCTCTAGCCTCTGTCTGCAGATGGGCACCTTCAAGTTCTGTGCCAAAGAG
TCCAGACGACAGGGTCGAGTGGCTGAGAGAGGCCGATGCCGAGAACACAA
TAATTGCTTCTCTGGCAGCTGTCTTGCGATAAATTCTAACTCTACGATGA
AGTTTTGTTCGAAAGACTCCAACGTTATTGGTCGGGTTGGCGAAGGAGGA
CTCTGCACTCTGGATAAACAGTGCCACTCAGGCTACTGTGCTCTGCTTGA
AGACAAGAAGATGTATTGCAGCAAAGACTCCCGAGCAGTGGACAAAATAG
GGCAAGGAGGACCTTGTTTGATCGACTCGCAGTGCTATTCAGGAGTCTGT
TTCAAGTTCAAAGGAAAACTGCGATGTGCTCGTGAATCAAAAGAAATAAA
CAAAGTTGGCAGTGGCGGAAGTTGTCTCAAGCGGCAGCAATGTTTTTCGA
ATTATTGCGTCGTAGACAAAGTGTCCAAAAGGCAATTCTGTGCCAAAGTA
TCGCGACTTCAGGGACTCGTCGGAGGGGGCGGACAGTGCAAACGCGATGA
CATGTGCTTCTCCGGGTTTTGTGTAAAACTTGGAAACATAAATGTCTGTG
CAAAAGATTCCTCGAAAAGAAATAAAATTGGCGGCGGAGGACCGTGCAGA
AGACCGGATGAGTGCTTTTCGGGACATTGTGTAAAAAAAAGTCGCGCTAA
GATGGGGTTTTGTTCAAAAGATGCACCGACATTTAACCACATTGGCGGAG
GGGGTCCTTGCAAATTCCATGCCCAATGTTACTCCTTATACTGTCACAAA
CTCAATAATAAGACGAAAGCATGTGCCAAGGATTCGTTCTATCCTGGGAA
AGTCGGGGGAGGAGGACCATGCCGAGATGATTTTGACTGTGCTTCGAATT
ACTGCTACCAAGCAAGGGGAGTCAAATTCTGTGTTCAAGAGTCAAAATCA
AAACTTGGATTTATCGCAGAGGGAGGGCTGTGCATGATTCATAGATCGTG
TAATTCTGGATTTTGTGTGAAGAATAATTCAACAGGTTTCTGTGCCAAAG
AGTCTCGGATGGATGGGAAAATCGGAGGAGGTGGTCCTTGCAAGATGGAC
TACCAATGCTTCTCTGGCTATTGCTTCAATAATGGCAGCATGATGTACTG
TGCTAAGGATGGCCATAAATACAACAGAGTGGGTATCAGTGGTCCATGTA
GAAAAAATTCCGAGTGCAGCTCCAAACGGTGCGTAGAAATGAACCTGAAG
ACTGCTATCAACAACAGCACCAAAGCGAAAGTGTGTTTGGAAAAGAAAAA
ACATAGCACGAAAAAAGGGAACACAATTAAATGA
back to top
Gene Groups
tnxb is similar in sequence to the genes of this group: GG2694
Gene NameGene ID
SMU15000337SMU15000337
Ddo_006968Ddo_006968
Gsp_004346Gsp_004346
Pgr_000233Pgr_000233
Pgr_004696Pgr_004696
Pmo_015562Pmo_015562
tnxbPmo_024144

Gene Group Protein Sequences

>SMU15000337

LKTSFVQVQSLDQKSKISSRISFVIFIQLHHQLIVMNSYLLWIIFTAAFS
IYYIHRTEAVVRPGGYKCQKNEDCASKFCVKVTKRWFCAPQSRNGRGKIA
GGGICEADDQCFSGVCLNMGSFKFCSKETKIQNKVAERGRCREDSNCFSG
FCNPVRSNSTMKFCAKDSLIAGKIGGGGICKNDNQCHSGFCVQVAGITRH
CSKDSRRIGLVGQGGPCQNDAQCFSGVCFKHQGQMVCARESKKKGLVGSG
GRCIKDEQCFSNFCVKDRLGKYKFCAKVSRNPKLVGGGGQCLHDKMCFSG
VCVTLGTMQVCAKDSKFNNIVGGGGACRRHVECFSGLCVKQENTKIGFCS
KDSSIFKSIGGGGICRNNAQCFSRYCHKVDAKTKICAKDSKFRGKVAGGG
PCNSDFYCASNFCHDNNGTKYCVQESSQKPGYIAEGGFCVNHHLCYSGYC
VKIGKESFCAKESKKIEKIGGGGPCVRDWQCFSRYCYFNGKLKYCAKDGQ
RFGEVGISGPCRRNKDCSSSRCVSMKTKSVNGTEGTVKVCQNSKKQKNPL
YNTI*
>Ddo_006968 Ddo_006968
KSIDNLSNLILFSTFIFIMNTYLTILLFGCLLNFCIYQTSGILLPGGYRC
KSDSDCASAFCVQAKIRWYCAPNSRNGRKSIAEGGICEKDDQCFSGVCLE
MGKFKFCSKESKIRNKVAERGRCREDSNCFSGFCVPIRPDSDMKFCAKDS
LVKDKVGSGGICKTDDQCYCGYCVQVAGMTKHCSQDSRVINKIGQGGPCK
SDDQCFSGVCFKHRGQKVCAKESKKMNLVGSGGRCYKNGQCFSNYCILDP
IRKIKFCAKSSRYKNFVGGGGQCTEDKMCFSGVCAKLGSMKVCAKDSKFQ
SQVGGGGSCRRNENCFSGYCVKKDNMDFGFCSKDSSVRLLIGGGGICRNI
QQCFSRYCYVVDGKTKICAKDSKFRGKVGGGGPCKTDNHCASNFCHNLNG
KKFCIQESPQKVGFVGEGSLCKSHLSCYSGYCVKMKNESFCAKESFRMEK
IGGGGPCQYNWQCFSGYCYTNGKLKYCAKDGYKFGEIGVSGPCRKNKDCS
SGRCVSMKSKLADGTESRVKVCQNSKKKKENPFKN*
>Gsp_004346 Gsp_004346
MSSYFVTLFLAVTACLYLHVTVAVVRPGGFRCQRDYECASKFCVKSTKRW
FCSPQSRNRRGTIAGGGICEKDDQCFSGVCLSMGNLKFCSKETKVQKKVA
ERGRCREDSNCFSGYCIPIKPNSEMKFCAKDSLLAGFIGSGGICNEDKQC
NSGYCVQVAGTTKHCSKDSRRQGLIGQGGPCLKDSQCFSGVCFKYRGQNV
CARESKKPGFVGSGGRCKKNEQCFSNYCVEDKITKKKFCAKASRYQKLVG
GGGQCTEDKMCFSGVCVLLGNMQVCAKDSKSSNLVGGGGACRRHVECFSG
LCVKRDNGKVGFCSKDSSVIKLIGGGGICKNNGQCFSRYCYKVDAETKIC
AKDSKFKGKVGGGGPCKNDFFCASNLCHELNGVKYCVQESKQKVGYIGEG
SLCKSHHSCYSGYCVKVGNEGFCAKESLKSEKVGGGGPCVRDWQCYSRYC
FTNGKLKYCAKDGKQFGEVGISGPCRRNKDCSSGRCVSMKTKLADGTESK
VKVCQNPKKKDNPLYNYN*
>Pgr_000233 Pgr_000233
MLYSIKLLSPLTIILVLVHCQINYAWLPGGVSCKRDLECASKYCVKSIGR
WFCSKESKYGKRRVAGGGFCLSDEQCYSGVCLGVGKYFFCSKESKREGRV
AERGRCKEHKNCFSGVCMAIKINSTMKFCAKDSKEVGRVGGGGKCYADNQ
CFSGYCSVWKKNKKHCSKDSVKKGKIGGGGPCLKDLQCFSGVCFKYKNSM
RCASDSSKIGKVGSGGSCSSGSQCFSGHCIRDKVTNRNYCAKTSRHMGLI
GGGGQCLEDKMCFSGFCVQLGSIRVCAKDSKTVQRVGGGGSCRWNDECFS
GFCVRNKGKKVGYCSQDSQLFMLIGGGGPCLNNAQCYSFYCYKVDRKLRV
CAKDSYFRGKVGGGGPCKDDGYCASGYCVKTDKKALTGYCVQESKTKLGF
VAEGGACIVHHSCYSGYCAKVNNVSFCAKESKRLGKVGGGGPCQKDWQCF
SRYCYQNGNVKYCAKDGDKYGSVALGGPCRQNGDCGNVNRCVLMNVKVAN
SLDTKIKVCAKKRRMI*
>Pgr_004696 Pgr_004696
MFGSSKSLLILTTLCLVVSWHVTMAKLPGGMACKNDEQCKSRFCVKSLSR
WFCSKESTFGRQMIAGGGFCVNNDQCFSGLCLEMGKFKFCAKESRMRGKI
AERGRCLQHENCFSGSCLSINDNSTMKFCSKDSNVVGKIGEGGICTENDQ
CHSGYCVMLGDKKMYCSKDSRQQGRIGQGGPCLMNSQCYSGVCFKYKNKM
RCARESRKIDKVGSGGSCHNNSQCFSNYCIADKVSRRQFCAKVSRSEGLV
GGGGQCYNDKMCYSGYCVKLGNLMACAKDSIKKMKVGGGGPCRKNDGCFS
GYCVKNAGAKFGYCSKDSPEYNFVGGGGPCTSHVQCYSKYCHSLNDKLKV
CAKDSIYKGKVGGGGPCQNDFHCASTLCLRKIIAGPVRFCVQESSSRLGF
VAEGGICEDNRNCNSGYCVKQRTNSFCAKESKRDGKIGGGGPCYNDSQCF
SGYCYSNQGVKYCAKDGRKYRKVGISGPCRINADCSSKRCVKMIVYGVND
KMKEKVCLEKKKGTSKKDVI*
>Pmo_015562 Pmo_015562
MGFFLKSQLFPLVILLFIIASNVTWAWLPGGVSCKRDHECSSKFCVKTFG
RWFCSMESKYGSRRVAGGGFCATDEQCYSGLCLEIGKKKFCSKDSKKEGK
VAERGRCRDHKNCFSGVCLPIMKNETMKFCSKDSAVINKVGEGGICTENK
QCYCGYCATLKGNTTYCSKDSKVNGKIGGGGPCLRHDQCFSGVCFKYKSK
LRCARDSKTMNKVGSGGQCISNDQCFSGYCIPDSMSKKKYCAKSSRHQGL
IGGGGQCLTDNSCFSGFCVQLGKIKVCAKDSKTVQRVGGGGSCRRSKECF
SGYCVKGTGQKIGYCSQDSPLFKLIGAGGPCKNNNQCFSFYCYKVSKKLK
VCAQDSVYRGKVGGGGPCKSDIYCASGHCIKNESGLRFCVQESNRKLGFI
REGGRCNIHHACYSGYCIKADNNSFCAKESERMGKIGEGGPCLKDWQCYS
RYCYSNGNQKYCATNGDEYGSVGLNGPCRRNTDCSSRRCVEMKLKTPIND
ATKIKLCLKRKPLI*
>Pmo_024144 tnxb
HYHLLFTMLLVIRLLHSFVVLFILLQWHSTIAKLYGGMACKLNGQCMSGL
CVKSLNRWFCSKESKYDKSKIAGGGFCMEDWQCFSSLCLQMGTFKFCAKE
SRRQGRVAERGRCREHNNCFSGSCLAINSNSTMKFCSKDSNVIGRVGEGG
LCTLDKQCHSGYCALLEDKKMYCSKDSRAVDKIGQGGPCLIDSQCYSGVC
FKFKGKLRCARESKEINKVGSGGSCLKRQQCFSNYCVVDKVSKRQFCAKV
SRLQGLVGGGGQCKRDDMCFSGFCVKLGNINVCAKDSSKRNKIGGGGPCR
RPDECFSGHCVKKSRAKMGFCSKDAPTFNHIGGGGPCKFHAQCYSLYCHK
LNNKTKACAKDSFYPGKVGGGGPCRDDFDCASNYCYQARGVKFCVQESKS
KLGFIAEGGLCMIHRSCNSGFCVKNNSTGFCAKESRMDGKIGGGGPCKMD
YQCFSGYCFNNGSMMYCAKDGHKYNRVGISGPCRKNSECSSKRCVEMNLK
TAINNSTKAKVCLEKKKHSTKKGNTIK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.