slit, Pmo_017648 (mRNA) Phagocata morgani

Overview
Nameslit
Unique NamePmo_017648
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length9476
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of slit vs. uniprot
Match: gi|33302576|sp|P24014|SLIT_DROME (RecName: Full=Protein slit; Short=dSlit; Contains: RecName: Full=Protein slit N-product; Contains: RecName: Full=Protein slit C-product; Flags: Precursor)

HSP 1 Score: 771.155 bits (1990), Expect = 0
Identity = 483/1541 (31.34%), Postives = 771/1541 (50.03%), Query Frame = 3
Query: 4830 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +LRLN N ++ +P+ + +L +LD+ +N + V V G +L++L LD N+I + E + L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 771.155 bits (1990), Expect = 0
Identity = 483/1541 (31.34%), Postives = 771/1541 (50.03%), Query Frame = -3
Query:  184 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4647
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +LRLN N ++ +P+ + +L +LD+ +N + V V G +L++L LD N+I + E + L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 3 Score: 293.893 bits (751), Expect = 1.05125e-78
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4824 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 6770
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 317 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 926

HSP 4 Score: 293.893 bits (751), Expect = 1.05125e-78
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = -3
Query: 2707 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 4653
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 317 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 926

HSP 5 Score: 167.548 bits (423), Expect = 9.19281e-40
Identity = 125/494 (25.30%), Postives = 221/494 (44.74%), Query Frame = 3
Query: 6180 IPKISCPKNCTCTPEVVDCNGAHLTTIP-------------------------------------DNM-----------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 7445
I + CP+ C+CT VDC+ LT++P DN L S + + L+ N+LK I + + + +L+++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 6 Score: 167.548 bits (423), Expect = 9.19281e-40
Identity = 125/494 (25.30%), Postives = 221/494 (44.74%), Query Frame = -3
Query: 2032 IPKISCPKNCTCTPEVVDCNGAHLTTIP-------------------------------------DNM-----------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 3297
I + CP+ C+CT VDC+ LT++P DN L S + + L+ N+LK I + + + +L+++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 7 Score: 108.612 bits (270), Expect = 6.85418e-22
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = 3
Query: 6849 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 7472
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L ++ N+L+ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324

HSP 8 Score: 108.612 bits (270), Expect = 6.85418e-22
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = -3
Query: 2005 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 2628
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L ++ N+L+ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324
BLAST of slit vs. uniprot
Match: gi|341942041|sp|Q9WVB4|SLIT3_MOUSE (RecName: Full=Slit homolog 3 protein; Short=Slit-3; Short=Slit3; Flags: Precursor)

HSP 1 Score: 765.377 bits (1975), Expect = 0
Identity = 506/1577 (32.09%), Postives = 777/1577 (49.27%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEPE------ICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRK--------AYMCRRKMIKNHIKD-PDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGS-----------------SRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKC 9281
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ +KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS N++KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +PKG+P + TELYL+ N+L + + S+F+ L TL+ LS N I+ L + + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCK+NG CS QY+C CP+ + GK+C IN C +PC++GG C +N + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C YC ++N C + C L + +RC C G+ GK C+ N DDC ++CR+ AQCVD VNGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + +S +++GG P +AL + F GC+ + IN + DF +S+ V PGC+ + L V K + + E C++ G C A D + C C +G+ G C++K A+ C HI D + CL +CE Q++ +I + R D S S+CCQP + + R+ F+C G + V C C
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRNRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTV-CRHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCRH-GTCMATGD---SYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQC--HISDRGEPYCLCQPGFSGHHCE---QENPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 765.377 bits (1975), Expect = 0
Identity = 506/1577 (32.09%), Postives = 777/1577 (49.27%), Query Frame = -3
Query:  196 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEPE------ICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRK--------AYMCRRKMIKNHIKD-PDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGS-----------------SRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKC 4650
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ +KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS N++KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +PKG+P + TELYL+ N+L + + S+F+ L TL+ LS N I+ L + + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCK+NG CS QY+C CP+ + GK+C IN C +PC++GG C +N + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C YC ++N C + C L + +RC C G+ GK C+ N DDC ++CR+ AQCVD VNGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + +S +++GG P +AL + F GC+ + IN + DF +S+ V PGC+ + L V K + + E C++ G C A D + C C +G+ G C++K A+ C HI D + CL +CE Q++ +I + R D S S+CCQP + + R+ F+C G + V C C
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRNRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCEHGGTCHLSENLRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACLCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETNNDDCVAHKCRHGAQCVDEVNGYTCICPQGFSGLFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGSNSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTV-CRHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCRH-GTCMATGD---SYVCKCAEGYGGALCDQKNDSASACSAFKCHHGQC--HISDRGEPYCLCQPGFSGHHCE---QENPCMGEIVREAIRRQKDYASCATASKVPIMECRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 3 Score: 324.709 bits (831), Expect = 2.63503e-88
Identity = 221/673 (32.84%), Postives = 332/673 (49.33%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 6797
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I +P GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D +N + C +C + C C EG IV C + + +P LP +L L+DN I+VL+ + K NL+KI L++N + ++ GAF+G + L L GN+L+++ GLSSL L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC ++WL +LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP ++ + + F C+ V NA ++ C N
Sbjct: 276 NSLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQLTL--IDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 4 Score: 324.709 bits (831), Expect = 2.63503e-88
Identity = 221/673 (32.84%), Postives = 332/673 (49.33%), Query Frame = -3
Query: 2680 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 4659
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I +P GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D +N + C +C + C C EG IV C + + +P LP +L L+DN I+VL+ + K NL+KI L++N + ++ GAF+G + L L GN+L+++ GLSSL L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC ++WL +LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP ++ + + F C+ V NA ++ C N
Sbjct: 276 NSLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLARIPSHLPEYTTDLRLNDNDISVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSSLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCVETVVRCSNRGLHALPKGMPKDVTELYLEGNHLTAVPKELSAFRQLTL--IDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 5 Score: 184.882 bits (468), Expect = 4.62657e-45
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = 3
Query: 6183 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXXIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 7421
P +CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G +V+ + +K ++C G SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTIGQFT--LCMAPVHLRGFSVADVQKKEYVC--------------PGPHSEAPACNAN------SLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 184.882 bits (468), Expect = 4.62657e-45
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = -3
Query: 2056 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXLIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 3294
P +CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G +V+ + +K ++C G SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSIIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTIGQFT--LCMAPVHLRGFSVADVQKKEYVC--------------PGPHSEAPACNAN------SLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFVPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. uniprot
Match: gi|45477220|sp|O88280|SLIT3_RAT (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 764.992 bits (1974), Expect = 0
Identity = 502/1576 (31.85%), Postives = 777/1576 (49.30%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEPEICKNG-----GVCQAVNDGKKKFKCICKDGFSGKSCNRK--------AYMCRRKMIKNHIKD-PDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGS-----------------SRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKC 9281
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ +KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A +YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L+ IP ++ LP+ + + LS N++KE+ + A ++ L+ N+++ + +F S LK + L SN + C+NN TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R G CQ P L+ + + + F C N N+ C + RCP +C C T V CS L +PKG+P + TELYL+ N+L + + S+F+ L TL+ LS N I+ L + + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCK+NG CS QY+C CP+ + GK+C IN C +PC++GG C +++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C YC ++N C + C L + +RC C G+ GK C+ + DDC ++CR+ AQCVD VNGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PGC+ + L V K + + E + G G C A + + C C +G+ G C++K A+ C HI D + CL +CE Q++ +I + R D S S+CCQP + + R+ F+C G + V C C
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRNRFSSECFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEENS-----------------------CQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTV-CRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSHGTCVATGN---SYVCKCAEGYEGPLCDQKNDSANACSAFKCHHGQC--HISDRGEPYCLCQPGFSGNHCE---QENPCLGEIVREAIRRQKDYASCATASKVPIMVCRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 2 Score: 764.992 bits (1974), Expect = 0
Identity = 502/1576 (31.85%), Postives = 777/1576 (49.30%), Query Frame = -3
Query:  196 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEPEICKNG-----GVCQAVNDGKKKFKCICKDGFSGKSCNRK--------AYMCRRKMIKNHIKD-PDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGS-----------------SRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKC 4650
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ +KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + + Q LC P L ++ + E+ C +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A +YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L+ IP ++ LP+ + + LS N++KE+ + A ++ L+ N+++ + +F S LK + L SN + C+NN TF L + L L DN I I G+F ++ + L NP +CNC + W+ W R G CQ P L+ + + + F C N N+ C + RCP +C C T V CS L +PKG+P + TELYL+ N+L + + S+F+ L TL+ LS N I+ L + + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE+M + + + F C D I AKC+AC+ SPCK+NG CS QY+C CP+ + GK+C IN C +PC++GG C +++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C YC ++N C + C L + +RC C G+ GK C+ + DDC ++CR+ AQCVD VNGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ ++ + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PGC+ + L V K + + E + G G C A + + C C +G+ G C++K A+ C HI D + CL +CE Q++ +I + R D S S+CCQP + + R+ F+C G + V C C
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTI----GQFTLCMAPVHLRGFSVADVQKKEYVCPG--PHSEAPACNANSLSCPSACSCSNN-IVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRNRFSSECFMDLVCPEKCRCEGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQ-ELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCEGNEENS-----------------------CQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQL----TLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCSQDPVEQYRCTCPYSYKGKDCTVPINTCVQNPCQHGGTCHLSESHRDGFSCSCPLGFEGQRCEINPDDCEDNDCENSATCVDGINNYACVCPPNYTGELCDEVIDYCVPEMNLCQHEAKCISL-DKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDAVNGYTCICPQGFSGLFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTV-CRHGLCRSVEKDSVVCECHPGWTGPLCDQEAQDPCLGHSCSHGTCVATGN---SYVCKCAEGYEGPLCDQKNDSANACSAFKCHHGQC--HISDRGEPYCLCQPGFSGNHCE---QENPCLGEIVREAIRRQKDYASCATASKVPIMVCRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECGC 1519

HSP 3 Score: 322.013 bits (824), Expect = 1.63677e-87
Identity = 221/673 (32.84%), Postives = 331/673 (49.18%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 6797
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F + LK + +S N+I+ I F L LT L L N I +P GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D +N + C +C + C C EG IV C + + +P LP +L L+DN I VL+ + K NL+KI L++N + ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC ++WL +LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L T+P M + L N L + L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP ++ + + F C+ V NA ++ C N
Sbjct: 276 NSLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------EGNEENSCQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQLTL--IDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 4 Score: 322.013 bits (824), Expect = 1.63677e-87
Identity = 221/673 (32.84%), Postives = 331/673 (49.18%), Query Frame = -3
Query: 2680 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 4659
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F + LK + +S N+I+ I F L LT L L N I +P GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D +N + C +C + C C EG IV C + + +P LP +L L+DN I VL+ + K NL+KI L++N + ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC ++WL +LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L T+P M + L N L + L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP ++ + + F C+ V NA ++ C N
Sbjct: 276 NSLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRNRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLSRIPSHLPEYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTLVSLSTINLLSNPFNCNCHMAWLGRWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------EGNEENSCQLSPRCPEQCTCVETVVRCSNRGLHTLPKGMPKDVTELYLEGNHLTAVPKELSTFRQLTL--IDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGINPLHCDCSLRWLSEWIKAGYKEPG---IARCSSPESMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 5 Score: 185.652 bits (470), Expect = 2.53791e-45
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = 3
Query: 6183 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXXI------------------------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 7421
P +CP CTC+ VDC+G L +P + + T++ + + LK + ++I ++DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G +V+ + +K ++C G SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTIGQFT--LCMAPVHLRGFSVADVQKKEYVC--------------PGPHSEAPACNAN------SLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 185.652 bits (470), Expect = 2.53791e-45
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = -3
Query: 2056 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXLI------------------------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 3294
P +CP CTC+ VDC+G L +P + + T++ + + LK + ++I ++DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G +V+ + +K ++C G SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAAACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTIGQFT--LCMAPVHLRGFSVADVQKKEYVC--------------PGPHSEAPACNAN------SLSCPSACSCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. uniprot
Match: gi|311033528|sp|O75094|SLIT3_HUMAN (RecName: Full=Slit homolog 3 protein; Short=Slit-3; AltName: Full=Multiple epidermal growth factor-like domains protein 5; Short=Multiple EGF-like domains protein 5; Flags: Precursor)

HSP 1 Score: 754.977 bits (1948), Expect = 0
Identity = 497/1587 (31.32%), Postives = 770/1587 (48.52%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPG-----------CRDVAQES--------FNKLVTDVAKTDLQTXXXXXXXXXXXXXEPEICK-----NGGVCQAVNDGK---KKFK---------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCL 9284
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ ++KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS NK+KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC L W+ +W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +P+G+P + TELYL+ N+L + L +L + LS N I+ L + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCK+NG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C +C ++N C + C L + + C C G+ GK C+ + DDC ++CR+ AQCVD +NGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PG CR V ++S + + D D +CK G +C ND FK C+C+ GFSG+ C ++ C ++++ I+ +C + V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 2 Score: 754.977 bits (1948), Expect = 0
Identity = 497/1587 (31.32%), Postives = 770/1587 (48.52%), Query Frame = -3
Query:  193 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPG-----------CRDVAQES--------FNKLVTDVAKTDLQTXXXXXXXXXXXXSEPEICK-----NGGVCQAVNDGK---KKFK---------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCL 4650
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ ++KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS NK+KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC L W+ +W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +P+G+P + TELYL+ N+L + L +L + LS N I+ L + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCK+NG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C +C ++N C + C L + + C C G+ GK C+ + DDC ++CR+ AQCVD +NGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PG CR V ++S + + D D +CK G +C ND FK C+C+ GFSG+ C ++ C ++++ I+ +C + V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 3 Score: 318.931 bits (816), Expect = 1.51017e-86
Identity = 219/673 (32.54%), Postives = 334/673 (49.63%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 6797
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I + GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D ++ + C +C + C C EG IV C + + +P LP + +L L+DN ++VL+ + K NL+KI L++N++ ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC L+WL ++LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP + + + F C+ V NA ++ C N
Sbjct: 276 NSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTL--IDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 4 Score: 318.931 bits (816), Expect = 1.51017e-86
Identity = 219/673 (32.54%), Postives = 334/673 (49.63%), Query Frame = -3
Query: 2680 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 4659
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I + GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D ++ + C +C + C C EG IV C + + +P LP + +L L+DN ++VL+ + K NL+KI L++N++ ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC L+WL ++LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP + + + F C+ V NA ++ C N
Sbjct: 276 NSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTL--IDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 5 Score: 181.415 bits (459), Expect = 4.65393e-44
Identity = 127/484 (26.24%), Postives = 211/484 (43.60%), Query Frame = 3
Query: 6183 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXXIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 7421
P ++CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G V+ + +K ++C SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTVGQFT--LCMAPVHLRGFNVADVQKKEYVC--------------PAPHSEPPSCNAN------SISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 181.415 bits (459), Expect = 4.65393e-44
Identity = 127/484 (26.24%), Postives = 211/484 (43.60%), Query Frame = -3
Query: 2056 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXLIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 3294
P ++CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G V+ + +K ++C SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTVGQFT--LCMAPVHLRGFNVADVQKKEYVC--------------PAPHSEPPSCNAN------SISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. uniprot
Match: gi|45477219|sp|O88279|SLIT1_RAT (RecName: Full=Slit homolog 1 protein; Short=Slit-1; AltName: Full=Multiple epidermal growth factor-like domains protein 4; Short=Multiple EGF-like domains protein 4; Flags: Precursor)

HSP 1 Score: 744.191 bits (1920), Expect = 0
Identity = 496/1584 (31.31%), Postives = 765/1584 (48.30%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXX-----XXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLN------------------------RNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQL--NESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRY-LALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP-------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYMCRR----KMIKNHIKDPDTT---CLSLKTVRYRYCEGSCQDSKMQSDIQKSFFH-----------RPVDTGSSR-------CCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLP 9287
CP C C +++C L+ +P+++P T +L L GN I I K+DF+ + L++LQL N+I ++E G FD + +L +LRLNRN +Q LP+ LF + L +LDL +N LQ V G +LKNL LD+N+I I E R + L T + +N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + + C C C CS GIV C G+G+ +P +LP ++ E+ L N I + A S Y+ L++I L++N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L ++ L+L NP C+C L WLA+FLR E +G A C P+ L + + ++S +F C E+ + +C ++CP C C VV+C+G L+ IP+ + ST + L+ N++ + + L +L KI+LS N++ IE F + + E++L +N+L+ + + FR L L TL L +N I CI SF +N++ L+L NP +CNCQL W+ +W R G CQ+P L+ + + F C E + E C + +P+ CP +C C T V CS L +PKGIP N TELYLD N + S+FK+L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L NDV+T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P M+ K + + F C A + AKCD C+ SPC++ G C Y+C CP + G+NCE +++C +PC NGG C + + C CP GF G C N DDCV + C NGG CVD + Y C C Y G+ C +C+ D+NPC + C P RC C G+ G NC +N DDCK ++C+N AQCVD +N Y C C GY G+ C+ PPA + S C +C N CV + CQC G+ G +C+ L S+ F +++Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + G Y L + +++GG P + A + + + T F GC+++L IN + DF K + V PGC + + T C +P C +G + V + C C+DG+SG CN+ + + + H + T C+ CE Q+S+ + D + F RP+ R CCQ + + R++ F+C G + V +C C P
Sbjct: 30 GATACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAAQVPACTLSSGSCPAMCSCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETTG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSGLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGATSVSELHLTANQLESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEG--------------QEEVGC--LPRPQ------CPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQ---LVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA-VQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRNCEVSLDSCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGLTCGMNTDDCVKHDCVNGGVCVDGIGNYTCQCPLQYTGRACEQLVDFCSPDLNPCQHEAQCVGTPEGP-RCECVPGYTGDNCSKNQDDCKDHQCQNGAQCVDEINSYACLCAEGYSGQLCE----IPPAPRNS---------------------------CEGTECQNGANCVDQGSRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMD---NFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHGHKCVHG---KCVPLDALAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQASATRGAHCVCSPGFSGELCE---QESECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGACPGQGCCQGLRLKRRKLTFECSDGTSFAEEVEKPTKCGCAP 1529

HSP 2 Score: 744.191 bits (1920), Expect = 0
Identity = 496/1584 (31.31%), Postives = 765/1584 (48.30%), Query Frame = -3
Query:  190 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXX-----XDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLN------------------------RNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQL--NESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRY-LALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP-------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYMCRR----KMIKNHIKDPDTT---CLSLKTVRYRYCEGSCQDSKMQSDIQKSFFH-----------RPVDTGSSR-------CCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLP 4659
CP C C +++C L+ +P+++P T +L L GN I I K+DF+ + L++LQL N+I ++E G FD + +L +LRLNRN +Q LP+ LF + L +LDL +N LQ V G +LKNL LD+N+I I E R + L T + +N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + + C C C CS GIV C G+G+ +P +LP ++ E+ L N I + A S Y+ L++I L++N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L ++ L+L NP C+C L WLA+FLR E +G A C P+ L + + ++S +F C E+ + +C ++CP C C VV+C+G L+ IP+ + ST + L+ N++ + + L +L KI+LS N++ IE F + + E++L +N+L+ + + FR L L TL L +N I CI SF +N++ L+L NP +CNCQL W+ +W R G CQ+P L+ + + F C E + E C + +P+ CP +C C T V CS L +PKGIP N TELYLD N + S+FK+L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L NDV+T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P M+ K + + F C A + AKCD C+ SPC++ G C Y+C CP + G+NCE +++C +PC NGG C + + C CP GF G C N DDCV + C NGG CVD + Y C C Y G+ C +C+ D+NPC + C P RC C G+ G NC +N DDCK ++C+N AQCVD +N Y C C GY G+ C+ PPA + S C +C N CV + CQC G+ G +C+ L S+ F +++Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + G Y L + +++GG P + A + + + T F GC+++L IN + DF K + V PGC + + T C +P C +G + V + C C+DG+SG CN+ + + + H + T C+ CE Q+S+ + D + F RP+ R CCQ + + R++ F+C G + V +C C P
Sbjct: 30 GATACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAAQVPACTLSSGSCPAMCSCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETTG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSGLKLSKIPERIPQSTTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGATSVSELHLTANQLESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEG--------------QEEVGC--LPRPQ------CPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQ---LVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA-VQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRNCEVSLDSCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGLTCGMNTDDCVKHDCVNGGVCVDGIGNYTCQCPLQYTGRACEQLVDFCSPDLNPCQHEAQCVGTPEGP-RCECVPGYTGDNCSKNQDDCKDHQCQNGAQCVDEINSYACLCAEGYSGQLCE----IPPAPRNS---------------------------CEGTECQNGANCVDQGSRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMD---NFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHGHKCVHG---KCVPLDALAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQASATRGAHCVCSPGFSGELCE---QESECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGACPGQGCCQGLRLKRRKLTFECSDGTSFAEEVEKPTKCGCAP 1529
BLAST of slit vs. Smed Unigenes AA
Match: SMU15036778 (dd_smedV4_12111_0_1|m.4973|m.1592)

HSP 1 Score: 1931.76 bits (5003), Expect = 0
Identity = 947/1519 (62.34%), Postives = 1178/1519 (77.55%), Query Frame = 3
Query: 4788 SNTWYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSAD----QKSFCQCKSGYSGQQCQHLDSLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXX-----------EPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDT--TCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
S W +D + + CPNGCQC++YS+ECKHRL NVP L EKT +LNLLGNRINVIRKSDF K+ NLK+LQLSNNRITSIE G FD L L KLRLNRNLIQYLPD LFSKL LQKLDLRDNQLQC+N+N+ L LK L L+ NKIFWI+E IS+LK+L+ L I NKLNCNCHLAWLN F+K + +IKP SVLC+TPFRLS IPISSLSSYEFQCAS+ K +LEN+C KK+CSK C CS +GIVKCVG+ + +PQDLPT+++ELDL DN I +L+Q LSKYK LKKI+L N M DIEPGAF GL QLTS+YLN N LK+IRKNA GL SLMFLY+ NDIECLP+DT +L+LLHLSENKLT+LKKET P LRYLYLVHNPLNC+C++SW+ ++++ KE + +PVA+CL P+NL G P+R +Q Y F C ++ E++ E+HDE+C+PK+SCP CTC+ +VV+C+ + L ++P+++ PSTK +I+S+N LK++ + PNL+K+DLS+N+I+ +E D+F ++S+L+EINLNSN+LKCINN+TF+NL +LE L+LS+N I CIV SF+ N N+K+L LN+N HC+C+LKW+SEW+R HY LG H CQSP L+ T ++ LD+KYFLC N + + C + S +CCSI EC +K+CP+KCKCE TKVDCS +QL +IP IP +TTELYLDRN+L LNE+SFK+L NLKTLVLSYNGITELNKNVLTPL+SLETLV+SFNKLQCI ++AFK L NLKVLILQSNDV+TIP+ AF DL+NLNNIALGQNPFHCDCNIKWLNQFF++RFLDNGISLCASPE MKLKSIYHSKPTDF C+EET+DAYITAKCD+C++ PCKHNGKCSLITHH Y+C CP+PFHGKNC+KRINACFG PC+NGGICKN+DNYGNYECVCPVGFRGPKC N+DDCV N C NG TC D N Y C C++G+RG+YC +KF YC D+NPC N+G C LPNNDY+CVCS GW GK C+ N DDCKYN C++ +QCVDL N Y+C CRPGY GKFC+ AWKP +K +SRR+I + S +N NEVISESVCAYH+CLN G+C++ D QKS+C+CK GYSG CQ+L+S+YF K SYIEISPPSRGFLMPRGNI+L F TNSSSGL+LYQG ++ YL VNLY+GH+RI YN+GDKV+GPEGYSM +NDSR H+L IEI+GENLTMYL+GR HCTLKS Y + NRY+AL +GIFIGGAP IL++A+ K+H+E+++ FIGC++SL IN+KKIDF K++ +S+NV PGC KL++ V +DL+ S + P ICKN GVC+ + KKKF+CICK+GF G+ C ++ MC ++HI DPD+ TC S++ +YR C G+C S+MQSD+ K+F+H+P+D SSRCCQP K+ T I FKC++GR Y R + + CKC+ NC
Sbjct: 25 STIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKE-TNTPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSC-HETNSVKTCCSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQ--SEMTYENLENEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGC--------GKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANC 1531

HSP 2 Score: 1931.76 bits (5003), Expect = 0
Identity = 947/1519 (62.34%), Postives = 1178/1519 (77.55%), Query Frame = -3
Query:  184 SNTWYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSAD----QKSFCQCKSGYSGQQCQHLDSLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXS-----------EPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDT--TCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4689
S W +D + + CPNGCQC++YS+ECKHRL NVP L EKT +LNLLGNRINVIRKSDF K+ NLK+LQLSNNRITSIE G FD L L KLRLNRNLIQYLPD LFSKL LQKLDLRDNQLQC+N+N+ L LK L L+ NKIFWI+E IS+LK+L+ L I NKLNCNCHLAWLN F+K + +IKP SVLC+TPFRLS IPISSLSSYEFQCAS+ K +LEN+C KK+CSK C CS +GIVKCVG+ + +PQDLPT+++ELDL DN I +L+Q LSKYK LKKI+L N M DIEPGAF GL QLTS+YLN N LK+IRKNA GL SLMFLY+ NDIECLP+DT +L+LLHLSENKLT+LKKET P LRYLYLVHNPLNC+C++SW+ ++++ KE + +PVA+CL P+NL G P+R +Q Y F C ++ E++ E+HDE+C+PK+SCP CTC+ +VV+C+ + L ++P+++ PSTK +I+S+N LK++ + PNL+K+DLS+N+I+ +E D+F ++S+L+EINLNSN+LKCINN+TF+NL +LE L+LS+N I CIV SF+ N N+K+L LN+N HC+C+LKW+SEW+R HY LG H CQSP L+ T ++ LD+KYFLC N + + C + S +CCSI EC +K+CP+KCKCE TKVDCS +QL +IP IP +TTELYLDRN+L LNE+SFK+L NLKTLVLSYNGITELNKNVLTPL+SLETLV+SFNKLQCI ++AFK L NLKVLILQSNDV+TIP+ AF DL+NLNNIALGQNPFHCDCNIKWLNQFF++RFLDNGISLCASPE MKLKSIYHSKPTDF C+EET+DAYITAKCD+C++ PCKHNGKCSLITHH Y+C CP+PFHGKNC+KRINACFG PC+NGGICKN+DNYGNYECVCPVGFRGPKC N+DDCV N C NG TC D N Y C C++G+RG+YC +KF YC D+NPC N+G C LPNNDY+CVCS GW GK C+ N DDCKYN C++ +QCVDL N Y+C CRPGY GKFC+ AWKP +K +SRR+I + S +N NEVISESVCAYH+CLN G+C++ D QKS+C+CK GYSG CQ+L+S+YF K SYIEISPPSRGFLMPRGNI+L F TNSSSGL+LYQG ++ YL VNLY+GH+RI YN+GDKV+GPEGYSM +NDSR H+L IEI+GENLTMYL+GR HCTLKS Y + NRY+AL +GIFIGGAP IL++A+ K+H+E+++ FIGC++SL IN+KKIDF K++ +S+NV PGC KL++ V +DL+ S + P ICKN GVC+ + KKKF+CICK+GF G+ C ++ MC ++HI DPD+ TC S++ +YR C G+C S+MQSD+ K+F+H+P+D SSRCCQP K+ T I FKC++GR Y R + + CKC+ NC
Sbjct: 25 STIWINDPSDESEICPNGCQCENYSVECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCNCHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASEDKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKE-TNTPVAACLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCSSDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKLDLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQLSENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLGNHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSC-HETNSVKTCCSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDRNHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNKLQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFHCDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETEDAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDINQ--SEMTYENLENEVISESVCAYHECLNNGICINGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPRGNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEGYSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDTGIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKSINVHPGC--------GKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGICKNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDSQGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKYSTHEIQFKCENGRVYRRAANLPKNCKCVANC 1531
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006317 (SmedAsxldir_c107934_g5_i1|m.86273|m.14433)

HSP 1 Score: 141.739 bits (356), Expect = 4.71281e-33
Identity = 96/268 (35.82%), Postives = 133/268 (49.63%), Query Frame = 3
Query: 7452 CIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD---EAAWKPPAMKMSMSRREIQRFSSAGK---SDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
C PCK+ G C Y+C C + + GKNC+ N C +PCKN G C++V NY +Y+C+C GF G C +ID+C C NGG+C++ + G C+C G+ G C + C + PC N C L NNDY C C G GKNC+ NID+C N C N A+C D V G+ C+C G+ G C+ + + K + S K D N S C C+N G CV + + C C G+ G+ C+
Sbjct: 256 CELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESV-NYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECEN-KPCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCE 518

HSP 2 Score: 141.739 bits (356), Expect = 4.71281e-33
Identity = 96/268 (35.82%), Postives = 133/268 (49.63%), Query Frame = -3
Query: 1240 CIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD---EAAWKPPAMKMSMSRREIQRFSSAGK---SDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 2025
C PCK+ G C Y+C C + + GKNC+ N C +PCKN G C++V NY +Y+C+C GF G C +ID+C C NGG+C++ + G C+C G+ G C + C + PC N C L NNDY C C G GKNC+ NID+C N C N A+C D V G+ C+C G+ G C+ + + K + S K D N S C C+N G CV + + C C G+ G+ C+
Sbjct: 256 CELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESV-NYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECEN-KPCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCE 518

HSP 3 Score: 139.813 bits (351), Expect = 1.85431e-32
Identity = 94/309 (30.42%), Postives = 139/309 (44.98%), Query Frame = 3
Query: 7452 CIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCE---------------------------------------KRINACFGHP---CKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDL-VNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNE----VISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
C SPC++ G C + H+Y+CQCP + G NCE I+ C + C+NGG C ++ G+Y+C C GF G +C +I DC N+ C+NGGTC+D++ Y C C Y G C K T C ++ PC N G C + DY+C+C W GKNCD+ + CK N C+NN C + Y+C C+ G++GK+C+ + + I + PG E I+ + C C N C+ + C C G +G+ C+
Sbjct: 99 CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLC-ELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCE 403

HSP 4 Score: 139.813 bits (351), Expect = 1.85431e-32
Identity = 94/309 (30.42%), Postives = 139/309 (44.98%), Query Frame = -3
Query: 1240 CIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCE---------------------------------------KRINACFGHP---CKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDL-VNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNE----VISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 2025
C SPC++ G C + H+Y+CQCP + G NCE I+ C + C+NGG C ++ G+Y+C C GF G +C +I DC N+ C+NGGTC+D++ Y C C Y G C K T C ++ PC N G C + DY+C+C W GKNCD+ + CK N C+NN C + Y+C C+ G++GK+C+ + + I + PG E I+ + C C N C+ + C C G +G+ C+
Sbjct: 99 CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLC-ELKPCKNGGICRDF-DEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCE 403

HSP 5 Score: 134.806 bits (338), Expect = 5.863e-31
Identity = 90/304 (29.61%), Postives = 131/304 (43.09%), Query Frame = 3
Query: 7458 RSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHP---CKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-------------------------------------DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD----EAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
++PC NGKC L + KC C + G C I+ C + C+NGG C ++ G+Y+C C GF G +C +I DC N+ C+NGGTC+D++ Y C C Y G C K T C +NPC N G C + DY+C+C G+ GK C+ +ID+C+ C N C++++ G +C C PG++G C+ E KP + N I+ C + CLN C CQC G+ G +C+
Sbjct: 140 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE 441

HSP 6 Score: 134.806 bits (338), Expect = 5.863e-31
Identity = 90/304 (29.61%), Postives = 131/304 (43.09%), Query Frame = -3
Query: 1240 RSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHP---CKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-------------------------------------DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD----EAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 2019
++PC NGKC L + KC C + G C I+ C + C+NGG C ++ G+Y+C C GF G +C +I DC N+ C+NGGTC+D++ Y C C Y G C K T C +NPC N G C + DY+C+C G+ GK C+ +ID+C+ C N C++++ G +C C PG++G C+ E KP + N I+ C + CLN C CQC G+ G +C+
Sbjct: 140 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKWCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE 441

HSP 7 Score: 119.783 bits (299), Expect = 2.61055e-26
Identity = 94/312 (30.13%), Postives = 134/312 (42.95%), Query Frame = 3
Query: 7446 DACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPC---------NNT-----------------------------GSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD----EAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISE-SVCAYHQCLNEGVCVSADQKS--FCQCKSG---YSGQQCQ 8237
D C + C + G C + KC C F G NCE +N C PC+N C +++N +Y C CP G G C NID+C N C NG C DRV G+ C C G+ G C K C + PC NNT G C + NN+ +C+C G+ G+ C+ I++C N C++ +QC DL N Y C C PG+KGK C+ E A P + E+ F G ++ C + C N+ +C+ ++ C C + Y G +C+
Sbjct: 331 DNCQKISCFNGGSCINMIEGG-KCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDV-NNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLN-GQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCE 637

HSP 8 Score: 119.783 bits (299), Expect = 2.61055e-26
Identity = 94/312 (30.13%), Postives = 134/312 (42.95%), Query Frame = -3
Query: 1240 DACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPC---------NNT-----------------------------GSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD----EAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISE-SVCAYHQCLNEGVCVSADQKS--FCQCKSG---YSGQQCQ 2031
D C + C + G C + KC C F G NCE +N C PC+N C +++N +Y C CP G G C NID+C N C NG C DRV G+ C C G+ G C K C + PC NNT G C + NN+ +C+C G+ G+ C+ I++C N C++ +QC DL N Y C C PG+KGK C+ E A P + E+ F G ++ C + C N+ +C+ ++ C C + Y G +C+
Sbjct: 331 DNCQKISCFNGGSCINMIEGG-KCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDV-NNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLN-GQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCE 637

HSP 9 Score: 115.161 bits (287), Expect = 6.6826e-25
Identity = 85/268 (31.72%), Postives = 123/268 (45.90%), Query Frame = 3
Query: 7509 YKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYC-HLKFTYCTDVNPCNNTGSCHQLPNND----YRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD---EAAWKPPAMKMSMSRREIQR----------------FSSAGKSDNPGNEV-ISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
++C+C F G+ CE IN C +PC N C +D+ +Y+C+C GF G C N +DC + C G CVD+VNG+ C C Y G C HLK D NPC N GSC N Y C C G+ G C+ +D C+ N C + C ++ ++CKC Y G+ C+ K A++ + I + F + +S G+ ++ CA C+N G C FC+C+ G+ G CQ
Sbjct: 719 FRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRP--CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQ 982

HSP 10 Score: 115.161 bits (287), Expect = 6.6826e-25
Identity = 85/268 (31.72%), Postives = 123/268 (45.90%), Query Frame = -3
Query: 1240 YKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYC-HLKFTYCTDVNPCNNTGSCHQLPNND----YRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD---EAAWKPPAMKMSMSRREIQR----------------FSSAGKSDNPGNEV-ISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 1968
++C+C F G+ CE IN C +PC N C +D+ +Y+C+C GF G C N +DC + C G CVD+VNG+ C C Y G C HLK D NPC N GSC N Y C C G+ G C+ +D C+ N C + C ++ ++CKC Y G+ C+ K A++ + I + F + +S G+ ++ CA C+N G C FC+C+ G+ G CQ
Sbjct: 719 FRCRCVAGFTGERCEIEINECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRP--CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCKTDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQ 982

HSP 11 Score: 106.686 bits (265), Expect = 1.95384e-22
Identity = 81/284 (28.52%), Postives = 129/284 (45.42%), Query Frame = 3
Query: 7476 NGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNN---DYRCVCSLG---WLGKNCDENIDDCKYNE--------------------CRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKM---SMSRREIQRFSSAGKSDNPGNEV-ISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
NG+C + + + KC C F G+ CE IN CF +PC++G C+++ + +Y C+C GF+G KC NI++C +N C G C+D V G+ C C Y G C K C + N C N C +P N Y C CS + G C++++D+C + C N+ QC++ + CKC Y+G+ C++ + F + G I + C ++ C N+ C+ C C+SG+SG+ C+
Sbjct: 494 NGQCVDVNNEE-KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC-NPNACYNDAIC--IPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE 771

HSP 12 Score: 106.686 bits (265), Expect = 1.95384e-22
Identity = 81/284 (28.52%), Postives = 129/284 (45.42%), Query Frame = -3
Query: 1240 NGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNN---DYRCVCSLG---WLGKNCDENIDDCKYNE--------------------CRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKM---SMSRREIQRFSSAGKSDNPGNEV-ISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 2001
NG+C + + + KC C F G+ CE IN CF +PC++G C+++ + +Y C+C GF+G KC NI++C +N C G C+D V G+ C C Y G C K C + N C N C +P N Y C CS + G C++++D+C + C N+ QC++ + CKC Y+G+ C++ + F + G I + C ++ C N+ C+ C C+SG+SG+ C+
Sbjct: 494 NGQCVDVNNEE-KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC-NPNACYNDAIC--IPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE 771

HSP 13 Score: 105.531 bits (262), Expect = 4.52529e-22
Identity = 94/336 (27.98%), Postives = 143/336 (42.56%), Query Frame = 3
Query: 7446 DACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVG---FRGPKCNENIDD-------------------------CVN-NKCEN--------------------------------GGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAW----KPPAMKMSMSRREIQRFSSAGKSD------NPGNEVISESVCAYHQCLNEGVCVSADQKSF-CQCKSGYSGQQCQ 8237
+ C +PC NG+C + + ++CQC P+ G C +++ C + C N IC + Y +Y C C + G KC +++D+ C+N N+C N G TC + +G+ C C G+ G+ C ++ C NPC+N C N DY+C+C G+ GKNC+ N +DC + C + QCVD VNG+ECKC Y G C+ P K S R++ + + + P E I C + C + GVC D SF C+C S Y G++C+
Sbjct: 560 NECAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQH-NPCSNDAKCIDHIN-DYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE-IKMDWCRGNPCGDFGVC-KTDLDSFKCKCNSEYIGERCE 890

HSP 14 Score: 105.531 bits (262), Expect = 4.52529e-22
Identity = 94/336 (27.98%), Postives = 143/336 (42.56%), Query Frame = -3
Query: 1240 DACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVG---FRGPKCNENIDD-------------------------CVN-NKCEN--------------------------------GGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAW----KPPAMKMSMSRREIQRFSSAGKSD------NPGNEVISESVCAYHQCLNEGVCVSADQKSF-CQCKSGYSGQQCQ 2031
+ C +PC NG+C + + ++CQC P+ G C +++ C + C N IC + Y +Y C C + G KC +++D+ C+N N+C N G TC + +G+ C C G+ G+ C ++ C NPC+N C N DY+C+C G+ GKNC+ N +DC + C + QCVD VNG+ECKC Y G C+ P K S R++ + + + P E I C + C + GVC D SF C+C S Y G++C+
Sbjct: 560 NECAHNPCGLNGQC-IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNNPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQH-NPCSNDAKCIDHIN-DYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCE-IKMDWCRGNPCGDFGVC-KTDLDSFKCKCNSEYIGERCE 890

HSP 15 Score: 104.76 bits (260), Expect = 9.63658e-22
Identity = 82/284 (28.87%), Postives = 119/284 (41.90%), Query Frame = 3
Query: 7479 GKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN--------------KCENGGT--CVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVN-----PCNNTGSCHQLPNND------YRCVCSLGWLGKNCDENIDDCKYNECRNNAQC----VDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
GKC + + + C CP G+ CE ++ C C+NGGICKNV G++EC CP GF G C +I++C N C GT C+DR + C C+ + G+YC + YC PC N G C N+ + C+C G+ G+ C N C+ N C+NN C +D ++C+C G G FC E+ + C +C N G CV+ K+ C C G G++C+
Sbjct: 996 GKC-IDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFC---------------------------------EIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 1243

HSP 16 Score: 104.76 bits (260), Expect = 9.63658e-22
Identity = 82/284 (28.87%), Postives = 119/284 (41.90%), Query Frame = -3
Query: 1240 GKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN--------------KCENGGT--CVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVN-----PCNNTGSCHQLPNND------YRCVCSLGWLGKNCDENIDDCKYNECRNNAQC----VDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 1998
GKC + + + C CP G+ CE ++ C C+NGGICKNV G++EC CP GF G C +I++C N C GT C+DR + C C+ + G+YC + YC PC N G C N+ + C+C G+ G+ C N C+ N C+NN C +D ++C+C G G FC E+ + C +C N G CV+ K+ C C G G++C+
Sbjct: 996 GKC-IDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFC---------------------------------EIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 1243

HSP 17 Score: 103.99 bits (258), Expect = 1.50397e-21
Identity = 79/279 (28.32%), Postives = 126/279 (45.16%), Query Frame = 3
Query: 7431 ITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVD-RVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNE---CRNNAQCVDLVNGYECKCRPGYKGKFCDE---AAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISE-SVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHL 8243
I + C CK+ C + +Y C+C + + G CE++ N C PC+NGG CK + GNY C C + G C E +C ++ C NGG C ++ Y C C Y G C L + C NPC G C + + +C C+ G+ G C +ID+C E C N C++ V Y+CKC+ G+ G+ C+ +I + ++ G ++ ++C C N G+C D+ C C + ++G+ C +
Sbjct: 17 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI--AGNYVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNS-CGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDV 290

HSP 18 Score: 103.99 bits (258), Expect = 1.50397e-21
Identity = 79/279 (28.32%), Postives = 126/279 (45.16%), Query Frame = -3
Query: 1234 ITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVD-RVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNE---CRNNAQCVDLVNGYECKCRPGYKGKFCDE---AAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISE-SVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHL 2046
I + C CK+ C + +Y C+C + + G CE++ N C PC+NGG CK + GNY C C + G C E +C ++ C NGG C ++ Y C C Y G C L + C NPC G C + + +C C+ G+ G C +ID+C E C N C++ V Y+CKC+ G+ G+ C+ +I + ++ G ++ ++C C N G+C D+ C C + ++G+ C +
Sbjct: 17 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI--AGNYVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNS-CGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDV 290

HSP 19 Score: 103.219 bits (256), Expect = 2.55286e-21
Identity = 72/208 (34.62%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 7440 KCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCE-KRINACFGHP-------------CKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD 8021
K D C +PC G C +KC+C + G+ CE K+ C + CK+ G C N G ++C C G+ G C NIDDC + C NGG C D Y C C+ G++G C + C N C NTG C NN + CVC G G+ C+ +D CK EC+N C +++ +EC C G+ GK C+
Sbjct: 854 KMDWCRGNPCGDFGVCK-TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYS-NSC-NTGKCIDQINN-FSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 1057

HSP 20 Score: 103.219 bits (256), Expect = 2.55286e-21
Identity = 72/208 (34.62%), Postives = 99/208 (47.60%), Query Frame = -3
Query: 1456 KCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCE-KRINACFGHP-------------CKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCD 2037
K D C +PC G C +KC+C + G+ CE K+ C + CK+ G C N G ++C C G+ G C NIDDC + C NGG C D Y C C+ G++G C + C N C NTG C NN + CVC G G+ C+ +D CK EC+N C +++ +EC C G+ GK C+
Sbjct: 854 KMDWCRGNPCGDFGVCK-TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYS-NSC-NTGKCIDQINN-FSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 1057

HSP 21 Score: 83.1889 bits (204), Expect = 2.7941e-15
Identity = 72/239 (30.13%), Postives = 107/239 (44.77%), Query Frame = 3
Query: 7560 INACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNG-YECKCRPGYKGKFC----DE-AAWKPPAMKMSMS-RREIQRFSSAGKSDNPGNEVISESV-CAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSL 8252
+N C H CKNG C++ D G Y C C G++G C E +C C+NGGTC Y C C + G++C +F+ +PC N G C L + Y C C +LG NC+ N C N +C+ +G +C C GY G C DE A+++ P + + + + K+ G ++ V C C N G C+ C C + Y G C++ +L
Sbjct: 21 LNFCENHKCKNGATCQS-DINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFC--EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTL 255

HSP 22 Score: 83.1889 bits (204), Expect = 2.7941e-15
Identity = 72/239 (30.13%), Postives = 107/239 (44.77%), Query Frame = -3
Query: 1225 INACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNG-YECKCRPGYKGKFC----DE-AAWKPPAMKMSMS-RREIQRFSSAGKSDNPGNEVISESV-CAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSL 1917
+N C H CKNG C++ D G Y C C G++G C E +C C+NGGTC Y C C + G++C +F+ +PC N G C L + Y C C +LG NC+ N C N +C+ +G +C C GY G C DE A+++ P + + + + K+ G ++ V C C N G C+ C C + Y G C++ +L
Sbjct: 21 LNFCENHKCKNGATCQS-DINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFC--EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTL 255

HSP 23 Score: 62.7734 bits (151), Expect = 4.22625e-09
Identity = 61/206 (29.61%), Postives = 83/206 (40.29%), Query Frame = 3
Query: 7509 YKCQCPHPFHGKNCEKRINACFGH------PCKNGGICKN-----VDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTC----VDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCD------------------ENIDDCKYNECRNNAQ---CVDLVNGYECKCRPGYKGKFC 8018
+ C C F GK CE RI+ C PC N GIC N V N+ C+CP G+ G +C N C N C+N G C +D + C+C +G G +C + + C N GSC C C+ G G+ C+ + I DC+ N+C + A C N Y C G+ G C
Sbjct: 1097 FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI-CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGEC 1297

HSP 24 Score: 62.7734 bits (151), Expect = 4.22625e-09
Identity = 61/206 (29.61%), Postives = 83/206 (40.29%), Query Frame = -3
Query: 1459 YKCQCPHPFHGKNCEKRINACFGH------PCKNGGICKN-----VDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTC----VDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCD------------------ENIDDCKYNECRNNAQ---CVDLVNGYECKCRPGYKGKFC 1968
+ C C F GK CE RI+ C PC N GIC N V N+ C+CP G+ G +C N C N C+N G C +D + C+C +G G +C + + C N GSC C C+ G G+ C+ + I DC+ N+C + A C N Y C G+ G C
Sbjct: 1097 FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPSGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI-CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGEC 1297
BLAST of slit vs. Smed Unigenes AA
Match: SMU15006140 (SmedAsxldir_c107649_g2_i1|m.84323|m.17798)

HSP 1 Score: 133.65 bits (335), Expect = 1.02446e-30
Identity = 106/346 (30.64%), Postives = 157/346 (45.38%), Query Frame = 3
Query: 7257 QNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIR-----SPCKHNGKC-SLITHHQ-YKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNG-YGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQL-------PNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDE--AAWKPPAMKMSMSRREIQRFSSAGKSDNPG-NEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQH 8240
+NP C C W F E MK H D ++ + CD + +PCK+ G C +L++ Q YKC CP F G++CE I+ CF +PCK G K+ G + C C + G C+++ C N C+NGG C NG C C+ GY+G CHL PC N+ H L DY+C+C G+ GK CD+ I++C N C+NN C D +N Y+C C +KGK C+ A P + + ++ K+ G N I ++ C+ + CLN C + +Q +C C + G++C+H
Sbjct: 259 ENPGECRCRAGWQGTF--------------CDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSK---GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEH 578

HSP 2 Score: 133.65 bits (335), Expect = 1.02446e-30
Identity = 106/346 (30.64%), Postives = 157/346 (45.38%), Query Frame = -3
Query: 1237 QNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIR-----SPCKHNGKC-SLITHHQ-YKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNG-YGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQL-------PNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDE--AAWKPPAMKMSMSRREIQRFSSAGKSDNPG-NEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQH 2220
+NP C C W F E MK H D ++ + CD + +PCK+ G C +L++ Q YKC CP F G++CE I+ CF +PCK G K+ G + C C + G C+++ C N C+NGG C NG C C+ GY+G CHL PC N+ H L DY+C+C G+ GK CD+ I++C N C+NN C D +N Y+C C +KGK C+ A P + + ++ K+ G N I ++ C+ + CLN C + +Q +C C + G++C+H
Sbjct: 259 ENPGECRCRAGWQGTF--------------CDECMKYPGCKHGTCVDSPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSK---GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEH 578

HSP 3 Score: 126.716 bits (317), Expect = 1.34946e-28
Identity = 101/317 (31.86%), Postives = 148/317 (46.69%), Query Frame = 3
Query: 7368 KSIYHSKPTDFTCNEETDDAYITAKCDACI------RSPCKHN-----GKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCV----DRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPN-NDYRCVCSLGWLGKNCDE---NIDDCKY-NECRNNAQCVDL-VNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSS----AGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHL 8243
K HS+P + NE + AY DAC S KHN G C ++ C+C F G +CE I+ C +PCKNGGIC +D+ N+EC+C GF G C E D C+ + C N G C+ + N + C+C+ + G+ CHL D NPC N GSC +L N ++C C+ GW+G C + C+ N C+N C+++ N + C C+PG++GK CD + + I + +S K N ++ CA C +CV C+C G G+ C H+
Sbjct: 574 KRCEHSRP--YCGNESCESAY-----DACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC--IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHV 881

HSP 4 Score: 126.716 bits (317), Expect = 1.34946e-28
Identity = 101/317 (31.86%), Postives = 148/317 (46.69%), Query Frame = -3
Query: 1234 KSIYHSKPTDFTCNEETDDAYITAKCDACI------RSPCKHN-----GKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCV----DRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPN-NDYRCVCSLGWLGKNCDE---NIDDCKY-NECRNNAQCVDL-VNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSS----AGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHL 2109
K HS+P + NE + AY DAC S KHN G C ++ C+C F G +CE I+ C +PCKNGGIC +D+ N+EC+C GF G C E D C+ + C N G C+ + N + C+C+ + G+ CHL D NPC N GSC +L N ++C C+ GW+G C + C+ N C+N C+++ N + C C+PG++GK CD + + I + +S K N ++ CA C +CV C+C G G+ C H+
Sbjct: 574 KRCEHSRP--YCGNESCESAY-----DACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC--IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHV 881

HSP 5 Score: 108.227 bits (269), Expect = 5.10998e-23
Identity = 95/368 (25.82%), Postives = 153/368 (41.58%), Query Frame = 3
Query: 7263 PFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYH---SKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDN---------------------------------------YGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSF-CQCKSGYSGQQCQ 8237
P+ C C W QF D ++ CA K I S+ + C + + D C +PCK G C + + ++ CQC + GK C++ + C + C+NGG C +N G+Y+C+C G+ G C++ I++CV N C+N G C D +N Y C+C T ++G+ C L PC N G C ++ + Y C C G+ G NC+ C N C N A C + + C C + GK C+ + +P S S+ P ++++ S ++ C G C+S +++ F C+C G+ G C+
Sbjct: 293 PWTCSCENNWGGQF-----CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCK-KGTC-MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA--CQNQPCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHS--RPYCGNESCE-------SAYDACSMP--QMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCE 639

HSP 6 Score: 108.227 bits (269), Expect = 5.10998e-23
Identity = 95/368 (25.82%), Postives = 153/368 (41.58%), Query Frame = -3
Query: 1240 PFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYH---SKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDN---------------------------------------YGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSF-CQCKSGYSGQQCQ 2214
P+ C C W QF D ++ CA K I S+ + C + + D C +PCK G C + + ++ CQC + GK C++ + C + C+NGG C +N G+Y+C+C G+ G C++ I++CV N C+N G C D +N Y C+C T ++G+ C L PC N G C ++ + Y C C G+ G NC+ C N C N A C + + C C + GK C+ + +P S S+ P ++++ S ++ C G C+S +++ F C+C G+ G C+
Sbjct: 293 PWTCSCENNWGGQF-----CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCK-KGTC-MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA--CQNQPCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHS--RPYCGNESCE-------SAYDACSMP--QMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCE 639

HSP 7 Score: 103.219 bits (256), Expect = 1.75737e-21
Identity = 71/213 (33.33%), Postives = 111/213 (52.11%), Query Frame = 3
Query: 7446 DACIRSPCKHNGKC---SLITHHQYKCQCPHPFHGKNCE-KRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKC---NENIDDCV-NNKCENGGTCVDR-VNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEA----AWKPPA 8045
D CI+SPC + G C S ++ + C+C + + G+ C + + C +PC NGG C + ++C C G+ G C + + C N C+N G C++ N + C C+ G+ G++C + C + NPC N G C N+ YRC+C+ G+ G NC N D+C C A CVD ++ +EC+C G GK CD + +PP+
Sbjct: 681 DYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNEC-NPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPS 891

HSP 8 Score: 103.219 bits (256), Expect = 1.75737e-21
Identity = 71/213 (33.33%), Postives = 111/213 (52.11%), Query Frame = -3
Query: 1432 DACIRSPCKHNGKC---SLITHHQYKCQCPHPFHGKNCE-KRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKC---NENIDDCV-NNKCENGGTCVDR-VNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEA----AWKPPA 2031
D CI+SPC + G C S ++ + C+C + + G+ C + + C +PC NGG C + ++C C G+ G C + + C N C+N G C++ N + C C+ G+ G++C + C + NPC N G C N+ YRC+C+ G+ G NC N D+C C A CVD ++ +EC+C G GK CD + +PP+
Sbjct: 681 DYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNEC-NPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPS 891

HSP 9 Score: 72.7886 bits (177), Expect = 3.92154e-12
Identity = 79/328 (24.09%), Postives = 106/328 (32.32%), Query Frame = 3
Query: 7602 CKNVDNYGNYEC------VCPVGFRGPKCNENI-----------------------------DDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPN--NDYRCVCSLG-----------------------------------WLGKNCDENIDDCKYNECRNNAQCVDLVNG-----------------------------------------YECKCRPGYKGKFCDE---AAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
CKN N G+Y+C VC G+ G CN I D+C+ GTCVD + + C C + GQ+C YC + NPC N G C L + Y+C+C G W GK CD++ C N C+N QC NG Y+C C+PGY GK+CD+ P + I + + G C C N GVC D C+CK+GY+G C+
Sbjct: 216 CKN--NGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVD--SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCE 539

HSP 10 Score: 72.7886 bits (177), Expect = 3.92154e-12
Identity = 79/328 (24.09%), Postives = 106/328 (32.32%), Query Frame = -3
Query: 1240 CKNVDNYGNYEC------VCPVGFRGPKCNENI-----------------------------DDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPN--NDYRCVCSLG-----------------------------------WLGKNCDENIDDCKYNECRNNAQCVDLVNG-----------------------------------------YECKCRPGYKGKFCDE---AAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 1875
CKN N G+Y+C VC G+ G CN I D+C+ GTCVD + + C C + GQ+C YC + NPC N G C L + Y+C+C G W GK CD++ C N C+N QC NG Y+C C+PGY GK+CD+ P + I + + G C C N GVC D C+CK+GY+G C+
Sbjct: 216 CKN--NGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVD--SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCE 539
BLAST of slit vs. Smed Unigenes AA
Match: SMU15037114 (dd_smedV4_13823_0_1|m.8312|m.39635)

HSP 1 Score: 130.568 bits (327), Expect = 7.01076e-30
Identity = 79/228 (34.65%), Postives = 107/228 (46.93%), Query Frame = 3
Query: 7449 ACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENI---------DDCKYNECRNNAQC--------VDLVNG---------YECKCRPGYKGKFCDEAAWKPPAMKM 8054
+C +PC N +C +KC+CP F G+NCE + C PC NGG+C +D + CVCPVGF G +C N +DC C NG C+DR N C+C TG+ G+ C+ C PC N G C P + YRC C W G+ C+ I C N CRN+ C V++ N Y CKC PG+ G C++ ++ M
Sbjct: 430 SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMC--IDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS-YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVM 654

HSP 2 Score: 130.568 bits (327), Expect = 7.01076e-30
Identity = 79/228 (34.65%), Postives = 107/228 (46.93%), Query Frame = -3
Query: 1423 ACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENI---------DDCKYNECRNNAQC--------VDLVNG---------YECKCRPGYKGKFCDEAAWKPPAMKM 2028
+C +PC N +C +KC+CP F G+NCE + C PC NGG+C +D + CVCPVGF G +C N +DC C NG C+DR N C+C TG+ G+ C+ C PC N G C P + YRC C W G+ C+ I C N CRN+ C V++ N Y CKC PG+ G C++ ++ M
Sbjct: 430 SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMC--IDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS-YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVM 654

HSP 3 Score: 126.331 bits (316), Expect = 1.45473e-28
Identity = 89/290 (30.69%), Postives = 134/290 (46.21%), Query Frame = 3
Query: 7389 PTDFTCNEETDDAYITAKCDACIRSP--CKHNGKC----SLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCV-DRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQ-CLNEGVCVSADQKSFCQCKSGYSGQQC 8234
P C ++ + + C +P C++ G+C ++ T+ QY+C C F G +CEK + C + C NGG CK N Y C CP F G +C N C +N C C+ D+ +G+ C C G+ G+ C + C+ PC N G C P+ + CVC +G+ G C N +DC+ C N A+C+D N +C+C G+ G+ C N+ I+E CA +Q CLN G+C+ CQC++ +SGQ C
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMC--------------------------------NQNINE--CAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 578

HSP 4 Score: 126.331 bits (316), Expect = 1.45473e-28
Identity = 89/290 (30.69%), Postives = 134/290 (46.21%), Query Frame = -3
Query: 1243 PTDFTCNEETDDAYITAKCDACIRSP--CKHNGKC----SLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCV-DRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQ-CLNEGVCVSADQKSFCQCKSGYSGQQC 2088
P C ++ + + C +P C++ G+C ++ T+ QY+C C F G +CEK + C + C NGG CK N Y C CP F G +C N C +N C C+ D+ +G+ C C G+ G+ C + C+ PC N G C P+ + CVC +G+ G C N +DC+ C N A+C+D N +C+C G+ G+ C N+ I+E CA +Q CLN G+C+ CQC++ +SGQ C
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMC--------------------------------NQNINE--CAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 578

HSP 5 Score: 125.946 bits (315), Expect = 2.13172e-28
Identity = 96/370 (25.95%), Postives = 152/370 (41.08%), Query Frame = 3
Query: 7263 PFHCDCNIKWLNQF--FMERFLDNGISLCASP-ENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSL-ITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNE-CRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKS-----------------FCQCKSGYSGQQCQHLDSLYFAKESYIEISPPSRGFL 8306
P C+C KW F + N ++C + E + +I ++ C A+ CI + C + GKC + + ++Y C CP F+G C+ +C +PC C D ++C CP GF G C + D+C + C NGG C+DR +G+ C C G+ G C + C ++ C N C N C C+ GW G+ C++NI++C N+ C NN C+D Y C+C+ + G+FC+ P N E C + C N G+C+ + C+C G++G C+ + + Y E + GFL
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVP-------------------------NINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFL 666

HSP 6 Score: 125.946 bits (315), Expect = 2.13172e-28
Identity = 96/370 (25.95%), Postives = 152/370 (41.08%), Query Frame = -3
Query: 1171 PFHCDCNIKWLNQF--FMERFLDNGISLCASP-ENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSL-ITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNE-CRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKS-----------------FCQCKSGYSGQQCQHLDSLYFAKESYIEISPPSRGFL 2214
P C+C KW F + N ++C + E + +I ++ C A+ CI + C + GKC + + ++Y C CP F+G C+ +C +PC C D ++C CP GF G C + D+C + C NGG C+DR +G+ C C G+ G C + C ++ C N C N C C+ GW G+ C++NI++C N+ C NN C+D Y C+C+ + G+FC+ P N E C + C N G+C+ + C+C G++G C+ + + Y E + GFL
Sbjct: 325 PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVP-------------------------NINYLERKCLINPCRNSGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFL 666

HSP 7 Score: 82.8037 bits (203), Expect = 2.97558e-15
Identity = 71/254 (27.95%), Postives = 108/254 (42.52%), Query Frame = 3
Query: 7512 KCQCPHPFHGKNCEKRINACFGHP-CKNGG--ICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNK--CENGGTCVDRVN-----GYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCH-QLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCV-DLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 8237
+C+C + G +C++ C +P C +GG + C C + G CN +++ C NN CEN G C++ N Y C C+ G++G +C K + +N C N G C + N Y C C + G C N C N C N++C+ D +G++CKC PG+ G+ C+ I E C+ CLN G+C+ C C G+SG +CQ
Sbjct: 288 QCRCQTGWTGDSCDQ----CIPYPGCVHGGCRFDERTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE-KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCE----------------------------------IDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ 502

HSP 8 Score: 82.8037 bits (203), Expect = 2.97558e-15
Identity = 71/254 (27.95%), Postives = 108/254 (42.52%), Query Frame = -3
Query: 1240 KCQCPHPFHGKNCEKRINACFGHP-CKNGG--ICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNK--CENGGTCVDRVN-----GYGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCH-QLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCV-DLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQ 1965
+C+C + G +C++ C +P C +GG + C C + G CN +++ C NN CEN G C++ N Y C C+ G++G +C K + +N C N G C + N Y C C + G C N C N C N++C+ D +G++CKC PG+ G+ C+ I E C+ CLN G+C+ C C G+SG +CQ
Sbjct: 288 QCRCQTGWTGDSCDQ----CIPYPGCVHGGCRFDERTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE-KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCE----------------------------------IDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ 502
BLAST of slit vs. Smed Unigenes AA
Match: SMU15026192 (SmedSxldir_c80425_g1_i1|m.21927|m.13931)

HSP 1 Score: 108.612 bits (270), Expect = 3.72093e-23
Identity = 72/209 (34.45%), Postives = 100/209 (47.85%), Query Frame = 3
Query: 7428 YITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNG-YGCDCRTGYRGQYCHLKFTYCTDV-----NPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENID-----DCKYNECRNNAQCVDLVNGYE-CKCRPGYKGKFC 8018
++ C PC NGKC +++C C H + G+ CE+ +N C +PCKNGG C + N + C C F G C + C+N CENGGTC NG + C CR G+ G++C ++ C + CNN G C PN C C G+ G CD+ + CK + C N C L NG C+C+ + GK C
Sbjct: 18 WVIVSSKLCSNRPCV-NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 223

HSP 2 Score: 108.612 bits (270), Expect = 3.72093e-23
Identity = 72/209 (34.45%), Postives = 100/209 (47.85%), Query Frame = -3
Query: 1459 YITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNG-YGCDCRTGYRGQYCHLKFTYCTDV-----NPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENID-----DCKYNECRNNAQCVDLVNGYE-CKCRPGYKGKFC 2049
++ C PC NGKC +++C C H + G+ CE+ +N C +PCKNGG C + N + C C F G C + C+N CENGGTC NG + C CR G+ G++C ++ C + CNN G C PN C C G+ G CD+ + CK + C N C L NG C+C+ + GK C
Sbjct: 18 WVIVSSKLCSNRPCV-NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 223

HSP 3 Score: 100.138 bits (248), Expect = 1.56147e-20
Identity = 77/250 (30.80%), Postives = 109/250 (43.60%), Query Frame = 3
Query: 7569 CFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNG-YGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDEN------IDDCKYNECRNNAQCVDLVN-GYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKS-FCQCKSGYSGQQCQHLDSLYFAKESYIEISPP 8291
C PC NG + D + C C G++G C EN++DC+ N C+NGGTC+D+ N + C+C + + G C + C +VN C N G+C L N ++C C G++G+ C I K C N+ +C N CKC PGY G CD+ E+ E C C N GVC D S C+CK ++G+ C + KE+ I I P
Sbjct: 26 CSNRPCVNGKCVEAFD--PEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKK-----------------------------ELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT-IPLKETRKEALINIKIP 241

HSP 4 Score: 100.138 bits (248), Expect = 1.56147e-20
Identity = 77/250 (30.80%), Postives = 109/250 (43.60%), Query Frame = -3
Query: 1186 CFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNG-YGCDCRTGYRGQYCHLKFTYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDEN------IDDCKYNECRNNAQCVDLVN-GYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKS-FCQCKSGYSGQQCQHLDSLYFAKESYIEISPP 1908
C PC NG + D + C C G++G C EN++DC+ N C+NGGTC+D+ N + C+C + + G C + C +VN C N G+C L N ++C C G++G+ C I K C N+ +C N CKC PGY G CD+ E+ E C C N GVC D S C+CK ++G+ C + KE+ I I P
Sbjct: 26 CSNRPCVNGKCVEAFD--PEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKK-----------------------------ELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT-IPLKETRKEALINIKIP 241
BLAST of slit vs. RefSeq Human
Match: gi|11321571|ref|NP_003053.1| (slit homolog 3 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 755.362 bits (1949), Expect = 0
Identity = 497/1587 (31.32%), Postives = 770/1587 (48.52%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPG-----------CRDVAQES--------FNKLVTDVAKTDLQTXXXXXXXXXXXXXEPEICK-----NGGVCQAVNDGK---KKFK---------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCL 9284
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ ++KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS NK+KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC L W+ +W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +P+G+P + TELYL+ N+L + L +L + LS N I+ L + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCK+NG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C +C ++N C + C L + + C C G+ GK C+ + DDC ++CR+ AQCVD +NGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PG CR V ++S + + D D +CK G +C ND FK C+C+ GFSG+ C ++ C ++++ I+ +C + V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 2 Score: 755.362 bits (1949), Expect = 0
Identity = 497/1587 (31.32%), Postives = 770/1587 (48.52%), Query Frame = -3
Query:  193 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPG-----------CRDVAQES--------FNKLVTDVAKTDLQTXXXXXXXXXXXXSEPEICK-----NGGVCQAVNDGK---KKFK---------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCL 4650
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ ++KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS NK+KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC L W+ +W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +P+G+P + TELYL+ N+L + L +L + LS N I+ L + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCK+NG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C +C ++N C + C L + + C C G+ GK C+ + DDC ++CR+ AQCVD +NGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PG CR V ++S + + D D +CK G +C ND FK C+C+ GFSG+ C ++ C ++++ I+ +C + V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPV-DINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1520

HSP 3 Score: 319.701 bits (818), Expect = 3.40093e-87
Identity = 219/673 (32.54%), Postives = 334/673 (49.63%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 6797
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I + GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D ++ + C +C + C C EG IV C + + +P LP + +L L+DN ++VL+ + K NL+KI L++N++ ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC L+WL ++LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP + + + F C+ V NA ++ C N
Sbjct: 276 NSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTL--IDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 4 Score: 319.701 bits (818), Expect = 3.40093e-87
Identity = 219/673 (32.54%), Postives = 334/673 (49.63%), Query Frame = -3
Query: 2680 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVT-------NASATAECTN 4659
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I + GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D ++ + C +C + C C EG IV C + + +P LP + +L L+DN ++VL+ + K NL+KI L++N++ ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC L+WL ++LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP + + + F C+ V NA ++ C N
Sbjct: 276 NSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTL--IDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKN 927

HSP 5 Score: 181.415 bits (459), Expect = 1.71244e-44
Identity = 127/484 (26.24%), Postives = 211/484 (43.60%), Query Frame = 3
Query: 6183 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXXIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 7421
P ++CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G V+ + +K ++C SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTVGQFT--LCMAPVHLRGFNVADVQKKEYVC--------------PAPHSEPPSCNAN------SISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 181.415 bits (459), Expect = 1.71244e-44
Identity = 127/484 (26.24%), Postives = 211/484 (43.60%), Query Frame = -3
Query: 2056 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXLIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 3294
P ++CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G V+ + +K ++C SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTVGQFT--LCMAPVHLRGFNVADVQKKEYVC--------------PAPHSEPPSCNAN------SISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. RefSeq Human
Match: gi|429836873|ref|NP_001258875.1| (slit homolog 3 protein isoform 1 precursor [Homo sapiens])

HSP 1 Score: 751.895 bits (1940), Expect = 0
Identity = 497/1593 (31.20%), Postives = 770/1593 (48.34%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCN------EETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPG-----------CRDVAQES--------FNKLVTDVAKTDLQTXXXXXXXXXXXXXEPEICK-----NGGVCQAVNDGK---KKFK---------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCL 9284
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ ++KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS NK+KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC L W+ +W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +P+G+P + TELYL+ N+L + L +L + LS N I+ L + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCK+NG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C +C ++N C + C L + + C C G+ GK C+ + DDC ++CR+ AQCVD +NGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PG CR V ++S + + D D +CK G +C ND FK C+C+ GFSG+ C ++ C ++++ I+ +C + V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1527

HSP 2 Score: 751.895 bits (1940), Expect = 0
Identity = 497/1593 (31.20%), Postives = 770/1593 (48.34%), Query Frame = -3
Query:  193 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-LKNLE------------------------TLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNM-------------------------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCN------EETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGN-YECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYF-AKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG--YSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPG-----------CRDVAQES--------FNKLVTDVAKTDLQTXXXXXXXXXXXXSEPEICK-----NGGVCQAVNDGK---KKFK---------------CICKDGFSGKSCNRKAYMCRRKMIKNHIKDPD--TTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCL 4650
CP C C + S++C LR VP +P +L+L N I I K DF+ + NL++L L +N+++ IE G F L QL +LRLN+N +Q LP+ LF L +LDL +NQ+Q + G+ ++KNL LD N I I + R L++LE TL + +N L C+CHLAWL+ +++ + V Q LC P L ++ + E+ C + +S C C C CS IV C G+G+ +P +LP I+E+ L N+I + A ++YK LK+I ++ N+++DI P AF+GL+ LTSL L GNK+ I K GL SL L ++ N I CL +TF L L LL L +NKL T+ K PL ++ L+L NP C+C L WLA++L+ E SG A C P+ L + + ++S +F C E +C + CP+ C C +VDC+ L IP ++ LP+ + + LS NK+KE+ + A ++ L+ N+++ + +F S LK + L SN + C++N TF L + L L DN I I G+F ++ + L NP +CNC L W+ +W R G CQ P L+ + + + F C N E S C +S RCP +C C T V CS L +P+G+P + TELYL+ N+L + L +L + LS N I+ L + + L TL++S+N+L+CI AF GL +L+VL L ND++++P G+F DL +L+++ALG NP HCDC+++WL+++ + + GI+ C+SPE M + + + F C D I AKC+AC+ SPCK+NG C+ Y+C CP+ + GK+C IN C +PC++GG C D++ + + C CP+GF G +C N DDC +N CEN TCVD +N Y C C Y G+ C +C ++N C + C L + + C C G+ GK C+ + DDC ++CR+ AQCVD +NGY C C G+ G FC+ PP M + + S C ++C N C+ Q+ C+C G++G +C+ L ++ F K+SY+E+ + + P+ NI+L+ +T+ +G+LLY+G D L++ LY+GHVR+ Y D + P YS+ ++ND + HS+E+ + + L + +D +L + ++S +++GG P +AL + F GC+ + IN + DF +S+ V PG CR V ++S + + D D +CK G +C ND FK C+C+ GFSG+ C ++ C ++++ I+ +C + V C G C +CCQP + + R+ F+C G + V C CL
Sbjct: 33 ACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTV----GQFTLCMAPVHLRGFNVADVQKKEYVCPA--PHSEPPSCNANSISCPSPCTCSNN-IVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSG---ARCSSPRRLANKRISQIKSKKFRC-SGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQ-ELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPR---CQKPFFLKEIPIQDVAIQDFTCDGN----------------EESSCQLS-------PRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAV-PRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKVLWFCCPGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPL-DKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH----PPPMVL-----------------------LQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVEL---ASAKVRPQANISLQVATDKDNGILLYKG-DNDPLALELYQGHVRLVY---DSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQK--QPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQEN-PCLGQVVREVIRRQKGYASCATASKVPIMECRGGC---------------------GPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCL 1527

HSP 3 Score: 319.316 bits (817), Expect = 5.08001e-87
Identity = 214/652 (32.82%), Postives = 327/652 (50.15%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCR 6755
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I + GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D ++ + C +C + C C EG IV C + + +P LP + +L L+DN ++VL+ + K NL+KI L++N++ ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC L+WL ++LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP + + + F C+
Sbjct: 276 NSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTL--IDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCK 906

HSP 4 Score: 319.316 bits (817), Expect = 5.08001e-87
Identity = 214/652 (32.82%), Postives = 327/652 (50.15%), Query Frame = -3
Query: 2722 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCAS--DSKNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKE-ASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCR 4659
N+ +CP+ C C + ++C+ + L +P +LPE V++ L N I I F++ LK + +S N+I+ I F L LT L L N I + GLF L +LQ L L N++ C+ N L NL L L NK+ I++ + + L++++TLH+A N C+CHL WL +++ P C++P RL+ IS + S +F+C+ D ++ + C +C + C C EG IV C + + +P LP + +L L+DN ++VL+ + K NL+KI L++N++ ++ GAF+G + L L GN+L+++ GLS L L + +N I C+ DTF GLS + LL L +N++TT+ L L + L+ NP NCNC L+WL ++LR + SG+P C P L P++ V F C + + C CP+ CTC VV C+ L +P M + L N L + L L IDLS N I + F S L + L+ N+L+CI F L L L L N I + EGSF + ++ HL L NPLHC+C L+W+SEW + Y G C SP + + + F C+
Sbjct: 276 NSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPI----ETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECF-MDLVCPEKCRC--EGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNP--RCQKPFFLKEIPIQDVAIQDFTC-------DGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTL--IDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPG---IARCSSPEPMADRLLLTTPTHRFQCK 906

HSP 5 Score: 181.415 bits (459), Expect = 1.69315e-44
Identity = 127/484 (26.24%), Postives = 211/484 (43.60%), Query Frame = 3
Query: 6183 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXXIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 7421
P ++CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G V+ + +K ++C SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTVGQFT--LCMAPVHLRGFNVADVQKKEYVCP--------------APHSEPPSCNAN------SISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490

HSP 6 Score: 181.415 bits (459), Expect = 1.69315e-44
Identity = 127/484 (26.24%), Postives = 211/484 (43.60%), Query Frame = -3
Query: 2056 PKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPS-----------TKVVILSYNKLKEIXXXXXXXXXXXLIK------------------------------------IDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVV------------------------SFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETD 3294
P ++CP CTC+ VDC+G L +P + + T++ + + LK + ++I+ +DLS N+I I F + +K + L++N + CI + FR L DLE L L++N I I+ SF I+ L L+ N L+C+C L W+S+W R T+G T LC +P L+G V+ + +K ++C SE C+ + + CP+ C C VDC L +IP +P E+ L++N++ + +F + LK + +S N I+++ + L+SL +LV+ + NK+ C+ F+ L NL +L L N + TI G F L+++ + L QNPF CDC++KWL + + ++ + C+SP + K I K F C+ D
Sbjct: 30 PAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTVGQFT--LCMAPVHLRGFNVADVQKKEYVCP--------------APHSEPPSCNAN------SISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED 490
BLAST of slit vs. RefSeq Human
Match: gi|574281850|ref|NP_001276064.1| (slit homolog 2 protein isoform 2 precursor [Homo sapiens])

HSP 1 Score: 745.732 bits (1924), Expect = 0
Identity = 477/1381 (34.54%), Postives = 719/1381 (52.06%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAE-----------------DISRLK--------NLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQC------------------------IVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCR 8789
CP C C +++C LR+VP ++P T +L+L GN I I K+DF+ + +L++LQL N+I++IE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q + G ++KNL LD N+I I + +I+RL L T + +N L C+CHLAWL+ +++ +P+V C P L ++ + EF C SD + ++ P + C C CS IV C G+G+ +P +LP +I E+ L N I V+ A S YK L++I L++N+++++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T PL ++ ++L NP C+C L WLA++L E SG A C P+ L + + ++S +F C E DC ++CP+ C C VDC+ L IP+++ T + L+ N+ + + LP L KI+ S N+I IE F S + EI L SN+L+ + ++ F+ L L+TL L N I C + G+F ++ L L NP +CNC L W+ EW R G CQ P L+ + + + F C + +NSC +S RCPT+C C T V CS L +PKGIP + TELYLD N + + S++KHL TL+ LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P GAF DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + FTC D I AKC+ C+ +PCK++G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N+DDC +N CEN TCVD +N Y C C Y G+ C K +C D+NPC + C P ++C C+ G++G++CD + DDC+ N+C+N A C D VNGY C C GY G FC+ + PP M + R S C C N C+ + CQC GY G++C+ L S+ F KESY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L S +++GG P +L + ++ T F GC+++L IN + DF K ++ + PGC
Sbjct: 27 ACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVC-SDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRC-SGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--------------NDDNSCSPLS--------RCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHL----TLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPP---MVLPR---------------------TSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQT-GILPGCE 1330

HSP 2 Score: 745.732 bits (1924), Expect = 0
Identity = 477/1381 (34.54%), Postives = 719/1381 (52.06%), Query Frame = -3
Query:  688 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAE-----------------DISRLK--------NLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQC------------------------IVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCR 4650
CP C C +++C LR+VP ++P T +L+L GN I I K+DF+ + +L++LQL N+I++IE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q + G ++KNL LD N+I I + +I+RL L T + +N L C+CHLAWL+ +++ +P+V C P L ++ + EF C SD + ++ P + C C CS IV C G+G+ +P +LP +I E+ L N I V+ A S YK L++I L++N+++++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T PL ++ ++L NP C+C L WLA++L E SG A C P+ L + + ++S +F C E DC ++CP+ C C VDC+ L IP+++ T + L+ N+ + + LP L KI+ S N+I IE F S + EI L SN+L+ + ++ F+ L L+TL L N I C + G+F ++ L L NP +CNC L W+ EW R G CQ P L+ + + + F C + +NSC +S RCPT+C C T V CS L +PKGIP + TELYLD N + + S++KHL TL+ LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P GAF DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + FTC D I AKC+ C+ +PCK++G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N+DDC +N CEN TCVD +N Y C C Y G+ C K +C D+NPC + C P ++C C+ G++G++CD + DDC+ N+C+N A C D VNGY C C GY G FC+ + PP M + R S C C N C+ + CQC GY G++C+ L S+ F KESY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L S +++GG P +L + ++ T F GC+++L IN + DF K ++ + PGC
Sbjct: 27 ACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVC-SDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRC-SGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--------------NDDNSCSPLS--------RCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHL----TLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPP---MVLPR---------------------TSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQT-GILPGCE 1330
BLAST of slit vs. RefSeq Human
Match: gi|530376407|ref|XP_005248268.1| (PREDICTED: slit homolog 2 protein isoform X1 [Homo sapiens])

HSP 1 Score: 745.347 bits (1923), Expect = 0
Identity = 477/1388 (34.37%), Postives = 719/1388 (51.80%), Query Frame = 3
Query: 4827 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAE-----------------DISRLK--------NLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQX-------XXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQC------------------------IVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCR 8789
CP C C +++C LR+VP ++P T +L+L GN I I K+DF+ + +L++LQL N+I++IE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q + G ++KNL LD N+I I + +I+RL L T + +N L C+CHLAWL+ +++ +P+V C P L ++ + EF C SD + ++ P + C C CS IV C G+G+ +P +LP +I E+ L N I V+ A S YK L++I L++N+++++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T PL ++ ++L NP C+C L WLA++L E SG A C P+ L + + ++S +F C E DC ++CP+ C C VDC+ L IP+++ T + L+ N+ + + LP L KI+ S N+I IE F S + EI L SN+L+ + ++ F+ L L+TL L N I C + G+F ++ L L NP +CNC L W+ EW R G CQ P L+ + + + F C + +NSC +S RCPT+C C T V CS L +PKGIP + TELYLD N + + S++KHL TL+ LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P GAF DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + FTC D I AKC+ C+ +PCK++G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N+DDC +N CEN TCVD +N Y C C Y G+ C K +C D+NPC + C P ++C C+ G++G++CD + DDC+ N+C+N A C D VNGY C C GY G FC+ + PP M + R S C C N C+ + CQC GY G++C+ L S+ F KESY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L S +++GG P +L + ++ T F GC+++L IN + DF K ++ + PGC
Sbjct: 27 ACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVC-SDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--------------NDDNSCSPLS--------RCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHL----TLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPP---MVLPR---------------------TSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQT-GILPGCE 1338

HSP 2 Score: 745.347 bits (1923), Expect = 0
Identity = 477/1388 (34.37%), Postives = 719/1388 (51.80%), Query Frame = -3
Query:  688 TCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAE-----------------DISRLK--------NLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKL--CSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQX-------XXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQC------------------------IVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNE--SSFKHLENLKTLV-LSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGIC--KNVDNYGNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCR 4650
CP C C +++C LR+VP ++P T +L+L GN I I K+DF+ + +L++LQL N+I++IE G F L +L +LRLNRN +Q P+ LF L +LDL +NQ+Q + G ++KNL LD N+I I + +I+RL L T + +N L C+CHLAWL+ +++ +P+V C P L ++ + EF C SD + ++ P + C C CS IV C G+G+ +P +LP +I E+ L N I V+ A S YK L++I L++N+++++ P AF+GLR L SL L GNK+ + K+ GL SL L ++ N I CL D F L L LL L +NKL T+ K T PL ++ ++L NP C+C L WLA++L E SG A C P+ L + + ++S +F C E DC ++CP+ C C VDC+ L IP+++ T + L+ N+ + + LP L KI+ S N+I IE F S + EI L SN+L+ + ++ F+ L L+TL L N I C + G+F ++ L L NP +CNC L W+ EW R G CQ P L+ + + + F C + +NSC +S RCPT+C C T V CS L +PKGIP + TELYLD N + + S++KHL TL+ LS N I+ L+ + + L TL++S+N+L+CI F GL +L++L L ND++ +P GAF DL L+++A+G NP +CDCN++WL+ + + + GI+ CA P M K + + FTC D I AKC+ C+ +PCK++G C+ Y+C CP+ F G++C+ I+AC +PCK+GG C K + G + C+C GF G C N+DDC +N CEN TCVD +N Y C C Y G+ C K +C D+NPC + C P ++C C+ G++G++CD + DDC+ N+C+N A C D VNGY C C GY G FC+ + PP M + R S C C N C+ + CQC GY G++C+ L S+ F KESY++I P ++ + P+ NITL+ +T+ SG+LLY+G D+ +++V LYRG VR Y+ G YS+ +IND H +E+ + ++L++ +DG + + S L S +++GG P +L + ++ T F GC+++L IN + DF K ++ + PGC
Sbjct: 27 ACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV----GLYTQCMGPSHLRGHNVAEVQKREFVC-SDEEEGHQSFMAPSCSVLHCPAACTCSNN-IVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG---ARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPR---CQKPYFLKEIPIQDVAIQDFTCDDG--------------NDDNSCSPLS--------RCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHL----TLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPV-DVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEEDG-FWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKG-FKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCE---FSPP---MVLPR---------------------TSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQI-PSAK--VRPQTNITLQIATDEDSGILLYKG-DKDHIAVELYRGRVRASYDTGSHP-ASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITN--LSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQT-GILPGCE 1338
BLAST of slit vs. RefSeq Human
Match: gi|188528675|ref|NP_003052.2| (slit homolog 1 protein precursor [Homo sapiens])

HSP 1 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1582 (31.48%), Postives = 766/1582 (48.42%), Query Frame = 3
Query: 4818 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXX-----XXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLN------------------------RNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQL--NESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRY-LALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP-------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYM---CRR-KMIKNHIKDPDTT---CLSLKTVRYRYCEGSCQDSKMQSDIQKSFFH-----------RPVDTGSSR-------CCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKC 9281
+ CP C C +++C L+ +P+++P T +L L GN I I K+DF+ + L++LQL N+I ++E G FD + +L +LRLNRN + LP+ LF + L +LDL +N +Q + G +LKNL LD+N+I I E R + L T + +N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + C C C CS GIV C G+G+ +P +LP ++ E+ L N I + A S Y+ L++I L++N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L ++ L+L NP C+C L WLA+FLR E SG A C P+ L + + ++S +F C E+ E + +C + CP C C VV+C+ LT IP+ + ST + L+ N++ + + L +L KI+LS N++ IE F + + E++L +N+L+ I + FR L L TL L +N I CI SF +N++ L+L NP +CNCQL W+ W R G CQ+P L+ + + F C E + E C + +P+ CP +C C T V CS L +PKGIP N TELYLD N + S+FK+L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L ND++T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P++M+ K + + F C A + AKCD C+ SPC++ G C Y+C CP + G++CE +++C PC+NGG C + + C CP GF GP C N DDCV++ C NGG CVD V Y C C Y G+ C C+ D+NPC + C P+ RC C G+ G NC EN DDC+ + C+N AQC+D VN Y C C GY G+ C+ PP + +S C +C N CV + CQC G+ G +C+ L S+ F +++Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + G Y L + +++GG P + A + + + T F GC+++L IN + DF K + V PGC + + T V C +P C +G Q V + C C+DG+SG CN+ + CR + + H + T C+ CE Q+S+ + D + F RP+ R CCQ + + R+ F+C G + V +C C
Sbjct: 30 GASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEG--------------QEEGGC--LPRPQ------CPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQ---LVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCE----IPPHLPA------------------------PKSPCEGTECQNGANCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMD---NFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHG---QCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCE---QESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530

HSP 2 Score: 742.265 bits (1915), Expect = 0
Identity = 498/1582 (31.48%), Postives = 766/1582 (48.42%), Query Frame = -3
Query:  196 NTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFK--EASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXX-----XXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLN------------------------RNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQL--NESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNY-GNYECVCPVGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLDSLYFA-KESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRY-LALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP-------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYM---CRR-KMIKNHIKDPDTT---CLSLKTVRYRYCEGSCQDSKMQSDIQKSFFH-----------RPVDTGSSR-------CCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKC 4659
+ CP C C +++C L+ +P+++P T +L L GN I I K+DF+ + L++LQL N+I ++E G FD + +L +LRLNRN + LP+ LF + L +LDL +N +Q + G +LKNL LD+N+I I E R + L T + +N L C+CHLAWL+++++ +P + C+ P L + ++ + EF C+ + C C C CS GIV C G+G+ +P +LP ++ E+ L N I + A S Y+ L++I L++N++ +I P AF+GLR L SL L GNK+ + + GL +L L ++ N I C+ D F L L LL L +NK+ +L K T L ++ L+L NP C+C L WLA+FLR E SG A C P+ L + + ++S +F C E+ E + +C + CP C C VV+C+ LT IP+ + ST + L+ N++ + + L +L KI+LS N++ IE F + + E++L +N+L+ I + FR L L TL L +N I CI SF +N++ L+L NP +CNCQL W+ W R G CQ+P L+ + + F C E + E C + +P+ CP +C C T V CS L +PKGIP N TELYLD N + S+FK+L+ + LS N I+ L+ + T + L TL++S+N LQCI AF+GL +L++L L ND++T+ G F D+ +L+++A+G NP +CDC+++WL+ + + + GI+ CA P++M+ K + + F C A + AKCD C+ SPC++ G C Y+C CP + G++CE +++C PC+NGG C + + C CP GF GP C N DDCV++ C NGG CVD V Y C C Y G+ C C+ D+NPC + C P+ RC C G+ G NC EN DDC+ + C+N AQC+D VN Y C C GY G+ C+ PP + +S C +C N CV + CQC G+ G +C+ L S+ F +++Y++ + PR NITL+ ST +G+LLY G D +++V LY+GHVR+ Y+ G YS +IND + H++E+ + + + +DG T+ + G Y L + +++GG P + A + + + T F GC+++L IN + DF K + V PGC + + T V C +P C +G Q V + C C+DG+SG CN+ + CR + + H + T C+ CE Q+S+ + D + F RP+ R CCQ + + R+ F+C G + V +C C
Sbjct: 30 GASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTI----GLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSN-GIVDCRGKGLTAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSG---ARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR---CQNPDFLRQIPLQDVAFPDFRCEEG--------------QEEGGC--LPRPQ------CPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQ---LVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA-VQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGP-RCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCE----IPPHLPA------------------------PKSPCEGTECQNGANCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQN---WPRANITLQVSTAEDNGILLYNG-DNDHIAVELYQGHVRVSYDPG-SYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMD---NFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKP-GVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHG---QCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCE---QESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGC 1530
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136484|ref|NP_476729.1| (slit, isoform B [Drosophila melanogaster])

HSP 1 Score: 783.097 bits (2021), Expect = 0
Identity = 481/1506 (31.94%), Postives = 771/1506 (51.20%), Query Frame = 3
Query: 4830 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ GL L+ L L+ N + + +I L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1468

HSP 2 Score: 783.097 bits (2021), Expect = 0
Identity = 481/1506 (31.94%), Postives = 771/1506 (51.20%), Query Frame = -3
Query:  184 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4647
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ GL L+ L L+ N + + +I L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1468

HSP 3 Score: 294.278 bits (752), Expect = 7.95553e-80
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4824 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 6770
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 293 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 902

HSP 4 Score: 294.278 bits (752), Expect = 7.95553e-80
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = -3
Query: 2707 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 4653
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 293 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 902

HSP 5 Score: 174.096 bits (440), Expect = 9.24638e-43
Identity = 119/469 (25.37%), Postives = 211/469 (44.99%), Query Frame = 3
Query: 6180 IPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXI-----------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 7445
I + CP+ C+CT VDC+ LT++P + + + L N L I + + ++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 6 Score: 174.096 bits (440), Expect = 9.24638e-43
Identity = 119/469 (25.37%), Postives = 211/469 (44.99%), Query Frame = -3
Query: 2032 IPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLI-----------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 3297
I + CP+ C+CT VDC+ LT++P + + + L N L I + + ++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 7 Score: 118.242 bits (295), Expect = 1.03924e-25
Identity = 70/232 (30.17%), Postives = 107/232 (46.12%), Query Frame = 3
Query: 6849 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVS------------------------FNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 7472
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300

HSP 8 Score: 118.242 bits (295), Expect = 1.03924e-25
Identity = 70/232 (30.17%), Postives = 107/232 (46.12%), Query Frame = -3
Query: 2005 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVS------------------------FNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 2628
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136482|ref|NP_476728.1| (slit, isoform A [Drosophila melanogaster])

HSP 1 Score: 774.622 bits (1999), Expect = 0
Identity = 481/1517 (31.71%), Postives = 771/1517 (50.82%), Query Frame = 3
Query: 4830 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ GL L+ L L+ N + + +I L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 2 Score: 774.622 bits (1999), Expect = 0
Identity = 481/1517 (31.71%), Postives = 771/1517 (50.82%), Query Frame = -3
Query:  184 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4647
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ GL L+ L L+ N + + +I L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 3 Score: 294.664 bits (753), Expect = 7.48762e-80
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4824 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 6770
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 293 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 902

HSP 4 Score: 294.664 bits (753), Expect = 7.48762e-80
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = -3
Query: 2707 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 4653
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 293 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 902

HSP 5 Score: 174.096 bits (440), Expect = 8.79279e-43
Identity = 119/469 (25.37%), Postives = 211/469 (44.99%), Query Frame = 3
Query: 6180 IPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXI-----------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 7445
I + CP+ C+CT VDC+ LT++P + + + L N L I + + ++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 6 Score: 174.096 bits (440), Expect = 8.79279e-43
Identity = 119/469 (25.37%), Postives = 211/469 (44.99%), Query Frame = -3
Query: 2032 IPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLI-----------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 3297
I + CP+ C+CT VDC+ LT++P + + + L N L I + + ++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 7 Score: 118.242 bits (295), Expect = 9.83792e-26
Identity = 70/232 (30.17%), Postives = 107/232 (46.12%), Query Frame = 3
Query: 6849 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVS------------------------FNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 7472
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300

HSP 8 Score: 118.242 bits (295), Expect = 9.83792e-26
Identity = 70/232 (30.17%), Postives = 107/232 (46.12%), Query Frame = -3
Query: 2005 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVS------------------------FNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 2628
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077130|ref|NP_001097333.1| (slit, isoform D [Drosophila melanogaster])

HSP 1 Score: 774.622 bits (1999), Expect = 0
Identity = 481/1517 (31.71%), Postives = 771/1517 (50.82%), Query Frame = 3
Query: 4830 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ GL L+ L L+ N + + +I L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 2 Score: 774.622 bits (1999), Expect = 0
Identity = 481/1517 (31.71%), Postives = 771/1517 (50.82%), Query Frame = -3
Query:  184 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDI-SRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4647
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +L ++ N+I + +F ++L+ L L +NQ+ C++E+ GL L+ L L+ N + + +I L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1479

HSP 3 Score: 294.664 bits (753), Expect = 7.48762e-80
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4824 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 6770
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 293 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 902

HSP 4 Score: 294.664 bits (753), Expect = 7.48762e-80
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = -3
Query: 2707 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 4653
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 293 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 902

HSP 5 Score: 174.096 bits (440), Expect = 8.79279e-43
Identity = 119/469 (25.37%), Postives = 211/469 (44.99%), Query Frame = 3
Query: 6180 IPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXI-----------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 7445
I + CP+ C+CT VDC+ LT++P + + + L N L I + + ++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 6 Score: 174.096 bits (440), Expect = 8.79279e-43
Identity = 119/469 (25.37%), Postives = 211/469 (44.99%), Query Frame = -3
Query: 2032 IPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLI-----------------------KIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 3297
I + CP+ C+CT VDC+ LT++P + + + L N L I + + ++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 513

HSP 7 Score: 118.242 bits (295), Expect = 9.83792e-26
Identity = 70/232 (30.17%), Postives = 107/232 (46.12%), Query Frame = 3
Query: 6849 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVS------------------------FNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 7472
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300

HSP 8 Score: 118.242 bits (295), Expect = 9.83792e-26
Identity = 70/232 (30.17%), Postives = 107/232 (46.12%), Query Frame = -3
Query: 2005 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVS------------------------FNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 2628
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L +S N++ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 300
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|17136480|ref|NP_476727.1| (slit, isoform C [Drosophila melanogaster])

HSP 1 Score: 771.155 bits (1990), Expect = 0
Identity = 483/1541 (31.34%), Postives = 771/1541 (50.03%), Query Frame = 3
Query: 4830 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +LRLN N ++ +P+ + +L +LD+ +N + V V G +L++L LD N+I + E + L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 771.155 bits (1990), Expect = 0
Identity = 483/1541 (31.34%), Postives = 771/1541 (50.03%), Query Frame = -3
Query:  184 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4647
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +LRLN N ++ +P+ + +L +LD+ +N + V V G +L++L LD N+I + E + L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 3 Score: 293.893 bits (751), Expect = 1.21352e-79
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4824 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 6770
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 317 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 926

HSP 4 Score: 293.893 bits (751), Expect = 1.21352e-79
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = -3
Query: 2707 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 4653
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 317 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 926

HSP 5 Score: 167.548 bits (423), Expect = 1.06117e-40
Identity = 125/494 (25.30%), Postives = 221/494 (44.74%), Query Frame = 3
Query: 6180 IPKISCPKNCTCTPEVVDCNGAHLTTIP-------------------------------------DNM-----------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 7445
I + CP+ C+CT VDC+ LT++P DN L S + + L+ N+LK I + + + +L+++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 6 Score: 167.548 bits (423), Expect = 1.06117e-40
Identity = 125/494 (25.30%), Postives = 221/494 (44.74%), Query Frame = -3
Query: 2032 IPKISCPKNCTCTPEVVDCNGAHLTTIP-------------------------------------DNM-----------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 3297
I + CP+ C+CT VDC+ LT++P DN L S + + L+ N+LK I + + + +L+++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 7 Score: 108.612 bits (270), Expect = 7.91214e-23
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = 3
Query: 6849 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 7472
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L ++ N+L+ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324

HSP 8 Score: 108.612 bits (270), Expect = 7.91214e-23
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = -3
Query: 2005 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 2628
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L ++ N+L+ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324
BLAST of slit vs. RefSeq Drosophila melanogaster
Match: gi|161077132|ref|NP_001097334.1| (slit, isoform E [Drosophila melanogaster])

HSP 1 Score: 771.155 bits (1990), Expect = 0
Identity = 483/1541 (31.34%), Postives = 771/1541 (50.03%), Query Frame = 3
Query: 4830 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXXEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 9293
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +LRLN N ++ +P+ + +L +LD+ +N + V V G +L++L LD N+I + E + L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 2 Score: 771.155 bits (1990), Expect = 0
Identity = 483/1541 (31.34%), Postives = 771/1541 (50.03%), Query Frame = -3
Query:  184 CPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAEDISR-------------------------LKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGIVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLITHHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCPVGFRGPKCNENIDDCVNN-KCENGGTCVDRVNGYGCDCRTGYRGQYCHLKFTYCT-DVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRNNAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAGKSDNPGNEVIS-----ESVCAYHQCLNEGVCVSADQKS---FCQCKSGYSGQQCQHLDSLYFAK-ESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYFIGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDLQTXXXXXXXXXXXXSEP------EICKNGGVCQAVNDGKKKFKCICKDGFSGKSCNR-----------KAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSFFHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNC 4647
CP C C +++C HR L +VP + +L L GN + VI ++DF ++ L++LQL++N+I +IE +F L L +LRLN N ++ +P+ + +L +LD+ +N + V V G +L++L LD N+I + E + L L L ++ N C+CHL+WL+RF++ ++ C +P +L ++ L EF+C+ ++++ + C C C+ +GIV C + + +VP LP EL L N I L + S ++ L++I L++N ++ I A GL+QLT+L L GNK+K + GL SL L ++ N+I C+ +D F L L LL L +N + +L T D + ++ ++L NP C+C L WLA++L K + A C PK +H + + ++ +F C DE S + C CP C C VDC G L IP ++ T ++L+ N+L IS+ LP+L+K++L N++ IE + F S ++E+ L NK+K I+N+ F L+ L+TL L DN I C++ GSF+ ++ L L NP +CNC L W +EW R GA C +P+ ++ + L F C SENS C CP C C GT V CS QL +IP+GIP T+ELYL+ N + Q++ +HL +L L LS N IT L+ L L TL++S+NKLQC+ R A GL NL+VL L N ++ +P G+F DL++L +IALG NP +CDC +KW + + +++ GI+ CA PE MK K I + + F C + I AKC+AC PC++ +C + +Y+C C +HGK+CE I+AC+G+PC+N C ++ G + C C G+ G +C NIDDC+ KC+N TC+D V Y C+C+ G+ G++C K +C+ + NPC N C + Y C C G+ G NC +NIDDC+ + C+N CVD +N Y+C+C Y GK+C+ G+ +IS S C H+C GVC + + C+C GY+G+ C++L S+ F S++E+ P P N+T+ FS+ +G+L+Y G D +L+V L+ G +R+ Y++G+ + YS + D + H++E+ I +N T+ +D ++ + S N YL L++ +F+GG P + A + + + T F GC++ + IN K +DF R + PGC L+ + + + EP C+ G C ++ + ++C CK G G+ C++ A CR++ ++ + + D C S + ++Y C G C ++CC R R++ C + R+Y + + VR+C C C
Sbjct: 73 CPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP----YTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMEC--GAENSCPHPCRCA-DGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLH-KNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGE--CRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA---ARCGAPSKVRDVQIKDLPHSEFKCS-----------------SENS------EGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRND-ILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEE-GRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTH-YSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCE------------------------------GHNMISMMYPQTSPCQNHEC-KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLR---TRPEANVTIVFSSAEQNGILMYDGQD-AHLAVELFNGRIRVSYDVGNHPVSTM-YSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGS--NDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGN-AQRQQKITPGC---------ALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTEND--CRSRQPLKYAKCVGGC---------------------GNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKC 1503

HSP 3 Score: 293.893 bits (751), Expect = 1.21352e-79
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = 3
Query: 4824 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXXCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 6770
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 317 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 926

HSP 4 Score: 293.893 bits (751), Expect = 1.21352e-79
Identity = 209/653 (32.01%), Postives = 320/653 (49.00%), Query Frame = -3
Query: 2707 NTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNRINVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWIAED-ISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASDS-KNSLENICQPKKKLCSKHCICSTEG-IVKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNAL-SKYKNLKKILLNSNEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNNDIECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLNCNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQXXXXXXXXXXXDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTN 4653
N+CP+ C+C ++C+ + L +VP +LP+ T +L L N I + FS L+ + LSNN I+ I L QLT L L N I+ LP G+F L +LQ L L N++ C+ ++ L +L L L N I +A +K+++T+H+A N C+C+L WL ++ P C +P R+ + I SL +F+C+ D + L C+ C C C EG V C GRG+K +P+D+P EL L+DN + + + L + +L K+ L N++T IEP AFEG + L L NK+K I LGL L L +++N I C+ +F E L+ LT L L NP NCNC L+W AE+LR K +G A C P + ++ + +F C + E C+ CP +CTCT VV C+ L IP + T + L N++++I + + L +L ++DLS N+I + F ++L + ++ NKL+C+ L +L L L N I + EGSF++ K++ H+ L NPL+C+C LKW S+W + Y G C P ++ + S F+CR V N
Sbjct: 317 NSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPI----ETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSD-CPAMCHC--EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSF---------------------EHLNSLTSLN---LASNPFNCNCHLAWFAEWLRKKSLNGG-AARCGAPSKVRDVQIKDLPHSEFKCSS-------ENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQI-HYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPG---IARCAEPEQMKDKLILSTPSSSFVCRGRVRN 926

HSP 5 Score: 167.548 bits (423), Expect = 1.06117e-40
Identity = 125/494 (25.30%), Postives = 221/494 (44.74%), Query Frame = 3
Query: 6180 IPKISCPKNCTCTPEVVDCNGAHLTTIP-------------------------------------DNM-----------LPSTKVVILSYNKLKEIXXXXXXXXXXXXIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 7445
I + CP+ C+CT VDC+ LT++P DN L S + + L+ N+LK I + + + +L+++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 6 Score: 167.548 bits (423), Expect = 1.06117e-40
Identity = 125/494 (25.30%), Postives = 221/494 (44.74%), Query Frame = -3
Query: 2032 IPKISCPKNCTCTPEVVDCNGAHLTTIP-------------------------------------DNM-----------LPSTKVVILSYNKLKEIXXXXXXXXXXXLIKIDLSYNEIDHIEADIFMKNSRLKEINLNSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNRNPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYFLCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKC 3297
I + CP+ C+CT VDC+ LT++P DN L S + + L+ N+LK I + + + +L+++D+S N I + +F L+ + L++N++ C++ F+ L +LE L L++N + + F ++ L L+ NP C+C L W+S + R+ L +T CQSP+ L+G V+ L ++ F C +A EC CP C+C VDC L +P +P +TTEL L++N + +L SF L+ + LS N I+ + + L+ L+ L TLV+ NK++ CI ++AF+ L +L +L L N++ ++ G F ++++ + L +NPF CDCN++WL + + ++ + C SP+ M + I + F C+ + ++ +C
Sbjct: 68 ITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRS-ATRLAPYTR--CQSPSQLKGQNVADLHDQEFKCSGLTEHAPM--------------------ECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGEC 537

HSP 7 Score: 108.612 bits (270), Expect = 7.91214e-23
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = 3
Query: 6849 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 7472
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L ++ N+L+ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324

HSP 8 Score: 108.612 bits (270), Expect = 7.91214e-23
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = -3
Query: 2005 TTKRCPTKCKCEGTKVDCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYNGITELNKNVLTPLRSLETLVVSFNKLQ------------------------------------------------CIDREAFKGLTNLKVLILQSNDVATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCK 2628
T RCP C C G VDCS L +P+ I + L L NNL + E+ F+ L L+ L L+ N I + +N L SLE L ++ N+L+ C+D AFKGL L++L L +N++ ++P F L L + L NPF CDC++ WL++F + C SP +K +++ +F C+ T+ A + + PC+
Sbjct: 69 TEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR 324
The following BLAST results are available for this feature:
BLAST of slit vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|33302576|sp|P24014|SLIT_DROME1.051250e-7831.34RecName: Full=Protein slit; Short=dSlit; Contains:... [more]
gi|341942041|sp|Q9WVB4|SLIT3_MOUSE2.635030e-8832.09RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|45477220|sp|O88280|SLIT3_RAT1.636770e-8731.85RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|311033528|sp|O75094|SLIT3_HUMAN1.510170e-8631.32RecName: Full=Slit homolog 3 protein; Short=Slit-3... [more]
gi|45477219|sp|O88279|SLIT1_RAT0.000000e+031.31RecName: Full=Slit homolog 1 protein; Short=Slit-1... [more]
back to top
BLAST of slit vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150367780.000000e+062.34dd_smedV4_12111_0_1|m.4973|m.1592[more]
SMU150063174.712810e-3335.82SmedAsxldir_c107934_g5_i1|m.86273|m.14433[more]
SMU150061401.024460e-3030.64SmedAsxldir_c107649_g2_i1|m.84323|m.17798[more]
SMU150371147.010760e-3034.65dd_smedV4_13823_0_1|m.8312|m.39635[more]
SMU150261923.720930e-2334.45SmedSxldir_c80425_g1_i1|m.21927|m.13931[more]
back to top
BLAST of slit vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|11321571|ref|NP_003053.1|3.400930e-8731.32slit homolog 3 protein isoform 2 precursor [Homo s... [more]
gi|429836873|ref|NP_001258875.1|5.080010e-8731.20slit homolog 3 protein isoform 1 precursor [Homo s... [more]
gi|574281850|ref|NP_001276064.1|0.000000e+034.54slit homolog 2 protein isoform 2 precursor [Homo s... [more]
gi|530376407|ref|XP_005248268.1|0.000000e+034.37PREDICTED: slit homolog 2 protein isoform X1 [Homo... [more]
gi|188528675|ref|NP_003052.2|0.000000e+031.48slit homolog 1 protein precursor [Homo sapiens][more]
back to top
BLAST of slit vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17136484|ref|NP_476729.1|7.955530e-8031.94slit, isoform B [Drosophila melanogaster][more]
gi|17136482|ref|NP_476728.1|7.487620e-8031.71slit, isoform A [Drosophila melanogaster][more]
gi|161077130|ref|NP_001097333.1|7.487620e-8031.71slit, isoform D [Drosophila melanogaster][more]
gi|17136480|ref|NP_476727.1|1.213520e-7931.34slit, isoform C [Drosophila melanogaster][more]
gi|161077132|ref|NP_001097334.1|1.213520e-7931.34slit, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_017648 ID=Pmo_017648|Name=slit|organism=Phagocata morgani|type=mRNA|length=9476bp
CACAGAGGTAACTACGCCAAGTTTAAAGAGAACTGAAATGCAATAAAATA
ATAAATACCGCTGATACAATGAATTACATGACTAAGCGAGGAAGAAAATA
ATCAAATGTGATTGATAAAAATCCGTATTGATGAATTTCGTTCGTGAGAA
TATTTGTAAGTTTCTTTGATCTCATTTACTGGTACAATTAGGCAGACATT
TACAGCGTCTAACAAAATGAACCACTCGAAAATATTGACGGCCCGAGTCA
CATTTGAAATCAATTCGTCGAGTTCGAAATTTATAGGGCTGACAGCAACG
AGAAGAACCTGTATCGACGGGTCTGTGAAAGAAACTTTTCTGAATATCGG
ACTGCATCTTTGAGTCTTGGCAGGATCCTTCGCAATATCTGTATCGCACT
GTCTTTAAAGACAAACAGGTCGTATCCGGGTCCTTGATGTGGTTTTTGAT
CATTTTACGACGACACATGTATGCTTTTCTATTACATGATTTTCCAGAAA
ATCCATCCTTGCAGATACATTTGAACTTTTTCTTTCCATCATTAACTGCT
TGGCAAACTCCTCCATTCTTACAAATCTCCGGCTCACTGCACACGTCAGA
TACACTGACCGGTGTCGAAGATACCGTCTGAAGGTCGGTCTTAGCGACAT
CCGTGACCAATTTATTGAATGACTCCTGAGCAACGTCTCTGCAGCCTGGC
TTCACATTTACTGATCGCGTCATAAATTTCAAAAAATCAATCTTCTTCTG
GTTAATCTCCAAGGATTGCAGACAACCGATGAAGTAAGTGTTGCTTTCCA
AGTGGTACTTTGATAATGCTGTCTCTAGAATTAGTTTCGGTGCACCGCCA
ATGAAGATGCCACTGCTAAGAGCTAAGTACCGATTGCCCGATGAATAACT
CGACTTCAAGGTGCAATGGAATCGACCATCCAAGTACATCGTCAGATTTT
CACCGATTATTTCAATTTCCAGAGAATGGGATCGACTGTCATTGATACTA
TTCATTGAATATCCCTCTGGGCCAATGACCTTGTCACCGATATTATACCC
GATTCTCACGTGACCCCGATAAAGATTGACCGATAAATATTTCCGATCGA
ATCCTTGATAAAGAAGCAGACCCGACGACGAATTTGTAGAAAATCGAAGC
GTGATATTTCCCCGTGGCATAAGAAATCCGCGTGAAGGTGGTGAGATCTC
AATGTACGATTCTTTGGCAAAATAAAGACTGTCCAGATGCTGACACTGTT
GACCAGAGTAACCTGATTTACATTGACAGAACGACTTCTGGTCTGCACTG
ACGCAGACCCCTTCGTTCAGACATTGATGGTATGCACACACCGATTCGGA
GATGACTTCGTTACCGGGATTATCGCTTTTCCCGGCGGACGAAAACCTCT
GAATCTCGCGTCGGGACATGCTCATCTTCATGGCTGGCGGCTTCCATGCC
GCTTCATCGCAAAATTTCCCCTTGTATCCGGGCCTGCATTTGCACTCATA
TCCGTTGACCAGATCGACGCATTGGGCATTGTTGCGGCACTCGTTGTACT
TGCAGTCGTCGATGTTTTCATCGCAGTTCTTGCCCAGCCAACCGAGAGAG
CAAACACAGCGATAATCATTATTTGGTAATTGATGACATGAACCGGTGTT
ATTGCAAGGGTTTACGTCAGTGCAGTATGTAAATTTAAGATGGCAATATT
GTCCTCTATATCCAGTCCTACAGTCACAACCGTATCCATTAACCCTGTCC
ACGCACGTACCACCATTTTCACACTTATTATTCACGCAGTCGTCGATATT
TTCATTACACTTCGGCCCCCGGAAACCGACCGGACAAACGCATTCATAAT
TGCCGTAATTGTCCACATTCTTACAAATTCCTCCGTTTTTACACGGATGC
CCGAAACAGGCATTGATCCTCTTCTCACAATTCTTCCCATGGAACGGATG
TGGACACTGGCATTTGTACTGATGATGTGTGATCAGGGAACATTTCCCAT
TGTGTTTGCACGGACTCCGGATACAAGCATCACATTTGGCGGTGATATAC
GCATCGTCTGTCTCCTCGTTGCACGTGAAATCTGTCGGTTTCGAGTGGTA
GATCGATTTCAATTTCATATTCTCGGGACTGGCACATAGGGAGATTCCGT
TGTCGAGGAATCGTTCCATGAAGAATTGATTCAACCATTTTATGTTACAG
TCGCAATGGAATGGATTTTGACCCAATGCAATATTGTTCAGATTTCTAAG
GTCTCTAAATGCGCCGAAGGGTATCGTTGCCACGTCGTTGCTTTGTAAAA
TTAACACTTTCAAATTAGTTAACCCTTTGAATGCTTCACGGTCAATACAC
TGTAACTTGTTGAAGCTCACCACCAATGTCTCAAGGCTTCGCAGAGGAGT
TAGAACATTCTTGTTGAGCTCCGTAATTCCATTATAACTCAGCACTAACG
TTTTGAGATTTTCTAGATGTTTAAATGATGATTCATTGAGCTGGTTGAGA
TTATTTCTGTCAAGGTACAGCTCAGTGGTGTTAATTGGTATCCCCTTCGG
AATATCTCCAAGTTGAATCCAGCTGCAGTCGACCTTCGTCCCTTCACATT
TGCATTTAGTTGGACACCGCTTGGTAGTGTGGCATTCTGGTTTAGAAATA
GAACAGCAAGAATTTTCAGATCTCATTCCATTGGTGCATTCCGCTGTGGC
AGAGGCATTTGTGACATTCTCCCGACACAGAAAATATTTCTCATCCAAAC
TCGAAACTGCTGTACCCTGCAGAGCAGCAGGACTTTGACAGAGCACGGCA
GTATGGGCGCCAAGCGTTGCGTAATGAGTCCTGGCCCATTCGGAGATCCA
TTTTAGTTGACAATTACAATGTAAAGGATTTCTATTCAACGTTAAATGTT
TGATATTTTTATTCTCCTGAAATGAGCCTTCTACGATACATTGAATTAAA
TTGTCACTGAGTTTCAATGTCTCCAAATCGTATAAATTTCGAAATGTCTG
ATTGTTGATGCATTTCAGTTTGTTGGAGTTGAGATTTATTTCTTTGAGTC
TTGAATTTTTCATGAAGATATCGGCTTCGATGTGGTCTATTTCGTTGTAC
GACAAGTCTATTTTAATCAAATTTGGAAGTGCCAAAAGCGGAGAAGAATT
GCTTATTTCTTTCAGTTTATTGTAAGACAGAATCACGACTTTCGTAGACG
GTAGCATATTATCTGGAATAGTCGTCAGGTGGGCCCCATTGCAGTCAACT
ACTTCCGGTGTGCACGTACAGTTTTTTGGACAGCTGATTTTCGGTATGCA
GTCTTCGTCATGTGACTCTGACTCGGCCTCTTCATCTTGACCGCAATTAA
ACTGATACGATTGCACGCCTCTGACCGGTTGGCCGTGGAGATTCTTGGGC
AACAGACATGAGGCCACAGGACTACCACTTGCTTCCTTAAATCGTAGAAA
CTCGGCTAACCAGCTCAATTTACAGTTGCAATTCAATGGATTATGCACAA
GATATAAATATCGAAGTTTTGTGAGAGGATCAAGAGTCTCTTTTTTCAGT
GTCGTCAGTTTATTTTCCGATAAATGTAATAAATATAATTTTGAAAGACC
AACAAAAGTATCGCGAGGTAGACATTCGATATCGTTATTGTGAATATATA
AAAACATCAGTGAAGATAATCCCAAGAGAGCATTTTTGCGAATGGACTTG
AGCTTGTTACCGTTTAGGTACAAAGAAGTCAGCTGTCTAAGACCTTCAAA
TGCTCCCGGCTCAATGTCGGTCATTTCATTACTATTTAGCAGTATTTTTT
TCAAATTCTTATATTTTGATAATGCATTCTGCTTCAGAACATTAATGGCA
TTATCGTGTAAATCTAATTCAATGATACTGGTGGGCAAATCCTGGGGAAC
AGTCTTTATTCCTCTACCTACGCACTTGACAATGCCCTCGGTAGAACAAA
TACAATGCTTGGAACATAGCTTCTTCTTTGGTTGACAAATGTTCTCTAAA
CTGTTCTTACTGTCGCTTGCACATTGGAACTCGTAGGAACTGAGACTCGA
TATTGGAATTTGAGACAAACGAAAAGGGGTTGCACAGAGAACTGACTGAG
GATTAGGCTTAATAACTTGAGGCTGATGCTTGATGAAACGATTTAGCCAT
GCCAGATGACAATTGCAGTTCAGTTTATTGGTTGCGATGTGCAAAGTCTC
CAGATTCTTCAGCCGTGAAATATCTTCTGCGATCCAAAATATTTTATTTC
GATCTAAATATAAATTCTTCAAATTATCAAGACCAGTCAGTACATTTTCA
TTGACACACTGCAACTGATTATCTCGAAGATCTAATTTCTGAAGGTTTTT
TAATTTAGAGAACAGCCCATCGGGAAGATATTGAATAAGATTTCGATTTA
ATCTCAATTTCGTCAATTGAGTTAACATATCAAATGTTCCAGCCTCAATA
GAGGTGATTCTGTTGTTGGATAATTGTAATATTTTGAGATTTATCACTTT
GGAGAAATCAGATTTTCTAATGACATTAATGCGGTTCCCAAGCAGATTCA
ATTTAACAGTCTTCTCTGGAAGAGATTCGGGAACATTTCTCAATAGTCGA
TGCTTACATTCCATTGAGTAACTGTCACATTGACAACCATTTGGACATGT
GTTTGTATTTTCTATTGTATCATGATACCATGTATTCGAATATGATTGAC
ATATTGAGAAAAATAATAATAATAATGCAAAAAATAAATTTATTTTTTGC
ATTATTATTATTATTTTTCTCAATATGTCAATCATATTCGAATACATGGT
ATCATGATACAATAGAAAATACAAACACATGTCCAAATGGTTGTCAATGT
GACAGTTACTCAATGGAATGTAAGCATCGACTATTGAGAAATGTTCCCGA
ATCTCTTCCAGAGAAGACTGTTAAATTGAATCTGCTTGGGAACCGCATTA
ATGTCATTAGAAAATCTGATTTCTCCAAAGTGATAAATCTCAAAATATTA
CAATTATCCAACAACAGAATCACCTCTATTGAGGCTGGAACATTTGATAT
GTTAACTCAATTGACGAAATTGAGATTAAATCGAAATCTTATTCAATATC
TTCCCGATGGGCTGTTCTCTAAATTAAAAAACCTTCAGAAATTAGATCTT
CGAGATAATCAGTTGCAGTGTGTCAATGAAAATGTACTGACTGGTCTTGA
TAATTTGAAGAATTTATATTTAGATCGAAATAAAATATTTTGGATCGCAG
AAGATATTTCACGGCTGAAGAATCTGGAGACTTTGCACATCGCAACCAAT
AAACTGAACTGCAATTGTCATCTGGCATGGCTAAATCGTTTCATCAAGCA
TCAGCCTCAAGTTATTAAGCCTAATCCTCAGTCAGTTCTCTGTGCAACCC
CTTTTCGTTTGTCTCAAATTCCAATATCGAGTCTCAGTTCCTACGAGTTC
CAATGTGCAAGCGACAGTAAGAACAGTTTAGAGAACATTTGTCAACCAAA
GAAGAAGCTATGTTCCAAGCATTGTATTTGTTCTACCGAGGGCATTGTCA
AGTGCGTAGGTAGAGGAATAAAGACTGTTCCCCAGGATTTGCCCACCAGT
ATCATTGAATTAGATTTACACGATAATGCCATTAATGTTCTGAAGCAGAA
TGCATTATCAAAATATAAGAATTTGAAAAAAATACTGCTAAATAGTAATG
AAATGACCGACATTGAGCCGGGAGCATTTGAAGGTCTTAGACAGCTGACT
TCTTTGTACCTAAACGGTAACAAGCTCAAGTCCATTCGCAAAAATGCTCT
CTTGGGATTATCTTCACTGATGTTTTTATATATTCACAATAACGATATCG
AATGTCTACCTCGCGATACTTTTGTTGGTCTTTCAAAATTATATTTATTA
CATTTATCGGAAAATAAACTGACGACACTGAAAAAAGAGACTCTTGATCC
TCTCACAAAACTTCGATATTTATATCTTGTGCATAATCCATTGAATTGCA
ACTGTAAATTGAGCTGGTTAGCCGAGTTTCTACGATTTAAGGAAGCAAGT
GGTAGTCCTGTGGCCTCATGTCTGTTGCCCAAGAATCTCCACGGCCAACC
GGTCAGAGGCGTGCAATCGTATCAGTTTAATTGCGGTCAAGATGAAGAGG
CCGAGTCAGAGTCACATGACGAAGACTGCATACCGAAAATCAGCTGTCCA
AAAAACTGTACGTGCACACCGGAAGTAGTTGACTGCAATGGGGCCCACCT
GACGACTATTCCAGATAATATGCTACCGTCTACGAAAGTCGTGATTCTGT
CTTACAATAAACTGAAAGAAATAAGCAATTCTTCTCCGCTTTTGGCACTT
CCAAATTTGATTAAAATAGACTTGTCGTACAACGAAATAGACCACATCGA
AGCCGATATCTTCATGAAAAATTCAAGACTCAAAGAAATAAATCTCAACT
CCAACAAACTGAAATGCATCAACAATCAGACATTTCGAAATTTATACGAT
TTGGAGACATTGAAACTCAGTGACAATTTAATTCAATGTATCGTAGAAGG
CTCATTTCAGGAGAATAAAAATATCAAACATTTAACGTTGAATAGAAATC
CTTTACATTGTAATTGTCAACTAAAATGGATCTCCGAATGGGCCAGGACT
CATTACGCAACGCTTGGCGCCCATACTGCCGTGCTCTGTCAAAGTCCTGC
TGCTCTGCAGGGTACAGCAGTTTCGAGTTTGGATGAGAAATATTTTCTGT
GTCGGGAGAATGTCACAAATGCCTCTGCCACAGCGGAATGCACCAATGGA
ATGAGATCTGAAAATTCTTGCTGTTCTATTTCTAAACCAGAATGCCACAC
TACCAAGCGGTGTCCAACTAAATGCAAATGTGAAGGGACGAAGGTCGACT
GCAGCTGGATTCAACTTGGAGATATTCCGAAGGGGATACCAATTAACACC
ACTGAGCTGTACCTTGACAGAAATAATCTCAACCAGCTCAATGAATCATC
ATTTAAACATCTAGAAAATCTCAAAACGTTAGTGCTGAGTTATAATGGAA
TTACGGAGCTCAACAAGAATGTTCTAACTCCTCTGCGAAGCCTTGAGACA
TTGGTGGTGAGCTTCAACAAGTTACAGTGTATTGACCGTGAAGCATTCAA
AGGGTTAACTAATTTGAAAGTGTTAATTTTACAAAGCAACGACGTGGCAA
CGATACCCTTCGGCGCATTTAGAGACCTTAGAAATCTGAACAATATTGCA
TTGGGTCAAAATCCATTCCATTGCGACTGTAACATAAAATGGTTGAATCA
ATTCTTCATGGAACGATTCCTCGACAACGGAATCTCCCTATGTGCCAGTC
CCGAGAATATGAAATTGAAATCGATCTACCACTCGAAACCGACAGATTTC
ACGTGCAACGAGGAGACAGACGATGCGTATATCACCGCCAAATGTGATGC
TTGTATCCGGAGTCCGTGCAAACACAATGGGAAATGTTCCCTGATCACAC
ATCATCAGTACAAATGCCAGTGTCCACATCCGTTCCATGGGAAGAATTGT
GAGAAGAGGATCAATGCCTGTTTCGGGCATCCGTGTAAAAACGGAGGAAT
TTGTAAGAATGTGGACAATTACGGCAATTATGAATGCGTTTGTCCGGTCG
GTTTCCGGGGGCCGAAGTGTAATGAAAATATCGACGACTGCGTGAATAAT
AAGTGTGAAAATGGTGGTACGTGCGTGGACAGGGTTAATGGATACGGTTG
TGACTGTAGGACTGGATATAGAGGACAATATTGCCATCTTAAATTTACAT
ACTGCACTGACGTAAACCCTTGCAATAACACCGGTTCATGTCATCAATTA
CCAAATAATGATTATCGCTGTGTTTGCTCTCTCGGTTGGCTGGGCAAGAA
CTGCGATGAAAACATCGACGACTGCAAGTACAACGAGTGCCGCAACAATG
CCCAATGCGTCGATCTGGTCAACGGATATGAGTGCAAATGCAGGCCCGGA
TACAAGGGGAAATTTTGCGATGAAGCGGCATGGAAGCCGCCAGCCATGAA
GATGAGCATGTCCCGACGCGAGATTCAGAGGTTTTCGTCCGCCGGGAAAA
GCGATAATCCCGGTAACGAAGTCATCTCCGAATCGGTGTGTGCATACCAT
CAATGTCTGAACGAAGGGGTCTGCGTCAGTGCAGACCAGAAGTCGTTCTG
TCAATGTAAATCAGGTTACTCTGGTCAACAGTGTCAGCATCTGGACAGTC
TTTATTTTGCCAAAGAATCGTACATTGAGATCTCACCACCTTCACGCGGA
TTTCTTATGCCACGGGGAAATATCACGCTTCGATTTTCTACAAATTCGTC
GTCGGGTCTGCTTCTTTATCAAGGATTCGATCGGAAATATTTATCGGTCA
ATCTTTATCGGGGTCACGTGAGAATCGGGTATAATATCGGTGACAAGGTC
ATTGGCCCAGAGGGATATTCAATGAATAGTATCAATGACAGTCGATCCCA
TTCTCTGGAAATTGAAATAATCGGTGAAAATCTGACGATGTACTTGGATG
GTCGATTCCATTGCACCTTGAAGTCGAGTTATTCATCGGGCAATCGGTAC
TTAGCTCTTAGCAGTGGCATCTTCATTGGCGGTGCACCGAAACTAATTCT
AGAGACAGCATTATCAAAGTACCACTTGGAAAGCAACACTTACTTCATCG
GTTGTCTGCAATCCTTGGAGATTAACCAGAAGAAGATTGATTTTTTGAAA
TTTATGACGCGATCAGTAAATGTGAAGCCAGGCTGCAGAGACGTTGCTCA
GGAGTCATTCAATAAATTGGTCACGGATGTCGCTAAGACCGACCTTCAGA
CGGTATCTTCGACACCGGTCAGTGTATCTGACGTGTGCAGTGAGCCGGAG
ATTTGTAAGAATGGAGGAGTTTGCCAAGCAGTTAATGATGGAAAGAAAAA
GTTCAAATGTATCTGCAAGGATGGATTTTCTGGAAAATCATGTAATAGAA
AAGCATACATGTGTCGTCGTAAAATGATCAAAAACCACATCAAGGACCCG
GATACGACCTGTTTGTCTTTAAAGACAGTGCGATACAGATATTGCGAAGG
ATCCTGCCAAGACTCAAAGATGCAGTCCGATATTCAGAAAAGTTTCTTTC
ACAGACCCGTCGATACAGGTTCTTCTCGTTGCTGTCAGCCCTATAAATTT
CGAACTCGACGAATTGATTTCAAATGTGACTCGGGCCGTCAATATTTTCG
AGTGGTTCATTTTGTTAGACGCTGTAAATGTCTGCCTAATTGTACCAGTA
AATGAGATCAAAGAAACTTACAAATATTCTCACGAACGAAATTCATCAAT
ACGGATTTTTATCAATCACATTTGATTATTTTCTTCCTCGCTTAGTCATG
TAATTCATTGTATCAGCGGTATTTATTATTTTATTGCATTTCAGTTCTCT
TTAAACTTGGCGTAGTTACCTCTGTG

Design Primers for slit

back to top

protein sequence

>Pmo_017648-protein ID=Pmo_017648-protein|Name=slit|organism=Phagocata morgani|type=polypeptide|length=1553bp
MCLYFLLYHDTMYSNMIDILRKIIIIMQKINLFFALLLLFFSICQSYSNT
WYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNR
INVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQ
YLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWI
AEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCA
TPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGI
VKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNS
NEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNND
IECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLN
CNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQDE
EAESESHDEDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVI
LSYNKLKEISNSSPLLALPNLIKIDLSYNEIDHIEADIFMKNSRLKEINL
NSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNR
NPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYF
LCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKV
DCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYN
GITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDV
ATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCA
SPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLI
THHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCP
VGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKF
TYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRN
NAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAG
KSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLD
SLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLS
VNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYL
DGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYF
IGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDL
QTVSSTPVSVSDVCSEPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCN
RKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSF
FHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNCT
SK*
back to top

coding sequence

>Pmo_017648.4647.9305 ID=Pmo_017648.4647.9305|Name=Pmo_017648.4647.9305|organism=Phagocata morgani|type=CDS|length=4659bp
ATGTGTTTGTATTTTCTATTGTATCATGATACCATGTATTCGAATATGAT
TGACATATTGAGAAAAATAATAATAATAATGCAAAAAATAAATTTATTTT
TTGCATTATTATTATTATTTTTCTCAATATGTCAATCATATTCGAATACA
TGGTATCATGATACAATAGAAAATACAAACACATGTCCAAATGGTTGTCA
ATGTGACAGTTACTCAATGGAATGTAAGCATCGACTATTGAGAAATGTTC
CCGAATCTCTTCCAGAGAAGACTGTTAAATTGAATCTGCTTGGGAACCGC
ATTAATGTCATTAGAAAATCTGATTTCTCCAAAGTGATAAATCTCAAAAT
ATTACAATTATCCAACAACAGAATCACCTCTATTGAGGCTGGAACATTTG
ATATGTTAACTCAATTGACGAAATTGAGATTAAATCGAAATCTTATTCAA
TATCTTCCCGATGGGCTGTTCTCTAAATTAAAAAACCTTCAGAAATTAGA
TCTTCGAGATAATCAGTTGCAGTGTGTCAATGAAAATGTACTGACTGGTC
TTGATAATTTGAAGAATTTATATTTAGATCGAAATAAAATATTTTGGATC
GCAGAAGATATTTCACGGCTGAAGAATCTGGAGACTTTGCACATCGCAAC
CAATAAACTGAACTGCAATTGTCATCTGGCATGGCTAAATCGTTTCATCA
AGCATCAGCCTCAAGTTATTAAGCCTAATCCTCAGTCAGTTCTCTGTGCA
ACCCCTTTTCGTTTGTCTCAAATTCCAATATCGAGTCTCAGTTCCTACGA
GTTCCAATGTGCAAGCGACAGTAAGAACAGTTTAGAGAACATTTGTCAAC
CAAAGAAGAAGCTATGTTCCAAGCATTGTATTTGTTCTACCGAGGGCATT
GTCAAGTGCGTAGGTAGAGGAATAAAGACTGTTCCCCAGGATTTGCCCAC
CAGTATCATTGAATTAGATTTACACGATAATGCCATTAATGTTCTGAAGC
AGAATGCATTATCAAAATATAAGAATTTGAAAAAAATACTGCTAAATAGT
AATGAAATGACCGACATTGAGCCGGGAGCATTTGAAGGTCTTAGACAGCT
GACTTCTTTGTACCTAAACGGTAACAAGCTCAAGTCCATTCGCAAAAATG
CTCTCTTGGGATTATCTTCACTGATGTTTTTATATATTCACAATAACGAT
ATCGAATGTCTACCTCGCGATACTTTTGTTGGTCTTTCAAAATTATATTT
ATTACATTTATCGGAAAATAAACTGACGACACTGAAAAAAGAGACTCTTG
ATCCTCTCACAAAACTTCGATATTTATATCTTGTGCATAATCCATTGAAT
TGCAACTGTAAATTGAGCTGGTTAGCCGAGTTTCTACGATTTAAGGAAGC
AAGTGGTAGTCCTGTGGCCTCATGTCTGTTGCCCAAGAATCTCCACGGCC
AACCGGTCAGAGGCGTGCAATCGTATCAGTTTAATTGCGGTCAAGATGAA
GAGGCCGAGTCAGAGTCACATGACGAAGACTGCATACCGAAAATCAGCTG
TCCAAAAAACTGTACGTGCACACCGGAAGTAGTTGACTGCAATGGGGCCC
ACCTGACGACTATTCCAGATAATATGCTACCGTCTACGAAAGTCGTGATT
CTGTCTTACAATAAACTGAAAGAAATAAGCAATTCTTCTCCGCTTTTGGC
ACTTCCAAATTTGATTAAAATAGACTTGTCGTACAACGAAATAGACCACA
TCGAAGCCGATATCTTCATGAAAAATTCAAGACTCAAAGAAATAAATCTC
AACTCCAACAAACTGAAATGCATCAACAATCAGACATTTCGAAATTTATA
CGATTTGGAGACATTGAAACTCAGTGACAATTTAATTCAATGTATCGTAG
AAGGCTCATTTCAGGAGAATAAAAATATCAAACATTTAACGTTGAATAGA
AATCCTTTACATTGTAATTGTCAACTAAAATGGATCTCCGAATGGGCCAG
GACTCATTACGCAACGCTTGGCGCCCATACTGCCGTGCTCTGTCAAAGTC
CTGCTGCTCTGCAGGGTACAGCAGTTTCGAGTTTGGATGAGAAATATTTT
CTGTGTCGGGAGAATGTCACAAATGCCTCTGCCACAGCGGAATGCACCAA
TGGAATGAGATCTGAAAATTCTTGCTGTTCTATTTCTAAACCAGAATGCC
ACACTACCAAGCGGTGTCCAACTAAATGCAAATGTGAAGGGACGAAGGTC
GACTGCAGCTGGATTCAACTTGGAGATATTCCGAAGGGGATACCAATTAA
CACCACTGAGCTGTACCTTGACAGAAATAATCTCAACCAGCTCAATGAAT
CATCATTTAAACATCTAGAAAATCTCAAAACGTTAGTGCTGAGTTATAAT
GGAATTACGGAGCTCAACAAGAATGTTCTAACTCCTCTGCGAAGCCTTGA
GACATTGGTGGTGAGCTTCAACAAGTTACAGTGTATTGACCGTGAAGCAT
TCAAAGGGTTAACTAATTTGAAAGTGTTAATTTTACAAAGCAACGACGTG
GCAACGATACCCTTCGGCGCATTTAGAGACCTTAGAAATCTGAACAATAT
TGCATTGGGTCAAAATCCATTCCATTGCGACTGTAACATAAAATGGTTGA
ATCAATTCTTCATGGAACGATTCCTCGACAACGGAATCTCCCTATGTGCC
AGTCCCGAGAATATGAAATTGAAATCGATCTACCACTCGAAACCGACAGA
TTTCACGTGCAACGAGGAGACAGACGATGCGTATATCACCGCCAAATGTG
ATGCTTGTATCCGGAGTCCGTGCAAACACAATGGGAAATGTTCCCTGATC
ACACATCATCAGTACAAATGCCAGTGTCCACATCCGTTCCATGGGAAGAA
TTGTGAGAAGAGGATCAATGCCTGTTTCGGGCATCCGTGTAAAAACGGAG
GAATTTGTAAGAATGTGGACAATTACGGCAATTATGAATGCGTTTGTCCG
GTCGGTTTCCGGGGGCCGAAGTGTAATGAAAATATCGACGACTGCGTGAA
TAATAAGTGTGAAAATGGTGGTACGTGCGTGGACAGGGTTAATGGATACG
GTTGTGACTGTAGGACTGGATATAGAGGACAATATTGCCATCTTAAATTT
ACATACTGCACTGACGTAAACCCTTGCAATAACACCGGTTCATGTCATCA
ATTACCAAATAATGATTATCGCTGTGTTTGCTCTCTCGGTTGGCTGGGCA
AGAACTGCGATGAAAACATCGACGACTGCAAGTACAACGAGTGCCGCAAC
AATGCCCAATGCGTCGATCTGGTCAACGGATATGAGTGCAAATGCAGGCC
CGGATACAAGGGGAAATTTTGCGATGAAGCGGCATGGAAGCCGCCAGCCA
TGAAGATGAGCATGTCCCGACGCGAGATTCAGAGGTTTTCGTCCGCCGGG
AAAAGCGATAATCCCGGTAACGAAGTCATCTCCGAATCGGTGTGTGCATA
CCATCAATGTCTGAACGAAGGGGTCTGCGTCAGTGCAGACCAGAAGTCGT
TCTGTCAATGTAAATCAGGTTACTCTGGTCAACAGTGTCAGCATCTGGAC
AGTCTTTATTTTGCCAAAGAATCGTACATTGAGATCTCACCACCTTCACG
CGGATTTCTTATGCCACGGGGAAATATCACGCTTCGATTTTCTACAAATT
CGTCGTCGGGTCTGCTTCTTTATCAAGGATTCGATCGGAAATATTTATCG
GTCAATCTTTATCGGGGTCACGTGAGAATCGGGTATAATATCGGTGACAA
GGTCATTGGCCCAGAGGGATATTCAATGAATAGTATCAATGACAGTCGAT
CCCATTCTCTGGAAATTGAAATAATCGGTGAAAATCTGACGATGTACTTG
GATGGTCGATTCCATTGCACCTTGAAGTCGAGTTATTCATCGGGCAATCG
GTACTTAGCTCTTAGCAGTGGCATCTTCATTGGCGGTGCACCGAAACTAA
TTCTAGAGACAGCATTATCAAAGTACCACTTGGAAAGCAACACTTACTTC
ATCGGTTGTCTGCAATCCTTGGAGATTAACCAGAAGAAGATTGATTTTTT
GAAATTTATGACGCGATCAGTAAATGTGAAGCCAGGCTGCAGAGACGTTG
CTCAGGAGTCATTCAATAAATTGGTCACGGATGTCGCTAAGACCGACCTT
CAGACGGTATCTTCGACACCGGTCAGTGTATCTGACGTGTGCAGTGAGCC
GGAGATTTGTAAGAATGGAGGAGTTTGCCAAGCAGTTAATGATGGAAAGA
AAAAGTTCAAATGTATCTGCAAGGATGGATTTTCTGGAAAATCATGTAAT
AGAAAAGCATACATGTGTCGTCGTAAAATGATCAAAAACCACATCAAGGA
CCCGGATACGACCTGTTTGTCTTTAAAGACAGTGCGATACAGATATTGCG
AAGGATCCTGCCAAGACTCAAAGATGCAGTCCGATATTCAGAAAAGTTTC
TTTCACAGACCCGTCGATACAGGTTCTTCTCGTTGCTGTCAGCCCTATAA
ATTTCGAACTCGACGAATTGATTTCAAATGTGACTCGGGCCGTCAATATT
TTCGAGTGGTTCATTTTGTTAGACGCTGTAAATGTCTGCCTAATTGTACC
AGTAAATGA
back to top
Gene Groups
slit is similar in sequence to the genes of this group: GG9051
Gene NameGene ID
SMU15036778SMU15036778
slitDdo_016416
slitGsp_007744
slitPgr_016847
slitPmo_017648

Gene Group Protein Sequences

>SMU15036778

MIFIFKDITFKFLLVLLSSLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPVILQEKTTRLNLLGNRINVIRKSDFLKLNNLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQL
QCINDNIFNKLGMLKYLLLEGNKIFWISEAISKLKHLKELRIHKNKLNCN
CHLAWLNWFLKQKSNIIKPGAHSVLCSTPFRLSHIPISSLSSYEFQCASE
DKANLENMCPSDKKVCSKKCNCSHDGIVKCVGKRLSNIPQDLPTNVVELD
LKDNNITILQQGYLSKYKFLKKIILTRNGMVDIEPGAFLGLTQLTSIYLN
ENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSEN
KLTSLKKETFKPFLNLRYLYLVHNPLNCDCRMSWIVDYIKDKETNTPVAA
CLQPRNLQGTPLRNLQIYNFQCNKEFESKYETHDEECVPKVSCPLKCTCS
SDVVNCSNSGLMSLPESIFPSTKTLIMSHNNLKKLPPIYSIHEAPNLMKL
DLSFNQIETLEPDVFTRSSKLREINLNSNRLKCINNETFKNLKELEILQL
SENAISCIVTDSFKNNLNLKYLMLNKNQFHCDCKLKWMSEWSRNHYTVLG
NHRLPTCQSPIILKDTPITHLDDKYFLCDGNASVYHSVDSCHETNSVKTC
CSIGNEECTKSKKCPSKCKCESTKVDCSDLQLKEIPNEIPKDTTELYLDR
NHLQSLNETSFKNLLNLKTLVLSYNGITELNKNVLTPLKSLETLVLSFNK
LQCIHQDAFKNLHNLKVLILQSNDVSTIPYQAFNDLKNLNNIALGQNPFH
CDCNIKWLNQFFLDRFLDNGISLCASPEKMKLKSIYHSKPTDFICSEETE
DAYITAKCDSCMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINAC
FGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGAT
CNDLNNSYSCKCQSGFRGKYCDIKFLYCNDINPCQNSGQCQLLPNNDYKC
VCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHNDYKCMCRPGYIGKFCE
IPAWKPTVLKTLISRRDINQSEMTYENLENEVISESVCAYHECLNNGICI
NGDQNKNQKSYCKCKPGYSGHLCQYLNSIYFQKNSYIEISPPSRGFLMPR
GNISLNFMTNSSSGLILYQGSEQTYLVVNLYQGHLRISYNLGDKVVGPEG
YSMGMVNDSRLHALHIEIVGENLTMYLNGRVHCTLKSKYLNSNRYMALDT
GIFIGGAPHKILQSAIMKFHIETDSEFIGCMESLLINRKKIDFSKYLPKS
INVHPGCGKLISTVVASDLKIPSIMQPIKQILTQTTKKKPNNVCKRPGIC
KNQGVCEVLPGSKKKFRCICKNGFVGRKCKKRKSMCHGTFTESHIVDPDS
QGTCKSIERFQYRICTGTCSTSRMQSDVIKNFYHKPIDPSSSRCCQPTKY
STHEIQFKCENGRVYRRAANLPKNCKCVANCLND*
>Ddo_016416 slit
DKMQFIFKDITYKSYLILLLSLYCFSSTIWINDPSEEVEICPKGCQCENF
SVECKHRLFRNVPNILAEKTTRLNLLGNRIDVIRKSDFFKLNYLKVLQLS
NNRISSIESGAFDNLINLIKLRLNRNLIQHLPDHLFSKLSKLQKLDLREN
QLQCLNEHVFSKLGMLKTLLLEGNKLYWISEAITKLKHLRELRISSNKLH
CNCHLHWLNVFLKLKSDIFKPDTRSVVCVTPQRLSQIPISTLSTFEFQCA
NEENTCQPDRKVCPKQCTCSQDGIVNCTGKQLTNIPQDLPTNTIELDLQN
NSITILRQGFLSKYKLLKKIILTQNGMVDIEPGAFIGLQQLTALYLNMNN
LRTIRRNAFNGLSSLMFLYLHNNEIECLPTGTFEGVKRLYLLHLSENKLS
ALKEEVLRPLVKLRYLYLVHNPLYCDCKILWLVQVLKLKEVNATPVASCV
GPSSAHGIAVKSLQNYNFQCNSESDIKYDTHDENCVPKVICPHKCSCSSE
IVNCSGVGLSSLPEKIFPSTTTLILSHNDIKNLDQIYSVHQASNLVKLDL
SNNQIENIKPDTFSKSTKLKEINLSSNKLKCVNNETFKHLIELEILQLND
NHISCIGTNSFKFNTNLKYLMLNNNELHCDCRLKWLSEWSRNNYGILGSL
RLPTCQSPPILKGTPLPNLDEKYFVCEGNKSSKEETSSCAKANFSYSCCL
DMKCNKIPKCPSKCKCESTRIDCSELQLKEIPTEIPPNTTELYLDRNDLK
TLNESSFKNLINLKTLVLSYNGITEINKDVLTPLKNLETLVLSFNKLQCI
HQDAFKDLSNLKVLILQSNDVSTIPFQAFRDLTNLNNIALGQNPFHCDCN
IKWLNQFFLDRFLDNGISLCASPERMKLKSIYHSKPTEFICSEETEDTYI
TAKCDACMKTPCQNNGKCSLITHHDYICDCPNPFHGKSCEKRINACFGQP
CRNGGICKNTDNFGNYECVCPSGFRGPKCTENIDDCGGHKCENGATCVDQ
VNKYSCKCPNGFRGKFCESKFLYCHDKNPCENSGHCEPLSNNDYKCSCTK
GWEGKNCEQNIDDCKYNVCKNEAKCEDLVNGYKCICRPGYVGTYCEEPAW
KPYKLKTNLSRRDIDRSEVSKHFTSINEVISESVCAYHECLNNGVCVNED
MNKQKSYCKCKPGYSGPFCQYLNSLYFGKDSHIEIHPPSRGFLMPKGNIS
LKFITNSSSGLILYQGFDKSYLVVNLFRGHIKISYNIGDKDIGPDGFSMD
VVNDNKLHYLNIEIVGENLTMYLNGKVHFTLKSKYLMTNQYMALDTGIFI
GGAPKKILNTAIQNHHFDNDSDFTGCIESLLINRKKIDFSKYMSKSVNVK
PGCGDLISKTAQELPSSEVPTQDIEVPIKSTKSLPVKSTICSKPGVCSNN
GVCHEVNEKNRKYKCVCKNGFVGRKCKKRVSKCHGKTTRTFIKDPDTHDN
CLSIKKFQYRVCKGTCSNNRMQADSNRNFYQRSTDNSLSPCCQPSKYTTH
KIQFKCDNGRFYRRSVTLPRSCKCQGNCHRI*
>Gsp_007744 slit
MLIIFKDITYKFYLLLLLTLYCFSSTIWINDPSDESEICPNGCQCENYSV
ECKHRLFPNVPIILQEKTTRLNLLGNRINVIRKSDFFKLIYLKVLQLSNN
RITSIEPGAFDNLVNLIKLRLNRNLIQYLPDGLFSKLSKLQKLDLRDNQL
QCINENTFNKLTMLKYLLLEGNKIFWISESISKLKNLKELRIKKNKLTCN
CHLAWLNWFMKHRPDIFKPDVPSVVCSAPFRLSDIPVYTLSPYEFQCASE
DKTNLENICQQNKKVCSKQCNCSNDGIVKCVGKQLSNIPQDLPVNVVELD
LSDNNITILQQGYLSKYKTLKKINLTGNGMVDIEPGAFLGLQQLTSLYLN
ANKLKTIRKNAFSGLSSLMFLFLHGNEIECLPADAFEGVKKLHILHLSEN
KLTTLKRETFNPLIKLRFLYIVNNPLNCDCRLAWIVDYIKGKENNEPIAS
CHYPRNMQGLALRSLQTYSFQCNNEFDSKYETHNEECVPKVSCPLKCTCT
SDIVNCSNTGLNALPSSIFPSTKTLIMSHNNLNKLTPIYSVHEAPNLMKL
DMSFNQIEKLDADVFSRSTKLTEIHLNSNKLKCINNETFKNLNDLRTLQL
SDNEINCIVVDSFKNNLNLKYLMLNRNPFHCNCNMKWMSEWSRNHHSTLG
NHRLPTCQSPSLLKGTPITHLDEKYFLCDGNASIDQSSESCSEISSAEAC
CSIGSDECKQIKKCPLKCKCEITKVDCSDMQLKEIPHEIPLDTTELYLDR
NDLKTLNETSFKNLVFLKTLVLSYNGITELNKNVLTPLKNLETLVLSFNK
LQCIHQDAFKDLKNLKVLILQSNDVSTIPFQAFNDLNNLNNIALGQNPFH
CDCNIKWLNQFFHDKFLDNGISLCASPEKMKLKSIFHSKPTDFICSEETE
DAYITAKCDGCMKRPCKHNGKCSLITHHNYQCDCQYPFHGKNCENKINAC
FGQPCRNGGICKNIDNFGNYECVCPLGFRGPKCTLNIDDCVAHQCINGEC
VDLRNSYSCKCQNGFRGKYCDIKFSYCDDINPCKNDGICQSLPNNDYKCV
CSKGWEGKECNQNIDDCKYNTCKHEAKCVDLHNDYKCLCRPGYVGKYCEQ
PAWKPTSKPVSRRYINESAVMIHSGSENEIISESVCAYHECLNNGICVNG
DQSKNQKSYCRCKPGFSGHLCQYLNSLYFHKNSHIEITPPSRGFLMPKGN
ISLNFLTNSTSGLLLYQGFDQTYLVVNLYQGHVRISYNLGDKVVGPEGYS
MGMVNDSKLQKLHIEIVGENLTMYLNGRVHCTLKSKYINSNRYMALDTGI
FIGGAPNKILQSAMTKYHIDTDSEFIGCIESLLINQKRIDFSKYLSRSIN
VKPGCGDILSTVITSDMEIPSINQYSTKFQIPVTRKKLNNACRRPGICKN
QGICEPIRGSKKKFRCICKNGFVGKRCKKRTSMCHGTFTENFIDDPDTLD
SCKSIEKFQYRSCVGTCSNNKMQSDVNKGFFHKPIDISSSRCCQPTKYST
HKIQFKCRKGRKYFRDVNLPKNCKCISNCQSD*
>Pgr_016847 slit
MQTLNINIWFLFSIMLLLAICKSYSSTWYHDTIESTNICPNGCQCDSYSM
ECKHRLLRNVPESVPEKTVKLNLLGNRINVVRKTDFSKVVNLKILQLSNN
RITTIEAGTFDTLSQLTKLRLNRNLIQYLPDGLFSKLKNLQKLDLRDNQL
QCINENVFIGLDNLKNLYLDRNKIFWISEDISRLKNLETLHISLNKLNCN
CHLAWLNRFIKHQPQVIKPNPQSVLCATPFRLSQIPISSLSSYEFQCASD
SKNSLENICQPKKKLCSKHCTCSTEGIVKCVGKGIKSVPQDLPTSIIELD
LHDNAINVLKQNALSKYKNLKKILLNGNEMIDIEPGAFEGLRQLTSLYLN
GNKLKSIRKNALIGLSSLMFLYIHNNDIECLPKDTFAGLSRLYLLHLSEN
KLTTLKKETLNPLKKLRYLYLVHNPLNCNCKLGWLSAFLRFKEASGSPVA
SCLQPKNLHGQPVRGIQSYQFNCAQEEEQDAETHDEDCVPKISCPKNCTC
TPEVVDCNGAHLSIMPDNMLPSTKVVILSYNKLQEVTNPSPLLSLPNLIK
IDLSYNEIDHIDADVFMKNPKLKEINLNSNRLKCVNNQTFRMLHDLETLK
LSDNMIACIVEGSFQENGNIKHLTLNRNPLHCNCQLKWMSDWARTHYITL
GAHTAVLCQSPALLQGTPLSSLDEKYFQCRENVTNENASSNCPGSSDSEN
SCCSISKLECKKILRCPAKCRCESTKVDCSWIQLEDIPLGIPINTTELYL
DRNNLKTLNESSFKELENLKTLVLSYNGITELNKNVLTPLRNLETLVVSF
NKLQCIDRDAFKGLTNLKVLILQSNDVATIPFGTFRDLRNLNNIALGQNP
FHCDCNIKWLNQFFMERFLDNGISLCASPENMKLKSIYHSKPTDFSCTEE
TDDAYITAKCDACIRSPCKNNGKCSLVTHHQYQCQCPHPFHGKNCEKRIN
ACFGHPCKNGGICKNVDNYGNYECVCPLGFRGPKCNENINDCADHKCENG
ASCDDSVNGYNCVCKKGFRGKFCNLKFSFCKDINPCNNTGICESLPDNDY
RCACKPGWLGKNCNQNIDDCKYNECKNNAHCVDLVNGYDCKCRPGYVGKL
CDEPAWKPTVLKTSMSRRDLKLPHSANVNENEVISESVCAYHQCLNDGLC
VSDLQGDQKSYCRCKAGYSGQQCQHLDSLFFSTDSYIEISPPSRGFLMPR
GNITLKFSTNSSSGLLLYQGFDRKYLSVNLYRGHVRIGYNIGDKVIGPEG
YSMNSINDSRPHSLEIEIIGENLTMYLDGRFHCTLKSSYSSGNRYLALNS
GIFIGGAPKLIMEAALSKYHLESNTYFVGCLQFLSINNKKIDFLKYMTRA
VNVKPGCKVIGTESVTKAATEVLKIGHMSTTTTMSNVSDVCSEPEMCKNG
GVCQEQNDEKKKYKCICKDGFSGKSCNRKAYMCRRKMIKNHIKDPDTTCL
SLRRVRYRYCEGSCADSKMQSDIQKSFFHKPVETASSRCCQPYKFRTRRI
EFKCDSGRQYFRVVHFVRRCKCLPNCTSK*
>Pmo_017648 slit
MCLYFLLYHDTMYSNMIDILRKIIIIMQKINLFFALLLLFFSICQSYSNT
WYHDTIENTNTCPNGCQCDSYSMECKHRLLRNVPESLPEKTVKLNLLGNR
INVIRKSDFSKVINLKILQLSNNRITSIEAGTFDMLTQLTKLRLNRNLIQ
YLPDGLFSKLKNLQKLDLRDNQLQCVNENVLTGLDNLKNLYLDRNKIFWI
AEDISRLKNLETLHIATNKLNCNCHLAWLNRFIKHQPQVIKPNPQSVLCA
TPFRLSQIPISSLSSYEFQCASDSKNSLENICQPKKKLCSKHCICSTEGI
VKCVGRGIKTVPQDLPTSIIELDLHDNAINVLKQNALSKYKNLKKILLNS
NEMTDIEPGAFEGLRQLTSLYLNGNKLKSIRKNALLGLSSLMFLYIHNND
IECLPRDTFVGLSKLYLLHLSENKLTTLKKETLDPLTKLRYLYLVHNPLN
CNCKLSWLAEFLRFKEASGSPVASCLLPKNLHGQPVRGVQSYQFNCGQDE
EAESESHDEDCIPKISCPKNCTCTPEVVDCNGAHLTTIPDNMLPSTKVVI
LSYNKLKEISNSSPLLALPNLIKIDLSYNEIDHIEADIFMKNSRLKEINL
NSNKLKCINNQTFRNLYDLETLKLSDNLIQCIVEGSFQENKNIKHLTLNR
NPLHCNCQLKWISEWARTHYATLGAHTAVLCQSPAALQGTAVSSLDEKYF
LCRENVTNASATAECTNGMRSENSCCSISKPECHTTKRCPTKCKCEGTKV
DCSWIQLGDIPKGIPINTTELYLDRNNLNQLNESSFKHLENLKTLVLSYN
GITELNKNVLTPLRSLETLVVSFNKLQCIDREAFKGLTNLKVLILQSNDV
ATIPFGAFRDLRNLNNIALGQNPFHCDCNIKWLNQFFMERFLDNGISLCA
SPENMKLKSIYHSKPTDFTCNEETDDAYITAKCDACIRSPCKHNGKCSLI
THHQYKCQCPHPFHGKNCEKRINACFGHPCKNGGICKNVDNYGNYECVCP
VGFRGPKCNENIDDCVNNKCENGGTCVDRVNGYGCDCRTGYRGQYCHLKF
TYCTDVNPCNNTGSCHQLPNNDYRCVCSLGWLGKNCDENIDDCKYNECRN
NAQCVDLVNGYECKCRPGYKGKFCDEAAWKPPAMKMSMSRREIQRFSSAG
KSDNPGNEVISESVCAYHQCLNEGVCVSADQKSFCQCKSGYSGQQCQHLD
SLYFAKESYIEISPPSRGFLMPRGNITLRFSTNSSSGLLLYQGFDRKYLS
VNLYRGHVRIGYNIGDKVIGPEGYSMNSINDSRSHSLEIEIIGENLTMYL
DGRFHCTLKSSYSSGNRYLALSSGIFIGGAPKLILETALSKYHLESNTYF
IGCLQSLEINQKKIDFLKFMTRSVNVKPGCRDVAQESFNKLVTDVAKTDL
QTVSSTPVSVSDVCSEPEICKNGGVCQAVNDGKKKFKCICKDGFSGKSCN
RKAYMCRRKMIKNHIKDPDTTCLSLKTVRYRYCEGSCQDSKMQSDIQKSF
FHRPVDTGSSRCCQPYKFRTRRIDFKCDSGRQYFRVVHFVRRCKCLPNCT
SK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.