odf2, Pmo_015154 (mRNA) Phagocata morgani

Overview
Nameodf2
Unique NamePmo_015154
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length2279
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of odf2 vs. uniprot
Match: gi|74736013|sp|Q5BJF6|ODFP2_HUMAN (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 112.849 bits (281), Expect = 2.45225e-24
Identity = 92/280 (32.86%), Postives = 159/280 (56.79%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2173
+M++R E E Q+ R +EN IL D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E ++ + ++ RE L RQLE+A+ D+RR + +E SK+R+ Q++I DLE QL++ + E + RRS ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P S L++ + P
Sbjct: 550 VMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828

HSP 2 Score: 76.6406 bits (187), Expect = 3.84915e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
PS+ + S G K V RR +R + PW+PP K S +G W TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +Q E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394
BLAST of odf2 vs. uniprot
Match: gi|158513400|sp|A3KGV1|ODFP2_MOUSE (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 110.923 bits (276), Expect = 8.64391e-24
Identity = 90/274 (32.85%), Postives = 158/274 (57.66%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGL--SNP 2149
+M++R E E Q+ R +EN +L D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E + + ++ RE L RQLE+A+ D+RR + +E+ SK+R+ QS+I DLE QL++ + E + RR+ ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P ++ S+P
Sbjct: 550 VMKTRLEADEVAAQLERCDKENKMLKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSQKVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSP 822

HSP 2 Score: 75.485 bits (184), Expect = 1.0978e-12
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
PS+ + S G K V RR +R + PW+PP K S +G W TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +Q E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGTLLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394
BLAST of odf2 vs. uniprot
Match: gi|158564320|sp|Q6AYX5|ODFP2_RAT (RecName: Full=Outer dense fiber protein 2; AltName: Full=84 kDa outer dense fiber protein; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 110.153 bits (274), Expect = 1.77862e-23
Identity = 90/274 (32.85%), Postives = 158/274 (57.66%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGL--SNP 2149
+M++R E E Q+ R +EN +L D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E + + ++ RE L RQLE+A+ D+RR + +E+ SK+R+ QS+I DLE QL++ + E + RR+ ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P ++ S+P
Sbjct: 545 VMKTRLEADEVAAQLERCDKENKMLKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLELAREKHQASQKENKQLSQKVDELERKLEATSTQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARRQVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDVDRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTSSYLTSSP 817

HSP 2 Score: 91.2781 bits (225), Expect = 1.2579e-17
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
S+ P+++HVD++TP+HV + K + + ++ ++ N RR S+ + T M K +R + + +PP + PP+ S L TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +E E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 6 STPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERIKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 389
BLAST of odf2 vs. uniprot
Match: gi|82082176|sp|Q5ZKK5|ODFP2_CHICK (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2)

HSP 1 Score: 109.768 bits (273), Expect = 1.96519e-23
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = 2
Query: 1682 RIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTS 2158
+ EELERK++ QN++ + ++E + + + ++ RE + L RQLE A+ D++R + RE+ S++R+ QS++ DLE QL++ + E + RR+ E+ +R+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVF D L L +P S
Sbjct: 663 KAEELERKLETTSTQNIEFLQVIAKREESIHQCQLRLEEKTRECSSLARQLEMAIEDAKREVEQTRERATSRERAAQSKVLDLETQLSRTKTELNQLRRNKEDAERRYESRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFADSAL---LGSPGRS 818

HSP 2 Score: 102.064 bits (253), Expect = 4.952e-21
Identity = 108/398 (27.14%), Postives = 195/398 (48.99%), Query Frame = 2
Query:   95 LPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIAT-SKLM--GKKKVGSRRIRSMSPPW---VPPPAKTTKGSKSTLGPFWTEDE-ADIGQQERYESKINELMNEVGDLR--YQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD---------ESETLVQALIETE---LSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILK 1222
+ N SS P+++HVD++TP+HV + K +++ +++ N+ N RR ++ + T + M GK V + P + PP S L T++E A + YE KI+ LMN VG L+ +L+K++QR ++ + L+ ++ ++E+ QE+ E EN +LR ++R + E E L+ L E E +A R H ++ + L N+ E H +S DI+ + ++ F+ N LR LL+ +RE ++ L + L + A+ + +LQ + +++ I++L Q+ + ++ + +SLE+V+GHLQ QL+ K + NR++ QIR LE A+ + + E + D LK
Sbjct: 1 MKNRSSSPPLHVHVDENTPVHVHIKKGQKTTPAKCQQKHKQKMKGNTVNVRR----AVQVKTKAPWMPPGKTSVLDSTYKWEGPTHLLEITPPESEKMMSVLRLSDLSTDEEDAVCCKMNEYERKIDSLMNVVGTLKNEAKLQKQEQRQQM--TKRLLEEQKEELNEVTQELAESEHENTLLRRNIERMREEKDLTMLQKKYLQHEKECLLSKLSEAERDGAAAAREIHALKSTIERL-NV--EKH-MSSSDINMLTRQKELLLQKLSTFEETNRTLRELLREQHERERDVQKIL-EKQGVLMKMLADSDAEKLQLQMRLQDKEKEINNLAVQIQEEKEQARTASELSKSLESVRGHLQAQLRHKEAENNRLTTQIRNLERSEAQHKAEVECIKDQLK 387
BLAST of odf2 vs. uniprot
Match: gi|82179654|sp|Q5PQ23|ODFP2_XENLA (RecName: Full=Outer dense fiber protein 2; AltName: Full=Cenexin; AltName: Full=Outer dense fiber of sperm tails protein 2 [Xenopus laevis])

HSP 1 Score: 100.523 bits (249), Expect = 1.12143e-20
Identity = 99/383 (25.85%), Postives = 172/383 (44.91%), Query Frame = 2
Query:   95 LPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPW--------VPPPAKTTKGSKSTLGPFWT-EDEADIGQQERYESKINELMNEVGDLRYQLEKEKQR-------DELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLE 1168
+ N S P+++HVD+ TP+HV + K R K A + + N RR S + T + G +R W + PP S + T E+E + YE KI LM+E+G L+++LE +K+ ++L S L+A ++ + E+ QE+ E EN L+ LDR + +E L+ L+E E Q+ + D ++ L+ +++ DI+ + ++ F+ N LR LL+ Q R+ L + L ++ ++ + LQ ++E++ ++DL QL + D + + +S+E+ K HLQ QL+ + + NR+SVQIR LE
Sbjct: 1 MKNRSPSPPLHVHVDESTPVHVHIKKSSRPPAKTQ-QGAKLKKKGMGNLRR----SATVKTK--VPWIPPGKSSLRDAGLKWEGLTHRLDITPPDTERMFSALRMSDLSTDEEEMKRSKMNSYEEKIATLMSEMGTLKHELELQKREKYLGKCEEQLAASKRLLEAQQEELAEVSQELVETENENVWLKRSLDRIQEEKGLSILQKQQLQEEKAHLLAKLLEAETDGAEAAKQVTLLSDTIQR-LKHEKRMTSTDINLLTRQKELLLQKLNTFEDTNRSLRTLLR-EQHRQETETYRLMEQKEMLLKKLSDADTEKMHLQLKLHEQEEKVEDLLAQLKTEKDLSKTASEVSKSIESTKAHLQGQLRTREAENNRLSVQIRNLE 374
BLAST of odf2 vs. Smed Unigenes AA
Match: SMU15001741 (Asxlregen_comp65555_c0_seq4|m.19436|m.7732)

HSP 1 Score: 726.472 bits (1874), Expect = 0
Identity = 415/724 (57.32%), Postives = 548/724 (75.69%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKST------------------LGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXXEDTIQDXXXXXXXXXXXXXXXMMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2182
MS S+++ SR SSPV+L VDKDTP+HV +DK +R + FN S +RP+KP N+ TS+LM + + R+RSMSPPWVPPP KTTK KST LG +W EDEAD+ Q++RY +I L NEVG+LR QL+ EKQ D+LR + +A+ ++ ++ELKQEID++EKEN +LR L++ ++ + +SE LVQ LIETEL+ RC HQMQHVFD L+NI+ EGHK+S RDIDRI+ FHDTESR+F+FK+++N LR+LLK Q REI + S ++N FL + R+EL++ +L+ + E++ IDDL++QL KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR DDR LKKAARAQKQRA KAE+T+Q L+S+L KE+ +EQLM+ S+E+QE+L + I +EN LH ++ N+ + +I SLK+ENENLRSIADQCE RL+DVE EM+++R + +E D + + + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G + F
Sbjct: 1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 721
BLAST of odf2 vs. Smed Unigenes AA
Match: SMU15005576 (SmedAsxldir_c106665_g2_i15|m.77482|m.8142)

HSP 1 Score: 713.761 bits (1841), Expect = 0
Identity = 415/747 (55.56%), Postives = 548/747 (73.36%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKST------------------LGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGXXXXXXXXXXXXXXXXXXXXEDTIQDXXXXXXXXXXXXXXXMM-----------------------ESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2182
MS S+++ SR SSPV+L VDKDTP+HV +DK +R + FN S +RP+KP N+ TS+LM + + R+RSMSPPWVPPP KTTK KST LG +W EDEAD+ Q++RY +I L NEVG+LR QL+ EKQ D+LR + +A+ ++ ++ELKQEID++EKEN +LR L++ ++ + +SE LVQ LIETEL+ RC HQMQHVFD L+NI+ EGHK+S RDIDRI+ FHDTESR+F+FK+++N LR+LLK Q REI + S ++N FL + R+EL++ +L+ + E++ IDDL++QL KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR DDR LKKAARAQKQRA KAE+T+Q L+S+L KE+ +EQLM+ S+E+QE+L + I +EN LH ++ N+ + +I SLK+ENENLRSIADQCE RL+DVE EM+++R + +E D + + + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G + F
Sbjct: 1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKSYKSTSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMLCQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 744
BLAST of odf2 vs. Smed Unigenes AA
Match: SMU15005577 (SmedAsxldir_c106665_g2_i7|m.77472|m.45171)

HSP 1 Score: 436.802 bits (1122), Expect = 1.02175e-140
Identity = 222/390 (56.92%), Postives = 292/390 (74.87%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
MS S+++ SR SSPV+L VDKDTP+HV +DK +R + FN S +RP+KP N+ TS+LM + + R+RSMSPPWVPPP KTTK KS LG +W EDEAD+ Q++RY +I L NEVG+LR QL+ EKQ D+LR + +A+ ++ ++ELKQEID++EKEN +LR L++ ++ + +SE LVQ LIETEL+ RC HQMQHVFD L+NI+ EGHK+S RDIDRI+ FHDTESR+F+FK+++N LR+LLK Q REI + S ++N FL + R+EL++ +L+ + E++ IDDL++QL KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR
Sbjct: 1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDR 387

HSP 2 Score: 306.99 bits (785), Expect = 1.08113e-91
Identity = 163/272 (59.93%), Postives = 220/272 (80.88%), Query Frame = 2
Query: 1370 MESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2182
+ S+E+QE+L + I +EN LH ++ N+ + +I SLK+ENENLRSIADQCE RL+DVE EM+++R + +E D + + + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G + F
Sbjct: 495 INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 766
BLAST of odf2 vs. Smed Unigenes AA
Match: SMU15005578 (SmedAsxldir_c106665_g2_i9|m.77475|m.37289)

HSP 1 Score: 436.032 bits (1120), Expect = 2.62735e-140
Identity = 222/390 (56.92%), Postives = 292/390 (74.87%), Query Frame = 2
Query:   71 MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKGSKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFD-ESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
MS S+++ SR SSPV+L VDKDTP+HV +DK +R + FN S +RP+KP N+ TS+LM + + R+RSMSPPWVPPP KTTK KS LG +W EDEAD+ Q++RY +I L NEVG+LR QL+ EKQ D+LR + +A+ ++ ++ELKQEID++EKEN +LR L++ ++ + +SE LVQ LIETEL+ RC HQMQHVFD L+NI+ EGHK+S RDIDRI+ FHDTESR+F+FK+++N LR+LLK Q REI + S ++N FL + R+EL++ +L+ + E++ IDDL++QL KNDE+INFASTHESLEN+KGHLQQQLKQKSGD NR+SVQIRTLESELAKERLDKEHL+++LKN KDR
Sbjct: 1 MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSHSIKSTKMKRPRKPGSNVPTSRLM---RSPNERVRSMSPPWVPPPGKTTKTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDR 387

HSP 2 Score: 306.99 bits (785), Expect = 1.05394e-91
Identity = 163/272 (59.93%), Postives = 220/272 (80.88%), Query Frame = 2
Query: 1370 MESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESLRHNLGDE-DSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF 2182
+ S+E+QE+L + I +EN LH ++ N+ + +I SLK+ENENLRSIADQCE RL+DVE EM+++R + +E D + + + +LS+IL+KLE SE +NQ SQ RIE+LERK+KN E+QN ++K+ +QQK+S+ +DN+CKA++LARENA L+RQLEAAL DS+RN+DNAR+K +DR LQSRIH++E+QLA Q+AE+ KW R+CEE +RKC+ KLQD+K+QLEQ+E TNRSM TYVQFLKKSYANVFGD+PLSNGLS PN S +G + F
Sbjct: 504 INSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSF 775
BLAST of odf2 vs. RefSeq Human
Match: gi|767957560|ref|XP_011517032.1| (PREDICTED: outer dense fiber protein 2 isoform X8 [Homo sapiens])

HSP 1 Score: 113.235 bits (282), Expect = 6.80124e-25
Identity = 92/280 (32.86%), Postives = 159/280 (56.79%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2173
+M++R E E Q+ R +EN IL D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E ++ + ++ RE L RQLE+A+ D+RR + +E SK+R+ Q++I DLE QL++ + E + RRS ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P S L++ + P
Sbjct: 633 VMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 911

HSP 2 Score: 91.6633 bits (226), Expect = 3.541e-18
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
S+ P+++HVD++TP+HV + K + + ++ ++ N RR S+ + T M K +R + + +PP + PP+ S L TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +Q E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 94 STPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 477
BLAST of odf2 vs. RefSeq Human
Match: gi|334278913|ref|NP_001229281.1| (outer dense fiber protein 2 isoform 11 [Homo sapiens])

HSP 1 Score: 113.235 bits (282), Expect = 6.89743e-25
Identity = 92/280 (32.86%), Postives = 159/280 (56.79%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2173
+M++R E E Q+ R +EN IL D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E ++ + ++ RE L RQLE+A+ D+RR + +E SK+R+ Q++I DLE QL++ + E + RRS ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P S L++ + P
Sbjct: 545 VMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 823

HSP 2 Score: 92.0485 bits (227), Expect = 2.77826e-18
Identity = 98/394 (24.87%), Postives = 193/394 (48.98%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLR-NSNNPRRPKKPSINIATS-KLMGKKKVGSRRI--RSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
S+ P+++HVD++TP+HV + K + + ++ ++ N RR S+ + T M K +R + + +PP + PP+ S L TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +E E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 6 STPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRR----SVRVKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKE--DSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 389
BLAST of odf2 vs. RefSeq Human
Match: gi|310750400|ref|NP_702913.1| (outer dense fiber protein 2 isoform 1 [Homo sapiens])

HSP 1 Score: 113.235 bits (282), Expect = 7.50943e-25
Identity = 92/280 (32.86%), Postives = 159/280 (56.79%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2173
+M++R E E Q+ R +EN IL D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E ++ + ++ RE L RQLE+A+ D+RR + +E SK+R+ Q++I DLE QL++ + E + RRS ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P S L++ + P
Sbjct: 614 VMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 892

HSP 2 Score: 93.2041 bits (230), Expect = 1.31793e-18
Identity = 95/390 (24.36%), Postives = 189/390 (48.46%), Query Frame = 2
Query:  110 SSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDRLRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPW---VPPPAKTTKGSKSTLGPFWTEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
S+ P+++HVD++TP+HV + K + + ++ R K ++N+ S R+++ +PP + PP+ S L TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +Q E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 94 STPPLHVHVDENTPVHVHIKKLPKPSATSS---------QKSHKRGMKGDTVNVRRSV----------RVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 458
BLAST of odf2 vs. RefSeq Human
Match: gi|310750408|ref|NP_702911.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 112.849 bits (281), Expect = 9.25498e-25
Identity = 92/280 (32.86%), Postives = 159/280 (56.79%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2173
+M++R E E Q+ R +EN IL D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E ++ + ++ RE L RQLE+A+ D+RR + +E SK+R+ Q++I DLE QL++ + E + RRS ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P S L++ + P
Sbjct: 550 VMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828

HSP 2 Score: 76.6406 bits (187), Expect = 1.4527e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
PS+ + S G K V RR +R + PW+PP K S +G W TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +Q E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394
BLAST of odf2 vs. RefSeq Human
Match: gi|334278916|ref|NP_001229282.1| (outer dense fiber protein 2 isoform 2 [Homo sapiens])

HSP 1 Score: 112.849 bits (281), Expect = 9.25498e-25
Identity = 92/280 (32.86%), Postives = 159/280 (56.79%), Query Frame = 2
Query: 1367 MMESR-ENQEQLGQMNRIAEENDILHDKINNSHYDSVIHSLKRENENLRSIAD----------QCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDXXXXXXXXXXXXMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGGP 2173
+M++R E E Q+ R +EN IL D++N ++ + + +L+ + D +C+ +L+ E + L + D SR + ++L +K ++S+ N+ +++ELERK++ QN++ + ++E ++ + ++ RE L RQLE+A+ D+RR + +E SK+R+ Q++I DLE QL++ + E + RRS ++ DR+ +LQD+K +LEQ+E+TNRSM YVQFLK SYANVFGD P S L++ + P
Sbjct: 550 VMKTRLEADEVAAQLERCDKENKILKDEMNK-EIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP 828

HSP 2 Score: 76.6406 bits (187), Expect = 1.4527e-13
Identity = 91/369 (24.66%), Postives = 170/369 (46.07%), Query Frame = 2
Query:  257 PSINIATSKLMGKK--KVGSRR-IRSMSP-PWVPPPAKTTKGSKSTLGPFW---------------------------TEDEADIG--QQERYESKINELMNEVGDLRYQLEKEKQRDELRRSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKF---------DESETLVQALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTESRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLNDELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQKSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDR 1237
PS+ + S G K V RR +R + PW+PP K S +G W TED+ D G + RY+ KI+ LMN VG L+ ++ + Q+ E + + L+ ++ ++E+ E+ E EN +LRH ++R + F E E L+ L+E E+ Q+ + D + L+ +++ DI+ + ++ F+ N LR+LL+ +Q E L + L +R AE ++ L + ++D +++L +++ + + + +S+E+++GHLQ QL+ K + +R+ +QI+ LE + + + E +M+ LK K +
Sbjct: 36 PSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP----GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDD-DSGHCKMNRYDKKIDSLMNAVGCLKSEV--KMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGK-LKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLR--EQHCKEDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQK 394
The following BLAST results are available for this feature:
BLAST of odf2 vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|74736013|sp|Q5BJF6|ODFP2_HUMAN2.452250e-2432.86RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158513400|sp|A3KGV1|ODFP2_MOUSE8.643910e-2432.85RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|158564320|sp|Q6AYX5|ODFP2_RAT1.778620e-2332.85RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82082176|sp|Q5ZKK5|ODFP2_CHICK1.965190e-2340.88RecName: Full=Outer dense fiber protein 2; AltName... [more]
gi|82179654|sp|Q5PQ23|ODFP2_XENLA1.121430e-2025.85RecName: Full=Outer dense fiber protein 2; AltName... [more]
back to top
BLAST of odf2 vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 4
Match NameE-valueIdentityDescription
SMU150017410.000000e+057.32Asxlregen_comp65555_c0_seq4|m.19436|m.7732[more]
SMU150055760.000000e+055.56SmedAsxldir_c106665_g2_i15|m.77482|m.8142[more]
SMU150055771.021750e-14056.92SmedAsxldir_c106665_g2_i7|m.77472|m.45171[more]
SMU150055782.627350e-14056.92SmedAsxldir_c106665_g2_i9|m.77475|m.37289[more]
back to top
BLAST of odf2 vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|767957560|ref|XP_011517032.1|6.801240e-2532.86PREDICTED: outer dense fiber protein 2 isoform X8 ... [more]
gi|334278913|ref|NP_001229281.1|6.897430e-2532.86outer dense fiber protein 2 isoform 11 [Homo sapie... [more]
gi|310750400|ref|NP_702913.1|7.509430e-2532.86outer dense fiber protein 2 isoform 1 [Homo sapien... [more]
gi|310750408|ref|NP_702911.1|9.254980e-2532.86outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
gi|334278916|ref|NP_001229282.1|9.254980e-2532.86outer dense fiber protein 2 isoform 2 [Homo sapien... [more]
back to top
BLAST of odf2 vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_015154 ID=Pmo_015154|Name=odf2|organism=Phagocata morgani|type=mRNA|length=2279bp
TTACATTGTAAATTTTACCATATAATTATAACTCTATAATTAACTCTTTT
AATTATTTACATTTGAAATTATGTCTTACAATTACTCAAGAAAATTGCCA
AATAGTCGTTCATCAAGTCCAGTTTATTTGCATGTTGATAAAGACACTCC
GATTCATGTATGTGTGGATAAAGATGAAAGAAGTGATACTAAAAATGGAT
TTAATGATGCAAGTGATAGATTAAGAAATAGTAATAATCCAAGAAGACCA
AAAAAACCTAGTATTAACATTGCGACATCAAAATTAATGGGCAAAAAGAA
AGTCGGAAGCAGACGAATCAGATCTATGTCACCACCATGGGTTCCACCAC
CTGCTAAAACTACAAAAGGATCCAAGTCCACATTGGGTCCATTTTGGACT
GAAGATGAGGCCGACATAGGTCAACAAGAACGTTATGAATCAAAGATTAA
TGAGCTGATGAATGAAGTTGGAGACTTGAGATATCAGCTGGAGAAAGAAA
AGCAGCGGGATGAATTACGGAGAAGTAATGAGGCTCTAAAGGCTCACGAG
GACACAATTGATGAATTAAAACAAGAGATTGATTTGGTGGAGAAGGAGAA
TGACATTCTGAGGCACGGCCTTGATCGCGGCCACAATGATCCAAAGTTTG
ATGAGTCAGAGACACTGGTTCAAGCGTTGATCGAGACCGAATTATCTGCG
GGTCGGTGTCAGCATCAGATGCAGCACGTGTTCGATAATTTGAAGAACAT
CCTTCGGGAAGGACACAAGATCAGCGGGAGAGATATCGATCGCATTAATG
GATTCTTCCACGATACAGAATCCCGGATGTTCGAGTTCAAGGCAGTGAAC
AATGAGCTGAGAAATTTGCTGAAGTGTTTCCAGCAGCGGGAGATCGTGGC
GCGCGAGTCTTTGGCCCAGGACAATTCCTTCTTACAGCAGAGACGGGCAG
AGTTAGAGAATTTGAATGACGAGTTACAGAGGGCCATGAACGAGCGAGAT
GTTACGATTGACGATCTGCGCAGACAATTGGCGAGGAAAAATGACGAGAC
TATCAACTTTGCGTCGACCCACGAGTCCCTGGAGAATGTCAAGGGGCACT
TGCAGCAGCAGTTGAAGCAAAAGTCCGGTGACATTAACCGCATGTCCGTT
CAAATCCGTACCCTTGAAAGTGAATTGGCAAAAGAACGTTTGGACAAAGA
ACATCTGATGGACATTTTGAAAAACAGCAAAGACCGAACCGGGGACGATA
GGGATGCATTGAAGAAGGCCGCTCGGGCGCAGAAACAGAGGGCTCAGAAG
GCAGAAGACACAATCCAAGATTTGTCATCTCTGCTTGCCGAGAAGGAGAA
GCAGCTAGAGCAATTGATGATGGAAAGTCGAGAAAATCAGGAGCAACTTG
GACAGATGAACAGAATCGCTGAGGAGAACGATATTCTCCACGATAAGATC
AACAATTCCCATTACGACAGCGTGATCCATTCATTGAAAAGAGAAAATGA
GAACTTGCGATCAATAGCTGACCAGTGCGAGGTCAGACTAAAGGACGTAG
AACTAGAGATGGAGTCCCTACGACACAATCTTGGGGACGAAGACAGTAGG
GATGACAGCAACTTGGAGAGGTTGTCACAAATCCTTCAGAAGCTTGAGTC
CTCAGAAAATGCCAACCAAGTCAGTCAGACACGTATCGAAGAATTGGAAA
GAAAGATAAAGAATTGTGAAAATCAAAATTTGGATCTAAAGCACAATGTT
CAACAAAAGGAAAGTAATGCCTTAGATAATCGTTGTAAAGCCGATGATTT
AGCAAGGGAGAATGCGGGTCTTGTACGTCAACTGGAAGCTGCCTTGAATG
ATTCTCGCAGAAATGCTGACAATGCTCGAGAAAAGATCAACAGCAAAGAT
CGCAGTCTACAGTCACGAATCCATGATTTGGAAGCCCAATTAGCTCAGCA
AAGGGCCGAAGCAATGAAATGGCGGCGCAGTTGTGAAGAGAATGATCGGA
AATGTAGTGGCAAATTGCAGGACATCAAGGTCCAATTGGAGCAAGCAGAG
ACCACCAATCGCAGTATGCACACCTACGTACAGTTCCTGAAGAAGTCCTA
TGCCAATGTATTCGGAGACATTCCGCTGTCAAATGGACTCAGTAATCCGA
ACACATCCAACCTCGGTGGTCCGATATGCTTCTGAAGATATTCTATGCTA
CTGTTACCTTTCAGTTATTAAATTTGATATTTTTAGTTGGGTTATACTCT
TCGAATATATGTTGATGTTTCGTAAAAAA

Design Primers for odf2

back to top

protein sequence

>Pmo_015154-protein ID=Pmo_015154-protein|Name=odf2|organism=Phagocata morgani|type=polypeptide|length=705bp
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMMESRENQEQLGQMNRIA
EENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESL
RHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCE
NQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNAD
NAREKINSKDRSLQSRIHDLEAQLAQQRAEAMKWRRSCEENDRKCSGKLQ
DIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGG
PICF*
back to top

coding sequence

>Pmo_015154.71.2185 ID=Pmo_015154.71.2185|Name=Pmo_015154.71.2185|organism=Phagocata morgani|type=CDS|length=2115bp
ATGTCTTACAATTACTCAAGAAAATTGCCAAATAGTCGTTCATCAAGTCC
AGTTTATTTGCATGTTGATAAAGACACTCCGATTCATGTATGTGTGGATA
AAGATGAAAGAAGTGATACTAAAAATGGATTTAATGATGCAAGTGATAGA
TTAAGAAATAGTAATAATCCAAGAAGACCAAAAAAACCTAGTATTAACAT
TGCGACATCAAAATTAATGGGCAAAAAGAAAGTCGGAAGCAGACGAATCA
GATCTATGTCACCACCATGGGTTCCACCACCTGCTAAAACTACAAAAGGA
TCCAAGTCCACATTGGGTCCATTTTGGACTGAAGATGAGGCCGACATAGG
TCAACAAGAACGTTATGAATCAAAGATTAATGAGCTGATGAATGAAGTTG
GAGACTTGAGATATCAGCTGGAGAAAGAAAAGCAGCGGGATGAATTACGG
AGAAGTAATGAGGCTCTAAAGGCTCACGAGGACACAATTGATGAATTAAA
ACAAGAGATTGATTTGGTGGAGAAGGAGAATGACATTCTGAGGCACGGCC
TTGATCGCGGCCACAATGATCCAAAGTTTGATGAGTCAGAGACACTGGTT
CAAGCGTTGATCGAGACCGAATTATCTGCGGGTCGGTGTCAGCATCAGAT
GCAGCACGTGTTCGATAATTTGAAGAACATCCTTCGGGAAGGACACAAGA
TCAGCGGGAGAGATATCGATCGCATTAATGGATTCTTCCACGATACAGAA
TCCCGGATGTTCGAGTTCAAGGCAGTGAACAATGAGCTGAGAAATTTGCT
GAAGTGTTTCCAGCAGCGGGAGATCGTGGCGCGCGAGTCTTTGGCCCAGG
ACAATTCCTTCTTACAGCAGAGACGGGCAGAGTTAGAGAATTTGAATGAC
GAGTTACAGAGGGCCATGAACGAGCGAGATGTTACGATTGACGATCTGCG
CAGACAATTGGCGAGGAAAAATGACGAGACTATCAACTTTGCGTCGACCC
ACGAGTCCCTGGAGAATGTCAAGGGGCACTTGCAGCAGCAGTTGAAGCAA
AAGTCCGGTGACATTAACCGCATGTCCGTTCAAATCCGTACCCTTGAAAG
TGAATTGGCAAAAGAACGTTTGGACAAAGAACATCTGATGGACATTTTGA
AAAACAGCAAAGACCGAACCGGGGACGATAGGGATGCATTGAAGAAGGCC
GCTCGGGCGCAGAAACAGAGGGCTCAGAAGGCAGAAGACACAATCCAAGA
TTTGTCATCTCTGCTTGCCGAGAAGGAGAAGCAGCTAGAGCAATTGATGA
TGGAAAGTCGAGAAAATCAGGAGCAACTTGGACAGATGAACAGAATCGCT
GAGGAGAACGATATTCTCCACGATAAGATCAACAATTCCCATTACGACAG
CGTGATCCATTCATTGAAAAGAGAAAATGAGAACTTGCGATCAATAGCTG
ACCAGTGCGAGGTCAGACTAAAGGACGTAGAACTAGAGATGGAGTCCCTA
CGACACAATCTTGGGGACGAAGACAGTAGGGATGACAGCAACTTGGAGAG
GTTGTCACAAATCCTTCAGAAGCTTGAGTCCTCAGAAAATGCCAACCAAG
TCAGTCAGACACGTATCGAAGAATTGGAAAGAAAGATAAAGAATTGTGAA
AATCAAAATTTGGATCTAAAGCACAATGTTCAACAAAAGGAAAGTAATGC
CTTAGATAATCGTTGTAAAGCCGATGATTTAGCAAGGGAGAATGCGGGTC
TTGTACGTCAACTGGAAGCTGCCTTGAATGATTCTCGCAGAAATGCTGAC
AATGCTCGAGAAAAGATCAACAGCAAAGATCGCAGTCTACAGTCACGAAT
CCATGATTTGGAAGCCCAATTAGCTCAGCAAAGGGCCGAAGCAATGAAAT
GGCGGCGCAGTTGTGAAGAGAATGATCGGAAATGTAGTGGCAAATTGCAG
GACATCAAGGTCCAATTGGAGCAAGCAGAGACCACCAATCGCAGTATGCA
CACCTACGTACAGTTCCTGAAGAAGTCCTATGCCAATGTATTCGGAGACA
TTCCGCTGTCAAATGGACTCAGTAATCCGAACACATCCAACCTCGGTGGT
CCGATATGCTTCTGA
back to top
Gene Groups
odf2 is similar in sequence to the genes of this group: GG437
Gene NameGene ID
SMU15001741SMU15001741
SMU15005576SMU15005576
SMU15005577SMU15005577
SMU15005578SMU15005578
Ddo_003032Ddo_003032
Ddo_005045Ddo_005045
Ddo_009916Ddo_009916
Ddo_012914Ddo_012914
Gsp_000977Gsp_000977
Gsp_002888Gsp_002888
Gsp_019027Gsp_019027
Gsp_023053Gsp_023053
Pgr_024273Pgr_024273
Pmo_012872Pmo_012872
odf2Pmo_015154

Gene Group Protein Sequences

>SMU15001741

MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLMI
NSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIAD
QCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQ
SSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENAS
LMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNK
WHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGD
MPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005576
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKSYKS
TSVRWNARKCRYVNTLKSPLGSYWNEDEADLSQEDRYMQQITNLQNEVGE
LREQLKYEKQCDQLRDTQDAIDCQDEKLEELKQEIDVMEKENHLLRDSLE
KTRSNLNLNSDSERLVQILIETELAGERCAHQMQHVFDCLRNIMTEGHKV
SSRDIDRISTLFHDTESRLFDFKSLSNSLRDLLKIVQLREISGQNSTEKE
NLFLSKIRSELDDNISKLELELLEKEKIIDDLKKQLTNKNDESINFASTH
ESLENIKGHLQQQLKQKSGDCNRLSVQIRTLESELAKERLDKEHLIELLK
NPKDREYDDRGVLKKAARAQKQRALKAEETVQQLTSILTAKERHIEQLML
CQNDRALVQSSKSFVNQFVQCEINSQEDQEKLRHLEDIYDENQHLHQQMA
NNDQEEIIFSLKKENENLRSIADQCESRLRDVEREMKNVRRTMAEENDDK
SEEQVNKLSKILEKLEMSEKSNQSSQIRIEDLERKLKNLESQNFEMKNVL
QQKDSSFIDNKCKAEELARENASLMRQLEAALTDSKRNSDNARDKNVGRD
RQLQSRIHEIESQLAHQKAESNKWHRNCEETERKCNTKLQDMKIQLEQSE
ITNRSMQTYVQFLKKSYANVFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>SMU15005577
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSLCQNDGALVQSSKSFVNQFVQCEINSQED
QEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLRSIADQCESR
LRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSEKSNQSSQIR
IEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELARENASLMRQL
EAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKAESNKWHRNC
EETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYANVFGDMPLSN
GLSCPNPSYMGQSLSFNGF*
>SMU15005578
MSIKNSKQISRSRPSSPVHLFVDKDTPVHVYMDKGDRDPYNSDFNAPKSH
SIKSTKMKRPRKPGSNVPTSRLMRSPNERVRSMSPPWVPPPGKTTKTLKS
PLGSYWNEDEADLSQEDRYMQQITNLQNEVGELREQLKYEKQCDQLRDTQ
DAIDCQDEKLEELKQEIDVMEKENHLLRDSLEKTRSNLNLNSDSERLVQI
LIETELAGERCAHQMQHVFDCLRNIMTEGHKVSSRDIDRISTLFHDTESR
LFDFKSLSNSLRDLLKIVQLREISGQNSTEKENLFLSKIRSELDDNISKL
ELELLEKEKIIDDLKKQLTNKNDESINFASTHESLENIKGHLQQQLKQKS
GDCNRLSVQIRTLESELAKERLDKEHLIELLKNPKDREYDDRGVLKKAAR
AQKQRALKAEETVQQLTSILTAKERHIEQLMHSKTTRNHASAVSNHCDHC
PEANKHHHKNDDLPIQTYWPSAQFGHATRTRHHGRRHYGDYQDHDSSDSF
SNTINSQEDQEKLRHLEDIYDENQHLHQQMANNDQEEIIFSLKKENENLR
SIADQCESRLRDVEREMKNVRRTMAEENDDKSEEQVNKLSKILEKLEMSE
KSNQSSQIRIEDLERKLKNLESQNFEMKNVLQQKDSSFIDNKCKAEELAR
ENASLMRQLEAALTDSKRNSDNARDKNVGRDRQLQSRIHEIESQLAHQKA
ESNKWHRNCEETERKCNTKLQDMKIQLEQSEITNRSMQTYVQFLKKSYAN
VFGDMPLSNGLSCPNPSYMGQSLSFNGF*
>Ddo_003032 Ddo_003032
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLQSKSHADLEDGNDELLSKPLTELCDQCKLNSREYQQNLRHIDDIVE
ENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKEMKILR
KTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKKIRNLE
GQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDSRRNAD
NVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKNSSKLQ
DLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQ
SSLNFGGF*
>Ddo_005045 Ddo_005045
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRSSRSSLVHRYLCKWDDANSKSSFGSFWNEDEADFSQQERYEQQINDLL
NEVGELQEQLKIEKQREQLRNSHEALHYQEGKIEELKQEIDVIEKENHIL
RDSLDKTRSNLDLDSESEKLIQTLIEAELASERCAHQMQHVFDSLKNIVK
EGHKVTGRDVDRLSTLFHDTESRLFDFKSISNVLRDMLKESQQREMYRND
SLEKDNNFLIKMRNELDENISKLELELSDKDKVIDDLRKQLVSKNDETIN
FASTHESLESVKGHLQQQLKQKSGDCNRMSVQIRTLENELAKERLDKEHL
MEMLKGSKDRTYDDRDALKKAARLQKQRALKGEETIQELTAILAEKERHI
EQLLLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEIIIALKRENENL
RSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINRLSKILEKLEAS
EKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLM
RENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRIHDAESQLAQQR
AETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYA
NVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Ddo_009916 Ddo_009916
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLLNSREYQQNLRHI
DDIVEENEQLRRKMLNSNQEEIIIALKRENENLRSIADQCESRLKDVEKE
MKILRKTMSEDNDDQNTDKINRLSKILEKLEASEKSNQASQTRIEELEKK
IRNLEGQNLEMKNTIQLKDSSVIDNRCKADDLMRENSSLMRQLEAALTDS
RRNADNVREKNVGKDRQLQSRIHDAESQLAQQRAETNKWRRNCEETERKN
SSKLQDLKIQLEQAEITNRSLQTYVQFLKKSYANVFGDLPLSNGLSCPNN
SFVPQSSLNFGGF*
>Ddo_012914 Ddo_012914
MSHKLVKSVQRNRPASPVHLYVDKSTPVHVYVENGERDESMVDMDARAPG
RTDASRAGKIRRPRKPGSRVSARPLARAVPSAVHRVRSMSPPWVPPPGKT
SRNSKSSFGSFWNEDEADFSQQERYEQQINDLLNEVGELQEQLKIEKQRE
QLRNSHEALHYQEGKIEELKQEIDVIEKENHILRDSLDKTRSNLDLDSES
EKLIQTLIEAELASERCAHQMQHVFDSLKNIVKEGHKVTGRDVDRLSTLF
HDTESRLFDFKSISNVLRDMLKESQQREMYRNDSLEKDNNFLIKMRNELD
ENISKLELELSDKDKVIDDLRKQLVSKNDETINFASTHESLESVKGHLQQ
QLKQKSGDCNRMSVQIRTLENELAKERLDKEHLMEMLKGSKDRTYDDRDA
LKKAARLQKQRALKGEETIQELTAILAEKERHIEQLLQSKSHADLEDGND
ELLSKPLTELCDQCKLNSREYQQNLRHIDDIVEENEQLRRKMLNSNQEEI
IIALKRENENLRSIADQCESRLKDVEKEMKILRKTMSEDNDDQNTDKINR
LSKILEKLEASEKSNQASQTRIEELEKKIRNLEGQNLEMKNTIQLKDSSV
IDNRCKADDLMRENSSLMRQLEAALTDSRRNADNVREKNVGKDRQLQSRI
HDAESQLAQQRAETNKWRRNCEETERKNSSKLQDLKIQLEQAEITNRSLQ
TYVQFLKKSYANVFGDLPLSNGLSCPNNSFVPQSSLNFGGF*
>Gsp_000977 Gsp_000977
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLIMNSREDQDNLRRMDEIIDE
NQHLHRQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRR
TMAEENDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLEN
QNFEMKTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADN
SREKTVGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQD
LKLQLEQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQS
LSFGGF*
>Gsp_002888 Gsp_002888
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKTGKS
CLGSFWNEEEAGFSQQDRYEQQINELQDELGELREQLKIEKEREQIRNSE
DTIQYQDEKIEELKQEIDVMEKENHLLRDSLENTRSNMNLFPESDKLIQM
LIEAELASERCAHQMQHVFDYLKSTIKEGHKITSRDVDRINTQFHDTESR
LFEFKSVNNTLRDLLKDAQQREINGQNSFEKDKTFLSKVRKELEDSISKL
ELELFDKDKVIDDLRKQLACKNDETINFASTHESLENVKGHLQQQLKQRS
GDINRMSVQIRTLESELAKERLDKEHLIELLKNPKDRGLDDRDVLKKAAR
AQKQRAIKAEETIQELTAILAEKERHIEHLISNQNQNETKSDSIPVIKSF
NNQYVQCEMNSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRE
NDSLRSIADQCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEK
LETSEKSNQTSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKT
EELIRENASLTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQL
AQQRAEANKWRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLK
KSYANVFGDIPLSNGLSCPNPPYIGQSLSFGGF*
>Gsp_019027 Gsp_019027
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIS
NQNQNETKSDSIPVIKSFNNQYVQCEMNSREDQDNLRRMDEIIDENQHLH
RQIVSNDQEDLIISLKRENDSLRSIADQCESRLRDVEREMKTLRRTMAEE
NDDQNDEQVNKLAKILEKLETSEKSNQTSQIRIEDLERKIKSLENQNFEM
KTSLQLKDGNVIDNKCKTEELIRENASLTRQLEAALTDSRRNADNSREKT
VGKDRQLQSRVHDIETQLAQQRAEANKWRRNSEEIERKCNSKLQDLKLQL
EQSEITNRSMQTYVQFLKKSYANVFGDIPLSNGLSCPNPPYIGQSLSFGG
F*
>Gsp_023053 Gsp_023053
MMSHEFSKRIPRSRPSSPVHVFVDKDTPVHVYMRKGENDQYNSEFTQPRS
NSRSNKMKRPKKPGSNIPTSKLMRNSNERVRSMSPPWVPPPGKTTKNHRS
ELVNRYMCKCDFENTGKSCLGSFWNEEEAGFSQQDRYEQQINELQDELGE
LREQLKIEKEREQIRNSEDTIQYQDEKIEELKQEIDVMEKENHLLRDSLE
NTRSNMNLFPESDKLIQMLIEAELASERCAHQMQHVFDYLKSTIKEGHKI
TSRDVDRINTQFHDTESRLFEFKSVNNTLRDLLKDAQQREINGQNSFEKD
KTFLSKVRKELEDSISKLELELFDKDKVIDDLRKQLACKNDETINFASTH
ESLENVKGHLQQQLKQRSGDINRMSVQIRTLESELAKERLDKEHLIELLK
NPKDRGLDDRDVLKKAARAQKQRAIKAEETIQELTAILAEKERHIEHLIM
NSREDQDNLRRMDEIIDENQHLHRQIVSNDQEDLIISLKRENDSLRSIAD
QCESRLRDVEREMKTLRRTMAEENDDQNDEQVNKLAKILEKLETSEKSNQ
TSQIRIEDLERKIKSLENQNFEMKTSLQLKDGNVIDNKCKTEELIRENAS
LTRQLEAALTDSRRNADNSREKTVGKDRQLQSRVHDIETQLAQQRAEANK
WRRNSEEIERKCNSKLQDLKLQLEQSEITNRSMQTYVQFLKKSYANVFGD
IPLSNGLSCPNPPYIGQSLSFGGF*
>Pgr_024273 Pgr_024273
MSYSYSKKLQNSRSSSPVYLHVDKDTPIHVYLDKDESNDIKSGFNAASDG
LQSFNNSRRPKKPGVNIKTSKLMGKKKAENSKRIRSMSPPWVPPPGKTTR
GSKTPLGPFWNEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQQDEL
RRSNDALRAHEDTIDELKQEIDLVEKENDLLRHSLDKGQHDSQLDESDHL
IQALIETELSAGRCQHQMQHVFDNLKNILREGHKITGRDIDRINGYFHDT
ESRMFEFKNVNNDLRSLLKSFQQREIRARESLAQDNSFLQERRAELERLN
DTLECAMNDKDVTIDELRRQLAKKSDESINFASTHESLENVKGHLQQQLK
QKSGDCNRMAVQIRTLESELAKERLDKEHLMDILKNSKDRTVDDRDSLKK
AARLQKQRAQKAEETIHDLSSLLAEKERQLEKLMAQFGITNHGTDPGQHC
AHCADYDHSESSFQTIDSRENQEKLGQMQRIADENEILHDKMNHSNHESV
IISLKRENDNLRSIADQCEVRLKDVEREMESLRRNIGDEDSRDDSQIEKL
SLILQKLEVSEKANQLSQSRIEELERKIKGCENQNLDLKNSLQQKESSVI
DNRCKADDLARENAALMRQLEAALSDSRRNADNAREKISSKDRGLQSRIH
DLEAQLAQQRAEAMKWRRNFEENERKCSSKMQDIKIQLEQAETTNRSMHT
YVQFLKKSYSNVFGDMPLPNGLSNPASSQIGGPICF*
>Pmo_012872 Pmo_012872
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMSEFGVPNHISEPNRHCS
HCVDYDASESSSMESRENQEQLGQMNRIAEENDILHDKINNSHYDSVIHS
LKRENENLRSIADQCEVRLKDVELEMESLRHNLGDEDSRDDSNLERLSQI
LQKLESSENANQVSQTRIEELERKIKNCENQNLDLKHNVQQKESNALDNR
CKADDLARENAGLVRQLEAALNDSRRNADNAREKINSKDRSLQSRIHDLE
AQLAQQRAEAMKWRRSCEENDRKCSGKLQDIKVQLEQAETTNRSMHTYVQ
FLKKSYANVFGDIPLSNGLSNPNTSNLGGPICF*
>Pmo_015154 odf2
MSYNYSRKLPNSRSSSPVYLHVDKDTPIHVCVDKDERSDTKNGFNDASDR
LRNSNNPRRPKKPSINIATSKLMGKKKVGSRRIRSMSPPWVPPPAKTTKG
SKSTLGPFWTEDEADIGQQERYESKINELMNEVGDLRYQLEKEKQRDELR
RSNEALKAHEDTIDELKQEIDLVEKENDILRHGLDRGHNDPKFDESETLV
QALIETELSAGRCQHQMQHVFDNLKNILREGHKISGRDIDRINGFFHDTE
SRMFEFKAVNNELRNLLKCFQQREIVARESLAQDNSFLQQRRAELENLND
ELQRAMNERDVTIDDLRRQLARKNDETINFASTHESLENVKGHLQQQLKQ
KSGDINRMSVQIRTLESELAKERLDKEHLMDILKNSKDRTGDDRDALKKA
ARAQKQRAQKAEDTIQDLSSLLAEKEKQLEQLMMESRENQEQLGQMNRIA
EENDILHDKINNSHYDSVIHSLKRENENLRSIADQCEVRLKDVELEMESL
RHNLGDEDSRDDSNLERLSQILQKLESSENANQVSQTRIEELERKIKNCE
NQNLDLKHNVQQKESNALDNRCKADDLARENAGLVRQLEAALNDSRRNAD
NAREKINSKDRSLQSRIHDLEAQLAQQRAEAMKWRRSCEENDRKCSGKLQ
DIKVQLEQAETTNRSMHTYVQFLKKSYANVFGDIPLSNGLSNPNTSNLGG
PICF*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.