beta-catenin, Pmo_016711 (mRNA) Phagocata morgani

Overview
Namebeta-catenin
Unique NamePmo_016711
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length3564
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of beta-catenin vs. uniprot
Match: gi|399056|sp|Q02453|ARM_MUSDO (RecName: Full=Armadillo segment polarity protein [Musca domestica])

HSP 1 Score: 415.616 bits (1067), Expect = 8.84005e-127
Identity = 292/775 (37.68%), Postives = 416/775 (53.68%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRIN-FDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDKL-------LEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YLVDSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A+ NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL A + + P S RL+ NCLWTLRNLSDAAT+++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLT+RH ++E Q A + + G + P W LIKA IGL+RN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 5 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLVDSGIHSGAVTQAPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLAEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAITNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQAL--------------AMHLSNP-----------SPRLVQNCLWTLRNLSDAATKVDGLEPLLQSLVQVLAST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTTRHADSEMAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAAIGLVRNLALCPANAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTGSQQPAAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 669
BLAST of beta-catenin vs. uniprot
Match: gi|221222436|sp|Q29I35|ARM_DROPS (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 414.846 bits (1065), Expect = 3.34996e-126
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
BLAST of beta-catenin vs. uniprot
Match: gi|114162|sp|P18824|ARM_DROME (RecName: Full=Armadillo segment polarity protein)

HSP 1 Score: 414.846 bits (1065), Expect = 4.58891e-126
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
BLAST of beta-catenin vs. uniprot
Match: gi|461856|sp|P35224|CTNB_URECA (RecName: Full=Catenin beta; AltName: Full=Beta-catenin [Urechis caupo])

HSP 1 Score: 412.535 bits (1059), Expect = 1.83967e-125
Identity = 265/613 (43.23%), Postives = 359/613 (58.56%), Query Frame = 2
Query:  503 AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAI-DALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDV---ANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
A AIP+L KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ AM + R AG ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+QEG K AVR + + K+V LL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y YEKLLWT +RVLKVLSVC++NKP I+ E G + L H SQRL+ NCLWTLRNLSDAAT+ + + LL++LVQ+L S+ D N VTCAAGILSNLTCNNQ NK+ + ++GG+EAL++ I EDI EP +CALRHLTSRH EAE Q A+ L+Y PV+ L W LIKA++GLIRN+A+ N A +RE G + ++ L+ RA D A G ++ +EEI+E T GALH++A++ RA I R + C I + A LL++ +++IQRVA G+L EL+A++ EMI T L E++HS++E VATYA+A+L R +E+K
Sbjct: 172 ATRAIPELTKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHRQGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLLLQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLKVLSVCASNKPAIV-EAGSAGPSMHLGHQ-------------------------SQRLVQNCLWTLRNLSDAATKSSDIEGLLQMLVQLLASN-----------DINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTI-----------------LQAGDREDITEPAVCALRHLTSRHGEAEMAQNAVR-------------------LHY---GLPVLVKLLHPPS-RWPLIKAVVGLIRNLALCPANHAPLREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAYVDGVRMEEIVEGTVGALHIMAREAHNRAVI-------RGLNC---------ISLFAQLLYSPIDNIQRVAAGVLCELAADKEGAEMIE-QEGTTAPLTELLHSRNEGVATYAAAVLFRMSEDK 689
BLAST of beta-catenin vs. uniprot
Match: gi|9972860|sp|Q9WU82|CTNB1_RAT (RecName: Full=Catenin beta-1; AltName: Full=Beta-catenin)

HSP 1 Score: 403.29 bits (1035), Expect = 1.96961e-122
Identity = 263/612 (42.97%), Postives = 354/612 (57.84%), Query Frame = 2
Query:  503 AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAI-DALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNP--GTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
A AIP+L KL+ DED VV+N+A +MV QLSK +A A++ S +M+S I+ M + R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR + + K+V LL K N KFL I TDCLQILA+ +Q SK+ IL +GGP L++I++ Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL P+ +P SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N VTCAAGILSNLTCNN NK+ + ++GG+EAL++ + EDI EP ICALRHLTSRH+EAE Q A+ L+Y PV+ L +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + GT + +EEI+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I T L E++HS++E VATYA+A+L R +E+K
Sbjct: 149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL--------------GPHLTDP-----------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVR-------------------LHY---GLPVVVKLLHPPS-HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIE-AEGATAPLTELLHSRNEGVATYAAAVLFRMSEDK 666
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15031548 (SmedSxlregen_c67076_g1_i1|m.10982|m.22691)

HSP 1 Score: 1104.35 bits (2855), Expect = 0
Identity = 575/746 (77.08%), Postives = 660/746 (88.47%), Query Frame = 2
Query:  101 IMNEQMNIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDHNKK--DWKCLSNISINDNFPNDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDG-GKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAIDALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMS-YKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
+MNE MNIVNSP +D+ INDK+NFTR WQQNQYL+DSGINSALE+H+HSVSS+HGYD+MDSED +K +WK SN + ND NDICMLTPD+PGS C R GGE MADV+L++ YD + + +FG+DIDKIEAE AIPDL+KLI DEDDAVVINEATMMVFQLSK+DAIDA+INS EMISC+IEAMNKAEHA+A+RFLAGAIYNMSQKK GLK+IFEANVIPCLVKLLGFS+ESVLFYAITTLHNLLLYQ+GGKEAVRSS CIPK+V LL KNN KFLTICTDCLQILAFNHQPSK+EILK+GGP+HLIHIIK+Y+YEKLLWTATRVLKVLSVCSANKPVIIREGG++ALTNILYHTIQ N++ PY P EN+E++P FSQRLLHNCLWTLRNLSDAATR+NFDHLLKVLVQILM+++NSFQRQ+ HIDTN +TCAAGILSNLTCNNQ+NKI FKLGGVEA+++ IEWN +L NPNA NK N NN F +DI EPCIC LRH++SRHEEAEA Q +++ QGL +LIR++EMQLG DL++MQ+ QP+MPNLF+S YKINWSLIKAIIGLIRN+AMS CNF IRERGF WPMIVLINRAQID+ NKN + +S KDKLLEEI+EV+CGALHMLAKDPGIR+QIIS+K+WQRLI PQQIGIQSA+YVIASLLFNHLESIQRV GLLVE+SAER+ LE+I+ +VITNKLNEMVHS +EA++TYASAILIRATEEK
Sbjct: 1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNL-ALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKN-SCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEK 744

HSP 2 Score: 109.768 bits (273), Expect = 3.95277e-24
Identity = 93/230 (40.43%), Postives = 120/230 (52.17%), Query Frame = 3
Query: 2319 KKKNKRYTPCHNYNVPLPNTGCSRPXXXXXXXXXXXXXXPGFLNSILHSPVMHNQPPCVSHRH-IPSQCGDQNYINNELLGQIGDMDVSDMQMNYGQSTGXXXXQTQNRYPYNPGYMDNNNGCTVLLAGNXXXXXXXXXXXSMSSDMRYFKQ--PPGIVNECHVTTDHQKA---AYIGKPRAPHLQHPSSMDLGGTGAKIKEPMELCMPDAVDWAESSCGQDFPHHQGHS 2990
++KNKRY HNYN+ +P + N N+ G+LNSIL+SP+MHNQPPCVSHRH +QCGDQN NE L I D+DV+D M + + Q QNRYPYNP ++D N + GN MR+FKQ I NEC V D QKA + P + L ++ +K K+ M++CM DA DW E +C DF QGHS
Sbjct: 742 EEKNKRYVAPHNYNI-IPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTL-----QPQNRYPYNPNFVDPNYSL-INQTGNSEIA------------MRHFKQMGSINISNEC-VNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSK-KDMMDVCMLDA-DWIE-TCS-DFS--QGHS 945
BLAST of beta-catenin vs. Smed Unigenes AA
Match: SMU15006664 (SmedAsxldir_c108529_g1_i1|m.90628|m.5971)

HSP 1 Score: 144.436 bits (363), Expect = 3.08044e-35
Identity = 158/567 (27.87%), Postives = 274/567 (48.32%), Query Frame = 2
Query:  650 IIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKIN----WSLIKAIIGLIRNMAMSS--CNFASIRERGFVWPMIVLINRAQ---IDVANKNPGTSAVSSKDKLLEEI-----MEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAIL 2305
I+ NK A+ I ++ ++S+ + G I N IP L+ LL + ++ I+TL NL+ + ++ +R+S I KLV + +N+ K LT+ +CL L FN+ +K +L + G ++ I++ Y YEKLL+ A+++LKVLSVC+ANKP+++ G +EAL ++L S +P RL+ + LW++RNLSD ++ I + LL+ L+++L S D + C+ G L NLT N NK+A + GGV+A+ ++I E+++EP + ALRH+T + L Q + Q P++ NL + + LIKAI+GL+RN++M S C S+ + G + + R D++ + +VSS+ +E + +E+T AL LAKD + +IIS + RL+ QS + ++ ++ + + R +GLL E+ E I+ +L+E++HS ++A++TYA+ ++
Sbjct: 127 IVSCKNKNTKAECI----SSVQHISKGEQGATNIVNVNFIPILLDLLSSNDLKIVECVISTLDNLMYFVNQSRDIIRNSHGIEKLVEQMDRNDVKLLTVVLNCLHKLTFNNYEAKKTMLLSHGSEKVVQILRQYTYEKLLFAASKLLKVLSVCNANKPILVETGAMEALHSLL-------RSGSP------------------RLVLSSLWSIRNLSDYSSHIADMQKLLQKLIELLGSD-----------DEHTSICSMGCLCNLTSGNTENKLAFIEYGGVQAVCQLI-----------------CERVGQEEVVEPGVAALRHVTHNN-------------------------HLAQQAIDIIIQSPLLSNLSVLIRGQPDKMLPLIKAIVGLLRNLSMISPQCR-RSLIDLGITNSLCEIFYRTSKGISDLSQQRNSIVSVSSELSFIEGVRLDDLLELTLAALQALAKD-NLAKKIISYE--NRLL--------QSVVQMV--MIKENSVPLHRACLGLLAEM-VEYADCARILEGEGFNTRLSELIHSTNKAISTYAAIVM 596
BLAST of beta-catenin vs. RefSeq Human
Match: gi|578805678|ref|XP_006713048.1| (PREDICTED: catenin beta-1 isoform X3 [Homo sapiens])

HSP 1 Score: 398.282 bits (1022), Expect = 8.12311e-122
Identity = 289/750 (38.53%), Postives = 395/750 (52.67%), Query Frame = 2
Query:  158 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDHNK-KDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIE----------------------AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNP--GTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
D+ WQQ YL DSGI+S T S+S + +E D + +W+ + S DI D + ++ AM L G + ++ ++ A AIP+L KL+ DED VV+N+A +MV QLSK +A A++ S +M+S I+ M + R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR + + K+V LL K N KFL I TDCLQILA+ +Q SK+ IL +GGP L++I++ Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L T P SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N VTCAAGILSNLTCNN NK+ + ++GG+EAL++ + EDI EP ICALRHLTSRH+EAE Q A+ L+Y PV+ L +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + GT + +EEI+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I T L E++HS++E VATYA+A+L R +E+K
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL-----------------------TDP--SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVR-------------------LHY---GLPVVVKLLHPPS-HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIE-AEGATAPLTELLHSRNEGVATYAAAVLFRMSEDK 666
BLAST of beta-catenin vs. RefSeq Human
Match: gi|578805674|ref|XP_006713046.1| (PREDICTED: catenin beta-1 isoform X2 [Homo sapiens])

HSP 1 Score: 398.667 bits (1023), Expect = 3.15337e-121
Identity = 289/750 (38.53%), Postives = 395/750 (52.67%), Query Frame = 2
Query:  158 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDHNK-KDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIE----------------------AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAI-DALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNP--GTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
D+ WQQ YL DSGI+S T S+S + +E D + +W+ + S DI D + ++ AM L G + ++ ++ A AIP+L KL+ DED VV+N+A +MV QLSK +A A++ S +M+S I+ M + R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR + + K+V LL K N KFL I TDCLQILA+ +Q SK+ IL +GGP L++I++ Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L T P SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N VTCAAGILSNLTCNN NK+ + ++GG+EAL++ + EDI EP ICALRHLTSRH+EAE Q A+ L+Y PV+ L +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + GT + +EEI+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I T L E++HS++E VATYA+A+L R +E+K
Sbjct: 10 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL-----------------------TDP--SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVR-------------------LHY---GLPVVVKLLHPPS-HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIE-AEGATAPLTELLHSRNEGVATYAAAVLFRMSEDK 659
BLAST of beta-catenin vs. RefSeq Human
Match: gi|578805676|ref|XP_006713047.1| (PREDICTED: catenin beta-1 isoform X2 [Homo sapiens])

HSP 1 Score: 398.667 bits (1023), Expect = 3.15337e-121
Identity = 289/750 (38.53%), Postives = 395/750 (52.67%), Query Frame = 2
Query:  158 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDHNK-KDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIE----------------------AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAI-DALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNP--GTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
D+ WQQ YL DSGI+S T S+S + +E D + +W+ + S DI D + ++ AM L G + ++ ++ A AIP+L KL+ DED VV+N+A +MV QLSK +A A++ S +M+S I+ M + R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR + + K+V LL K N KFL I TDCLQILA+ +Q SK+ IL +GGP L++I++ Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L T P SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N VTCAAGILSNLTCNN NK+ + ++GG+EAL++ + EDI EP ICALRHLTSRH+EAE Q A+ L+Y PV+ L +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + GT + +EEI+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I T L E++HS++E VATYA+A+L R +E+K
Sbjct: 10 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL-----------------------TDP--SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVR-------------------LHY---GLPVVVKLLHPPS-HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIE-AEGATAPLTELLHSRNEGVATYAAAVLFRMSEDK 659
BLAST of beta-catenin vs. RefSeq Human
Match: gi|4503131|ref|NP_001895.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 398.667 bits (1023), Expect = 3.43547e-121
Identity = 289/750 (38.53%), Postives = 395/750 (52.67%), Query Frame = 2
Query:  158 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDHNK-KDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIE----------------------AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAI-DALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNP--GTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
D+ WQQ YL DSGI+S T S+S + +E D + +W+ + S DI D + ++ AM L G + ++ ++ A AIP+L KL+ DED VV+N+A +MV QLSK +A A++ S +M+S I+ M + R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR + + K+V LL K N KFL I TDCLQILA+ +Q SK+ IL +GGP L++I++ Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L T P SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N VTCAAGILSNLTCNN NK+ + ++GG+EAL++ + EDI EP ICALRHLTSRH+EAE Q A+ L+Y PV+ L +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + GT + +EEI+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I T L E++HS++E VATYA+A+L R +E+K
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL-----------------------TDP--SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVR-------------------LHY---GLPVVVKLLHPPS-HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIE-AEGATAPLTELLHSRNEGVATYAAAVLFRMSEDK 666
BLAST of beta-catenin vs. RefSeq Human
Match: gi|148227672|ref|NP_001091680.1| (catenin beta-1 [Homo sapiens])

HSP 1 Score: 398.667 bits (1023), Expect = 3.43547e-121
Identity = 289/750 (38.53%), Postives = 395/750 (52.67%), Query Frame = 2
Query:  158 DKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSEDHNK-KDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQGGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIE----------------------AEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAI-DALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNP--GTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
D+ WQQ YL DSGI+S T S+S + +E D + +W+ + S DI D + ++ AM L G + ++ ++ A AIP+L KL+ DED VV+N+A +MV QLSK +A A++ S +M+S I+ M + R AG ++N+S + GL IF++ IP LVK+LG ++SVLFYAITTLHNLLL+QEG K AVR + + K+V LL K N KFL I TDCLQILA+ +Q SK+ IL +GGP L++I++ Y YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L T P SQRL+ NCLWTLRNLSDAAT+ + LL LVQ+L S D N VTCAAGILSNLTCNN NK+ + ++GG+EAL++ + EDI EP ICALRHLTSRH+EAE Q A+ L+Y PV+ L +W LIKA +GLIRN+A+ N A +RE+G + ++ L+ RA D + GT + +EEI+E GALH+LA+D R I + + I + LL++ +E+IQRVA G+L EL+ ++ A E I T L E++HS++E VATYA+A+L R +E+K
Sbjct: 17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADI-----DGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL-----------------------TDP--SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV-----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVR-------------------LHY---GLPVVVKLLHPPS-HWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGL----------------NTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIE-AEGATAPLTELLHSRNEGVATYAAAVLFRMSEDK 666
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45551205|ref|NP_726775.2| (armadillo, isoform C [Drosophila melanogaster])

HSP 1 Score: 415.616 bits (1067), Expect = 1.08412e-128
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|17136376|ref|NP_476666.1| (armadillo, isoform A [Drosophila melanogaster])

HSP 1 Score: 414.846 bits (1065), Expect = 5.29722e-127
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|19549863|ref|NP_599100.1| (armadillo, isoform B [Drosophila melanogaster])

HSP 1 Score: 414.846 bits (1065), Expect = 5.29722e-127
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|24639204|ref|NP_476665.2| (armadillo, isoform D [Drosophila melanogaster])

HSP 1 Score: 414.846 bits (1065), Expect = 5.29722e-127
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Match: gi|45553932|ref|NP_996328.1| (armadillo, isoform E [Drosophila melanogaster])

HSP 1 Score: 414.846 bits (1065), Expect = 5.29722e-127
Identity = 292/775 (37.68%), Postives = 414/775 (53.42%), Query Frame = 2
Query:  119 NIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSSRHGYDEMDSE--------------------DHNKKDWKCLSNISINDNFPNDI--------CMLTPDSPGSNICGRQGGEAM--ADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAID-ALINSNEMISCIIEAMNKAEHADAIRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLYQEGGKEAVRSSSCIPXXXXXXXXXXXXXXXICTDCLQILAFNHQPSKIEILKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSDAATRI-NFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQFNKIALFKLGGVEALIKVIEWNFXXXXXXXXXXXXXXXXXXXEDILEPCICALRHLTSRHEEAEAVQTAXXXXXXXXXXXXXXEMQLGQDLYYMQTQQPVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLINRAQIDVANKNPGTSAVSSKDK-------LLEEIMEVTCGALHMLAKDPGIRAQIISIKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERMALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEK 2326
N N P +++ K T +WQQN YL DSGI+S T S+S + +EM+ + D N++ + S FP + P P + + + + A VNL + D ++ A AIP+L+KL+ DED VV+++A MMV QLSK +A A++NS +M++ ++ A++ + ++ + G ++N+S + GL IF++ IP LVKLL +ESVLFYAITTLHNLLL+Q+G K AVR + + K+VTLL +NN KFL I TDCLQILA+ +Q SK+ IL +GGP L+ I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+ GG++AL L + S RL+ NCLWTLRNLSDAAT++ + LL+ LVQ+L S+ D N VTCAAGILSNLTCNNQ NK + ++GGV+AL++ I N E+I EP +CALRHLTSRH ++E Q A + + G + P W LIKA+IGLIRN+A+ N A +RE G + ++ L+ RA D + + S+ +EEI+E T GALH+LA++ RA I QS I + LLFN +E+IQRVA G+L EL+A++ E+I T L +++HS++E VATYA+A+L R +E+K
Sbjct: 15 NQYNPPDLPPMVSAKEQ-TLMWQQNSYLGDSGIHSGAVTQVPSLSGKED-EEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAEL--------------ATRAIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGN-------------------------MSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST-----------DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI-----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNA-------------VRLNYGLSVIVKLLHPPS----------RWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGA-TGPLTDLLHSRNEGVATYAAAVLFRMSEDK 679
The following BLAST results are available for this feature:
BLAST of beta-catenin vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|399056|sp|Q02453|ARM_MUSDO8.840050e-12737.68RecName: Full=Armadillo segment polarity protein [... [more]
gi|221222436|sp|Q29I35|ARM_DROPS3.349960e-12637.68RecName: Full=Armadillo segment polarity protein[more]
gi|114162|sp|P18824|ARM_DROME4.588910e-12637.68RecName: Full=Armadillo segment polarity protein[more]
gi|461856|sp|P35224|CTNB_URECA1.839670e-12543.23RecName: Full=Catenin beta; AltName: Full=Beta-cat... [more]
gi|9972860|sp|Q9WU82|CTNB1_RAT1.969610e-12242.97RecName: Full=Catenin beta-1; AltName: Full=Beta-c... [more]
back to top
BLAST of beta-catenin vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 2
Match NameE-valueIdentityDescription
SMU150315483.952770e-2477.08SmedSxlregen_c67076_g1_i1|m.10982|m.22691[more]
SMU150066643.080440e-3527.87SmedAsxldir_c108529_g1_i1|m.90628|m.5971[more]
back to top
BLAST of beta-catenin vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|578805678|ref|XP_006713048.1|8.123110e-12238.53PREDICTED: catenin beta-1 isoform X3 [Homo sapiens... [more]
gi|578805674|ref|XP_006713046.1|3.153370e-12138.53PREDICTED: catenin beta-1 isoform X2 [Homo sapiens... [more]
gi|578805676|ref|XP_006713047.1|3.153370e-12138.53PREDICTED: catenin beta-1 isoform X2 [Homo sapiens... [more]
gi|4503131|ref|NP_001895.1|3.435470e-12138.53catenin beta-1 [Homo sapiens][more]
gi|148227672|ref|NP_001091680.1|3.435470e-12138.53catenin beta-1 [Homo sapiens][more]
back to top
BLAST of beta-catenin vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|45551205|ref|NP_726775.2|1.084120e-12837.68armadillo, isoform C [Drosophila melanogaster][more]
gi|17136376|ref|NP_476666.1|5.297220e-12737.68armadillo, isoform A [Drosophila melanogaster][more]
gi|19549863|ref|NP_599100.1|5.297220e-12737.68armadillo, isoform B [Drosophila melanogaster][more]
gi|24639204|ref|NP_476665.2|5.297220e-12737.68armadillo, isoform D [Drosophila melanogaster][more]
gi|45553932|ref|NP_996328.1|5.297220e-12737.68armadillo, isoform E [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_016711 ID=Pmo_016711|Name=beta-catenin|organism=Phagocata morgani|type=mRNA|length=3564bp
TTTATTTCTTTCGATAATGGTAAATATTTATAATTTAAATATTTTCGATT
TTCTTTGATTTAATTTCATGTTATTTCCACCAATTGCCCGTATTTAGAGA
ATCATGAATGAGCAGATGAATATTGTAAATTCCCCACAATCAGATGATCT
TATTAATGACAAATCAAATTTCACAAGGTTATGGCAACAGAACCAGTATT
TGGTAGATTCTGGAATAAATTCAGCTTTAGAAACTCATACTCACAGTGTA
AGTAGTAGACATGGGTATGATGAAATGGATTCGGAAGATCACAATAAGAA
GGATTGGAAATGCCTATCGAACATAAGCATCAATGATAATTTTCCAAATG
ATATTTGTATGCTAACACCAGATTCTCCCGGAAGTAACATCTGTGGCAGA
CAAGGTGGAGAGGCAATGGCGGATGTCAATTTAACTTCTGGATATGATGG
TGGTAAAATAGACTGTGAAAAGGAGTTCGGCTTAGATATAGATAAGATAG
AAGCAGAAGGTGCTATACCAGATTTGGTTAAACTAATTAAGGATGAAGAT
GATGCAGTGGTTATCAATGAAGCTACAATGATGGTATTTCAATTAAGTAA
ATCAGATGCTATCGATGCTTTAATTAATTCAAATGAAATGATTTCGTGTA
TTATTGAAGCTATGAATAAAGCTGAACATGCAGATGCCATTAGATTCTTA
GCGGGCGCTATTTATAACATGTCTCAAAAGAAATATGGACTGAAGGTAAT
TTTTGAGGCAAATGTAATACCATGCTTGGTGAAACTTCTTGGATTTTCAT
TGGAATCCGTTTTGTTTTATGCAATAACAACGTTGCACAATTTATTACTG
TATCAAGAAGGAGGAAAAGAAGCAGTTAGATCAAGTAGTTGTATTCCAAA
GCTTGTTACGCTTCTGTTAAAAAATAACACAAAATTTTTAACAATTTGTA
CCGACTGCTTACAAATTTTGGCATTTAATCATCAGCCTAGCAAAATTGAG
ATATTAAAGAATGGTGGACCAATGCATCTGATTCATATTATAAAAAACTA
TAACTATGAAAAGTTATTATGGACAGCTACTCGAGTTTTAAAGGTCCTCA
GTGTTTGCTCGGCAAATAAACCAGTCATAATCAGAGAGGGAGGAATTGAA
GCACTCACAAACATTTTATATCACACAATTCAAAGTAATTCATCAACCGC
ACCGTATCAAGCTGAACCGCCCAATGAAAATAATGAAACGCATCCTCAAT
TTAGTCAGAGACTATTGCATAATTGTCTTTGGACTTTACGAAATTTATCG
GATGCAGCAACTCGGATTAATTTTGATCATTTATTAAAAGTTTTAGTTCA
AATTCTGATGAGTTCGTATAATTCGTTTCAAAGACAAAATATTCATATCG
ATACTAACGCTGTTACATGTGCAGCTGGAATATTGTCTAATTTGACTTGC
AATAATCAGTTCAATAAAATTGCTTTATTTAAGCTTGGTGGAGTTGAAGC
GTTAATTAAAGTTATCGAATGGAATTTTGCTTCTCTCAATAATCCAAATG
CACAAAATAAAAACAACTCCAACAATGCCTTCTCGGAGGATATATTAGAA
CCGTGCATTTGTGCATTGCGTCATTTGACGAGCAGACATGAGGAAGCAGA
GGCTGTTCAGACGGCACTTGTTCAACTGCAAGGCTTGTCCTTGCTGATCC
GATTATTGGAAATGCAACTCGGACAGGATCTGTACTATATGCAAACTCAG
CAACCAGTCATGCCTAATCTGTTCATGTCCTACAAAATCAACTGGAGTCT
CATAAAAGCGATCATAGGTCTCATACGGAATATGGCAATGTCATCGTGCA
ATTTTGCGTCGATACGAGAACGGGGTTTTGTGTGGCCAATGATTGTTCTA
ATTAATCGGGCACAAATCGATGTTGCTAACAAGAATCCGGGTACGTCCGC
GGTGTCATCGAAAGATAAATTGCTCGAAGAAATTATGGAAGTCACATGCG
GTGCATTGCACATGCTCGCTAAGGATCCCGGCATCCGGGCTCAAATTATA
TCAATTAAATTATGGCAGCGTTTAATTTACTGTCCGCAACAAATTGGAAT
TCAATCTGCCATTTACGTGATCGCAAGTCTTCTGTTCAATCATCTTGAAT
CAATTCAACGGGTCGCAGTTGGACTTCTTGTTGAACTGTCTGCGGAACGG
ATGGCCTTGGAAATGATAATGGGACATATGGTAATCACCAACAAACTCAA
CGAAATGGTGCACTCGAAAAGCGAAGCGGTGGCAACTTACGCATCGGCCA
TATTGATCCGAGCCACAGAAGAAAAAAAATAAACGTTACACACCGTGTCA
CAATTACAATGTGCCGCTTCCTAATACCGGATGCTCGAGACCGAATCTCT
CCATCTCTCTCTCATCTAATCAGTCCCATAATTCGCCTGGATTCCTTAAC
TCGATACTGCATTCGCCGGTCATGCACAATCAGCCGCCTTGTGTTAGTCA
TCGGCACATACCGTCCCAATGCGGGGATCAGAATTACATAAACAACGAAC
TATTGGGTCAGATCGGCGACATGGACGTATCAGACATGCAGATGAACTAC
GGCCAGTCCACAGGGCCCCCGCCCCCGCAGACCCAGAACAGGTACCCGTA
CAACCCCGGCTACATGGATAATAACAATGGCTGCACCGTGCTCCTCGCCG
GCAATCAGCCTCCACCGCCCCAACAGCAGCAGCAGCAGTCAATGTCATCG
GACATGAGATACTTCAAGCAGCCACCGGGCATCGTCAACGAATGTCACGT
GACCACCGATCACCAGAAGGCCGCATACATAGGCAAGCCTCGTGCCCCGC
ATCTTCAGCATCCGTCCTCGATGGACCTCGGCGGCACTGGCGCCAAGATC
AAAGAGCCAATGGAACTGTGCATGCCAGACGCCGTTGATTGGGCGGAGTC
CTCCTGTGGCCAGGACTTCCCCCACCACCAGGGGCACTCGTCCCACAAAT
CCTGACTGTTCACCACCGCATAAAAAGTATGTTGACTTTTACTTTTGTTT
ATTTATTAGACAGTTTCGTTATCGTTATTAATTAATTAATTAATTACTAA
TTACTATTTCGTGATGTAATTGTGATCATTTCGAATGAATGACGGATGGA
CAATGACTTTGTAGTGGTTGTGATTGCGGCTGTATTGATTCATTGCGATG
ATGGCGCCTCTCACTTGCATGCATGCACGCACGCACGCACGTTTCTCTCT
CTCTCTCTCTCTCCTGAACGTCCAGCGATACATACGTGCACACACCCACA
CACATGACACACTGACTGACTGACTCACGGTACTTGCTGCTCTCGACCTT
CGATTGACTACCGCGATTCAAACTGTGCCTTTAGCAATGTTTTTTTTTTC
GCGCGATAGTTTGCACTTTGTACACTGCGTCGATATTTCGTTTCGGACTT
GGCAAGCAATGGACGCGGAGGGCAGTCTCTGTAAATAATGGACTCAGTAC
ACGCCGTCTCTGTCTGAGCTACTTTGTATTGTATTATTATTACTACTACT
ACTAATACTATTAT

Design Primers for beta-catenin

back to top

protein sequence

>Pmo_016711-protein ID=Pmo_016711-protein|Name=beta-catenin|organism=Phagocata morgani|type=polypeptide|length=743bp
MNEQMNIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVS
SRHGYDEMDSEDHNKKDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQ
GGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSNEMISCIIEAMNKAEHADAIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLY
QEGGKEAVRSSSCIPKLVTLLLKNNTKFLTICTDCLQILAFNHQPSKIEI
LKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSD
AATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCN
NQFNKIALFKLGGVEALIKVIEWNFASLNNPNAQNKNNSNNAFSEDILEP
CICALRHLTSRHEEAEAVQTALVQLQGLSLLIRLLEMQLGQDLYYMQTQQ
PVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLI
NRAQIDVANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIIS
IKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERM
ALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEKK*
back to top

coding sequence

>Pmo_016711.104.2332 ID=Pmo_016711.104.2332|Name=Pmo_016711.104.2332|organism=Phagocata morgani|type=CDS|length=2229bp
ATGAATGAGCAGATGAATATTGTAAATTCCCCACAATCAGATGATCTTAT
TAATGACAAATCAAATTTCACAAGGTTATGGCAACAGAACCAGTATTTGG
TAGATTCTGGAATAAATTCAGCTTTAGAAACTCATACTCACAGTGTAAGT
AGTAGACATGGGTATGATGAAATGGATTCGGAAGATCACAATAAGAAGGA
TTGGAAATGCCTATCGAACATAAGCATCAATGATAATTTTCCAAATGATA
TTTGTATGCTAACACCAGATTCTCCCGGAAGTAACATCTGTGGCAGACAA
GGTGGAGAGGCAATGGCGGATGTCAATTTAACTTCTGGATATGATGGTGG
TAAAATAGACTGTGAAAAGGAGTTCGGCTTAGATATAGATAAGATAGAAG
CAGAAGGTGCTATACCAGATTTGGTTAAACTAATTAAGGATGAAGATGAT
GCAGTGGTTATCAATGAAGCTACAATGATGGTATTTCAATTAAGTAAATC
AGATGCTATCGATGCTTTAATTAATTCAAATGAAATGATTTCGTGTATTA
TTGAAGCTATGAATAAAGCTGAACATGCAGATGCCATTAGATTCTTAGCG
GGCGCTATTTATAACATGTCTCAAAAGAAATATGGACTGAAGGTAATTTT
TGAGGCAAATGTAATACCATGCTTGGTGAAACTTCTTGGATTTTCATTGG
AATCCGTTTTGTTTTATGCAATAACAACGTTGCACAATTTATTACTGTAT
CAAGAAGGAGGAAAAGAAGCAGTTAGATCAAGTAGTTGTATTCCAAAGCT
TGTTACGCTTCTGTTAAAAAATAACACAAAATTTTTAACAATTTGTACCG
ACTGCTTACAAATTTTGGCATTTAATCATCAGCCTAGCAAAATTGAGATA
TTAAAGAATGGTGGACCAATGCATCTGATTCATATTATAAAAAACTATAA
CTATGAAAAGTTATTATGGACAGCTACTCGAGTTTTAAAGGTCCTCAGTG
TTTGCTCGGCAAATAAACCAGTCATAATCAGAGAGGGAGGAATTGAAGCA
CTCACAAACATTTTATATCACACAATTCAAAGTAATTCATCAACCGCACC
GTATCAAGCTGAACCGCCCAATGAAAATAATGAAACGCATCCTCAATTTA
GTCAGAGACTATTGCATAATTGTCTTTGGACTTTACGAAATTTATCGGAT
GCAGCAACTCGGATTAATTTTGATCATTTATTAAAAGTTTTAGTTCAAAT
TCTGATGAGTTCGTATAATTCGTTTCAAAGACAAAATATTCATATCGATA
CTAACGCTGTTACATGTGCAGCTGGAATATTGTCTAATTTGACTTGCAAT
AATCAGTTCAATAAAATTGCTTTATTTAAGCTTGGTGGAGTTGAAGCGTT
AATTAAAGTTATCGAATGGAATTTTGCTTCTCTCAATAATCCAAATGCAC
AAAATAAAAACAACTCCAACAATGCCTTCTCGGAGGATATATTAGAACCG
TGCATTTGTGCATTGCGTCATTTGACGAGCAGACATGAGGAAGCAGAGGC
TGTTCAGACGGCACTTGTTCAACTGCAAGGCTTGTCCTTGCTGATCCGAT
TATTGGAAATGCAACTCGGACAGGATCTGTACTATATGCAAACTCAGCAA
CCAGTCATGCCTAATCTGTTCATGTCCTACAAAATCAACTGGAGTCTCAT
AAAAGCGATCATAGGTCTCATACGGAATATGGCAATGTCATCGTGCAATT
TTGCGTCGATACGAGAACGGGGTTTTGTGTGGCCAATGATTGTTCTAATT
AATCGGGCACAAATCGATGTTGCTAACAAGAATCCGGGTACGTCCGCGGT
GTCATCGAAAGATAAATTGCTCGAAGAAATTATGGAAGTCACATGCGGTG
CATTGCACATGCTCGCTAAGGATCCCGGCATCCGGGCTCAAATTATATCA
ATTAAATTATGGCAGCGTTTAATTTACTGTCCGCAACAAATTGGAATTCA
ATCTGCCATTTACGTGATCGCAAGTCTTCTGTTCAATCATCTTGAATCAA
TTCAACGGGTCGCAGTTGGACTTCTTGTTGAACTGTCTGCGGAACGGATG
GCCTTGGAAATGATAATGGGACATATGGTAATCACCAACAAACTCAACGA
AATGGTGCACTCGAAAAGCGAAGCGGTGGCAACTTACGCATCGGCCATAT
TGATCCGAGCCACAGAAGAAAAAAAATAA
back to top
Gene Groups
beta-catenin is similar in sequence to the genes of this group: GG5233
Gene NameGene ID
SMU15031548SMU15031548
beta-cateninDdo_020132
beta-cateninGsp_006976
Pgr_020799Pgr_020799
beta-cateninPgr_027642
beta-cateninPmo_016711

Gene Group Protein Sequences

>SMU15031548

MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSV
SSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSC
LRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPM
IVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSA
ERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVA
PHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVS
HRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPN
FVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKS
PSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWS
PINK*
>Ddo_020132 beta-catenin
MMNESMNIVNSPQTDDFIIDKTTFTRSWQQNQYLIDSGINSALESHSHSV
SSKHGYDEMESEDQNKNSKEWNYNASNNNVNDGLSNDICMLTPDTPGSSG
CLRHGGEGMADVNLSTCYDGKEENNRNPDFAIDIDKIEAESAIPDLIKLI
SDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEA
VRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLH
NLLLYQEGGKEAVRISGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQP
SKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIRE
GGMDALTNILYHTIQKNTNIESYPQVVPNENNESYPHFSQRLLHNCLWTL
RNLSDAATRLNFDNLLKVLVQILVNAANSFQRQAPHIDTNVITCAAGILS
NLTCNNQYNKITFYKLGGVEAILRTIEWNLALTNPTNVPNKLTQNNYFPD
DIFEPCICTLRHISSRHEDAEAAQAAILHCQGLHILIKIIEMQLGPDLFH
MQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMFSCNFVPIRERGFCW
PMIVLINRAQIDLLNKNACSSISPKDKLLEEIIEVSCGALHMLAKDPGIR
AQITSMKIWQRLISYPQQIGIQPAVYVISSLLFNHLESIQRVAAGLLVEV
SAERLGLELIINQLVITNKLNEMVHSNNEAISTYASAILIRATEEKSKRY
ASSHSYNVVPQNPNNLRNNLSISLPNNQNTNPGYLSSILNSPILHNQSPC
ISHRHNTVAQCGDQTVSNEPICQLNDVEVPDYHMNYSNTLQPQNRYPYNS
NYIDPNYSLINQPGNSDLTMRHFKQLGPINISNECVNQDVQKNFSNTSFK
SPSSHSLSLSGNLCSSSDNSKKEIMDVCMLDTDWIETCSEFSQGHSQKSW
SPINK*
>Gsp_006976 beta-catenin
MMNESMNIVNSPQTDEFINDKTNYTRSWQQNQYLIDSGINSAIESHSHSV
SSKHGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSC
LRHGGEGMADVSLSACYDNKEETNRNAEFAIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTTIESFPPVLPTENNESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNVPNKINQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPM
IVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINFPQQIGTQSSVFVIASLLFNHLESIQRVTAGLLVEVSA
ERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYTA
SHNYNVPQNPNNLRNNLSISLPANQVSNPGYLNSILNSPIMHNQPSCVGH
RHNSVTQCGDQNISTNETCQINDVDVSDYHMTFSNTLQPQNRYSYASNYL
DPNYSLLNQTVNPEISMRQHFKQLGPINISNECINQDIQKTFTNPSFKNP
TSHQMPLTGNLCPSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSP
INK*
>Pgr_020799 Pgr_020799
MSEQMSAMNSPLSEDLINDKTMLTRAWQQNQYLVDSGINSAFETQTHSVS
SRNCCDEMESEDHNKTDWKCLSNINVHDNFLNDVCMLTPDSSSSNLCGRQ
RVDSVSETYSTLNCHITKSGFEKKISLEIDKNEAESAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSQEMISCIIGAMNKADHAETIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLY
QEGGKEAVRLNGCIPKLVTHLQKNNIKFLTICTDCLQILAFNHQPSKIEI
LNNGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHSVQRNSTSSSCQVEVSYEFDESHPQFSQRLLHNCLWTLRNLSD
AATRINFDDLLKILVQILMGSYNSFQKQNMHIDTNAVTCAAGILSNLTCN
NPFNKMALFKVGGVEALIRVIEWNYASLANPYHQNKMNANSNFSEDILEP
CICALRHLTSRHEEAESVQASLIQYQGLSILLRIIEMQLGPDLFHMQPNQ
AVMSNLFISYYEINWNLIKAIIGLIRNMGMSQCNFGFIREKGFVWPMVVL
INRAHIDSVNKNVSSSGTSKDKLLDEIIEVACGALHLLAKDPGIRTQIIS
IKLWQRFINCPQQVGIQSGIYVIASLLYSHLESIQRVAVGLLVELSADRM
ALEMIMSHMVINNKLNEMVHSKSEAVSTYVSAILIRFSEEKNKRYAQIHN
YNVALPNSSNTRTNLAVPLTNNPPNNSTGFLNSILHSPILHNQSTCIGHR
RMPSQCEDQNYINNELLVQINDMDVADIHMNLMSPEDNNRYSYNPNYADI
TCNVVNQPSSVDMRYFKQLSSICPGNENHIRDAVVPYSNATKGRLNNQNV
SNTMNIITTITDNSKMKVSMDMNMYDVDWGETCSEFSHTNSH*
>Pgr_027642 beta-catenin
MNEQMNIVNSPLSDDINDKSNFTRLWQQNQYLVDSGINSALETHTHSVSS
RHGYDEMDSEDQNKKDWKCLSNISINDNFANDICMLTPDSPGSNICGRQG
GEAMADVNLTSGYDANKSECDKEFGLDIDKLEAESAIPDLIKLIKDEDDA
VVINGATRMVFQLSKLDAIDALINSKEMISCLIDAMNKAEHTDTVRYLAG
TIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ
EGGKEAVRISSCIPKLVTLLQKNNMKFLTICTDCLQILAFNHQPSKIEIL
KNCGPLHLIHIIKSYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEAL
TNILYHTIQGNSSVTPYQPDSTNENNDPHPQFSQRLLHNCLWTLRNLSDA
ATRINFDHLLKVLVQILMSSYNSFQRQNIHIDANAVNCAAGILSNLTCNN
QYNKIALFKLGGVEALIRVIEWNFASLNNPNPPNKINSNNTFSEDILEPC
ICALRHLTSRHEEAEAVQASLVQFQGLSLLIRLLEMQLGQDLFYMQTQQP
VTSNLFMSYKINWSLIKAIIGLIRNMAMSSCNFAAIRERGFVWPMIVLIN
RAQIDATNKSPGSTVSSKDKLLDDIMEVTCGALHMLAKDPGIRAQIISIK
LWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAIGLLVELSAERMAL
EMIMSHMVITNRLNEMVHSKSEAVSTYASAILIRATEEKNKRYTPCHNYN
APLQNSACSRPNLSIALSNNQSHNSPGFLNSILHSPVMHNQPPCVSHRHI
PSQCGDQNYINSELLGQIGDMDVSDMQMNYGPPMTPQTRYPYNPGYMDSG
GGCPSSGSSSGIQADMRYFKQTGDCHLQDTQKGGPYASKSKGKDSMDLCM
AEGPDWPDSGSDFSQAHSHKP*
>Pmo_016711 beta-catenin
MNEQMNIVNSPQSDDLINDKSNFTRLWQQNQYLVDSGINSALETHTHSVS
SRHGYDEMDSEDHNKKDWKCLSNISINDNFPNDICMLTPDSPGSNICGRQ
GGEAMADVNLTSGYDGGKIDCEKEFGLDIDKIEAEGAIPDLVKLIKDEDD
AVVINEATMMVFQLSKSDAIDALINSNEMISCIIEAMNKAEHADAIRFLA
GAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSLESVLFYAITTLHNLLLY
QEGGKEAVRSSSCIPKLVTLLLKNNTKFLTICTDCLQILAFNHQPSKIEI
LKNGGPMHLIHIIKNYNYEKLLWTATRVLKVLSVCSANKPVIIREGGIEA
LTNILYHTIQSNSSTAPYQAEPPNENNETHPQFSQRLLHNCLWTLRNLSD
AATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCN
NQFNKIALFKLGGVEALIKVIEWNFASLNNPNAQNKNNSNNAFSEDILEP
CICALRHLTSRHEEAEAVQTALVQLQGLSLLIRLLEMQLGQDLYYMQTQQ
PVMPNLFMSYKINWSLIKAIIGLIRNMAMSSCNFASIRERGFVWPMIVLI
NRAQIDVANKNPGTSAVSSKDKLLEEIMEVTCGALHMLAKDPGIRAQIIS
IKLWQRLIYCPQQIGIQSAIYVIASLLFNHLESIQRVAVGLLVELSAERM
ALEMIMGHMVITNKLNEMVHSKSEAVATYASAILIRATEEKK*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.