frizzled-like, Pmo_014048 (mRNA) Phagocata morgani

Overview
Namefrizzled-like
Unique NamePmo_014048
TypemRNA
OrganismPhagocata morgani (P. morgani)
Sequence length2082
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Phagocata morgani Transcriptome2016-03-03
Phagocata morgani BLASTX Schmidtea mediterranea2016-03-09
Phagocata morgani BLASTX Human2016-03-09
Phagocata morgani BLASTX Drosophila melanogaster2016-03-09
Phagocata morgani BLASTX Swissprot Uniprot2016-03-08
Phagocata morgani CDS2016-05-06
Homology
BLAST of frizzled-like vs. uniprot
Match: gi|17433078|sp|Q9R216|FZD9_MOUSE (RecName: Full=Frizzled-9; Short=Fz-9; Short=mFz3; Short=mFz9; AltName: CD_antigen=CD349; Flags: Precursor)

HSP 1 Score: 334.339 bits (856), Expect = 2.48952e-103
Identity = 199/523 (38.05%), Postives = 292/523 (55.83%), Query Frame = 2
Query:   98 CTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVK--FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLD--FLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
C + P+C+ + Y TRMPN +G SQ EA+ ++ ++ PL+ C ++L+ FLCS+Y P+C + +STP+ CR C + RC P M ++ WP+ LDC +LP+ D +L E + + T + + + + G + C + + SC RC V+ ++ DK FA +W+ WS LC S+ T+ TF RF YPE+PI+FLS+CY YS L+ AV G ++V C D++ +++ G E T C + FL+LY+F AS+LWWVVLT+TWFL+A + WG+EAIE+ S H+ +WG+PALK+I VL L K+ DELTG CYV + D AL GF+LVP YLV G +FL G+ ++ +RK + TN ++LEKLM KIGVFSILY VP TC I+ YV + ++ L E TV G + + ++P++ V ML+IFM+LV+GITSG+W+W +K
Sbjct: 40 CQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQ--VSTPI-PACRPMCEQARLRCAPIMEQ-FNFGWPDSLDCARLPTRN------DPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGD----SAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC---DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRK-----IMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRAT---EQPCTAATVPGGR----RDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 533
BLAST of frizzled-like vs. uniprot
Match: gi|17432964|sp|O00144|FZD9_HUMAN (RecName: Full=Frizzled-9; Short=Fz-9; Short=hFz9; AltName: Full=FzE6; AltName: CD_antigen=CD349; Flags: Precursor)

HSP 1 Score: 327.791 bits (839), Expect = 7.84215e-101
Identity = 200/523 (38.24%), Postives = 293/523 (56.02%), Query Frame = 2
Query:   98 CTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVK--FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLD--FLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
C + P+C+ + Y TRMPN +G SQ EA+ + ++ PL+ C ++L+ FLCS+Y P+C + +STP+ CR C + RC P M ++ WP+ LDC +LP+ P + ++ + K L DL AG S C + + SC RC V+ ++ DK FA +W+ WS LC S+ T++TF RF YPE+PI+FLS+CY YS L+ AV G ++V C D++ +++ G E T C + FL+LY+F AS+LWWVVLT+TWFL+A + WG+EAIE+ S H+ +WG+PALK+I +L L K+ DELTG CYV ++D AL GF+LVP YLV G +FL G+ ++ +RK + TN ++LEKLM KIGVFSILY VP TC I+ YV + ++ L+A + A G + + ++P++ V ML+IFM+LV+GITSG+W+W +K
Sbjct: 39 CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQ--VSTPI-PACRPMCEQARLRCAPIMEQ-FNFGWPDSLDCARLPTRND----PHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPG----DLGPGAG--GSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC---DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRK-----IMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWR--LRATEQPCAAAAGPGG-----RRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 532
BLAST of frizzled-like vs. uniprot
Match: gi|17433077|sp|Q9PWH2|FZD10_CHICK (RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-10; Flags: Precursor [Gallus gallus])

HSP 1 Score: 327.405 bits (838), Expect = 9.47102e-101
Identity = 200/540 (37.04%), Postives = 306/540 (56.67%), Query Frame = 2
Query:   77 SLDVYK----QCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGK---MCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNI----SCVQRCDS--DVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVD-IIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
S+D+ + +C I P+C+D+ Y TRMPN +G +Q EA+ ++ ++ PL+ C +LK FLCS+Y P+C + +STP+ CR C + +C P M ++ WP+ LDC KLP+ +C+ + D EP +M + + + DL + C N G+ ++ SC C DV +++DDK FA IW+ WS+LC SS T++TF + QRF YPE+PI+FLS+CY YS G ++ G ++ C QL +++ G E+T C I FL+LY+F AS+LWWV+LT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG CYVG+ D AL GF+L+P YL+ G +F+ G+ ++ +R+ V N +LEKLM +IGVFS+LY VP TC I Y + Y+ ++ K + K +D ++ ++P++E+ M++IFM LV+GITSG+WIW +K
Sbjct: 27 SIDIERPGDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTEQ--VSTPI-PACRVMCEQARLKCSPIMEQ-FNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSD-----EPPRGSSMLPPMFRPQRPSTGH-------DLQQHKDSLSRTSCE----NPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQL-YVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRR-----VMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVAS----------QQKCKMNNQTKNLDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 530
BLAST of frizzled-like vs. uniprot
Match: gi|17433043|sp|Q9DEB5|FZ10A_XENLA (RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=Xfz10-A; Flags: Precursor [Xenopus laevis])

HSP 1 Score: 327.405 bits (838), Expect = 9.52244e-101
Identity = 195/526 (37.07%), Postives = 298/526 (56.65%), Query Frame = 2
Query:   95 QCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGK---MCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDS--DVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVD-IIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
+C I P+C+D+ Y TRMPN +G +Q EA+ ++ ++ PL+ C ++LK FLCS+Y P+C + +STP+ CR C + +C P M ++ WP+ LDC KLP+ +C+ + D E + S + + + SR + K + SC C S DV +++DDK FA IW+ WS+LC SS T++TF + RF YPE+PI+FLS+CY YS G ++ G ++ C QL +++ G E+T C I FL+LY+F AS+LWWV+LT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG CYVG+ D AL GF+L+P YL+ G +F+ G+ ++ +R+ V N +LEKLM +IGVFS+LY VP TC I Y + ++ ++ + D + S K +D + ++P++E+ M++IFM LV+GITSG+WIW +K
Sbjct: 39 RCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQ--VSTPI-PACRVMCEQARLKCSPIMEQ-FNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTD-ETPRGSSMLPPIFRPQRPSSGHEIYPKDPTSRSSCENSGKFHHVEK------------SASCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRR-----VMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILA------TQDKCKMD----SQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 531
BLAST of frizzled-like vs. uniprot
Match: gi|17433091|sp|Q9ULW2|FZD10_HUMAN (RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz10; AltName: Full=FzE7; AltName: CD_antigen=CD350; Flags: Precursor)

HSP 1 Score: 326.25 bits (835), Expect = 1.99731e-100
Identity = 198/530 (37.36%), Postives = 302/530 (56.98%), Query Frame = 2
Query:   95 QCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGK---MCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNI----SCVQRCDS--DVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPA-LPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
+C I P+C+D+ Y TRMPN +G +Q EA+ ++ ++ PL+ C +L+ FLCS+Y P+C + +STP+ CR C + +C P M ++ WP+ LDC KLP+ +C+ + D EP+ + L + + + +K G C N G+ ++ SC C DV ++ +DK FA +WL W++LC SS T++TF + RF YPE+PI+FLS+CY YS G L+ G ++ C QL +++ G E+T C + FL+LY+F AS+LWWVVLT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG CYVG+ D AL GF+L+P YLV G +F+ G+ ++ +R+ V N +LEKLM +IG+FS+LY VP TC I Y + Y+ + L A ++ + T K +D + A +P++E+ M++IFM LV+GITSG+WIW +K
Sbjct: 33 KCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQ--VSTPI-PACRVMCEQARLKCSPIMEQ-FNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSD-----EPTRGSGLFPPLFRPQRPHSAQ-------EHPLKDGGPGRGGC----DNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRR-----VMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQT---------KTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15029711 (SmedSxlregen_c141340_g1_i1|m.45153|m.4173)

HSP 1 Score: 714.146 bits (1842), Expect = 0
Identity = 358/605 (59.17%), Postives = 457/605 (75.54%), Query Frame = 2
Query:    8 SVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNKKSFRYC------GRNKKD-----IQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGW 1789
+V +L+ + + + RR D+YKQC I EP CQDV Y++T MPN +G YSQ EASKR RD+ PLIN++CSNYLKLFLCS+YFP+C+++ ++S+ V+PCR CNHVK RCEP M T+ W ELDCEK P GK+CLTPDSFS D+ S D+ ++L +KL+L ++ + +S++++ K A+CLP ++N+GQTPNISC Q C ++V+FN DK FANIWL+ WS+LC S LLTII FSCNT RF+YPEKPIVFLSICYFFY+ GNL GA+LG+ V CR F+++ DF+VG+G ETTWCKINFLM+YFF SASALWWVVLT+TWFLSASRHWGYEAIES+SS+LHLVSW IPALKSIF+LILHKIDADELTGQC+VGNS+ + L GF++VP ++YL G+ FL +GY S+LKVR+SFLQ+ CIDT NLKRLEKLMAKIGVFSILY++PV CTI+SY++D ++ + FD+ LKAL+ +S +C+ G++WS KCV+I+QP LPS+E+RMLRIFMNLVIGITSGIWIWGNKK+ + C KK+ QC+ I+ PL+QT K E P+H W
Sbjct: 24 TVLILICISGFINIINGRRFG----DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPLSQT---KQKETLLPYHDW 621
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15005387 (SmedAsxldir_c106380_g2_i1|m.75515|m.16659)

HSP 1 Score: 339.732 bits (870), Expect = 6.8302e-106
Identity = 194/547 (35.47%), Postives = 316/547 (57.77%), Query Frame = 2
Query:   62 RNDKPSLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQI-------NMGQTPNISCVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQ-RFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLD--FLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQ-QVSCI--DTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNKKSF 1663
+++ DVY +C I + +CQ ++Y TRMPN +GI +Q +++KR+ DY+PLIN QCS Y + FLC+ YFP+C ++ T + PCR C V+ RCEPFM + WP EL+C+K P + ++C+ P ++ LD+ + + +D +K K + + + L + KCL + N ++ + SCV +CDS++ ++ DK+ A IW W++LCL+SS++ I TF + + RF+YPE+PI+F+ +CY NL L ++ ++C+ + L+ G E+ C + FL +Y+F +ALWW++L ++ +L++ R W E +E +S+ +H+VSW +PA+ + VLILHKID DEL G CYVG + + + FIL+P++L + G L L + S++ +R++ +++ I N + LEK +AK G+F +Y VP+TC I + ++ + +CV GL WS C+ + LP +EVR+L IF LVIGITSG+W+W NKK+
Sbjct: 26 KSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFM-KAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNV--KTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGL--PLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTL 566
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15014534 (SmedAsxldir_c94917_g1_i1|m.35515|m.3335)

HSP 1 Score: 277.33 bits (708), Expect = 1.41375e-81
Identity = 190/577 (32.93%), Postives = 288/577 (49.91%), Query Frame = 2
Query:    2 KLSVFLLL-VVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGK----MC----LTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLP-----YQINMGQTPNIS------CVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQ----LDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALY--EYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
KL VF+LL V +S ++D + D K C +I P+C+D+ Y T MPN +Q+EA +YPL+ ++CS L+ FLCS+Y PIC + S P PCR C VK C+P + Y WP +++C++ P +C L+ S +L V P + + + L + +R + ++ C +IN +S C Q C S +E D+ F WL W+++CL+S+ + TFS + R+ YPE+PI+F+SICYF S G L+ V+G ++ C + L L G+ C I FL++Y+F A++LWWV+LT+TWFL+A WG EAI S I H ++W +P +KSI L + +D D ++G CYVGN+ LI F+L P ++YL G L G+ S+ ++R Q ++LEKLM +IGVFS+LY P I++ +I ++L +A + S DC +L + PS V M + FM + +G+TSG WIW K
Sbjct: 11 KLLVFILLKTVESSNSDFYPLKSDNTNRDKGK-CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLP---PCRSVCERVKKGCDPLL-QKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTR---QYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTG----GKTEKLEKLMIRIGVFSVLYTAPAA-VIVACII-------YELQNRAEWYQNLSCDCFDSNRHQLNLPR---------PSYSVFMFKYFMFMGVGMTSGFWIWSKK 558
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15036199 (SmedSxlregen_c90692_g1_i1|m.42870|m.18187)

HSP 1 Score: 268.47 bits (685), Expect = 2.08604e-79
Identity = 198/592 (33.45%), Postives = 286/592 (48.31%), Query Frame = 2
Query:   23 LVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCL-PY------QINMGQTPNIS-CVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK------KSFR-----YCGRNKKDIQQCEMRQIEVLTPLNQ 1741
L + S+ + + N +P+ +C I P+C+++ Y T MPN +Q EA V +YPL+ + CS+ L+LFLCS+Y PIC +Q CR C + C P M NTY WP +DC+KL + + CL D+ K V K PS KC PY Q N T ++ C Q C S F DKSF WL W++LC +SS T++TF + RF YPE+PIVFLS CY S G ++ +G + C D L C I FL++YFF A+++WWV+LT+TWFLSA WG EAI S I H ++W + +KSI L L ID D + G CY+GN++ L F++VP +YL+ G FL G+ +++ +RK+ + + +LEKLM +IG+F +LY VP I ++ +++ + +E S +C + + + P V ML+ FM LV+GITSG WIW +K +FR CG++ K +Q + E TPL Q
Sbjct: 39 LAIDRASADRSNQENFRPN-----KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWP---KPIQACRSVCESARDGCAPVM-NTYGFKWPKSMDCDKL-TENQACLKKDT----KNVTKPPSKG---------------------------------CECKCRSPYIYDNKPQFNSVITGGVANCFQSCHS-ANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG-----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAK----GESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHL--------YEVKNREFWEKSNNCYCNRNIK-------SQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQE--TPLCQ 556
BLAST of frizzled-like vs. Smed Unigenes AA
Match: SMU15040087 (dd_smedV4_7210_0_1|m.35691|m.13357)

HSP 1 Score: 262.307 bits (669), Expect = 1.95953e-77
Identity = 175/521 (33.59%), Postives = 264/521 (50.67%), Query Frame = 2
Query:  107 ITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLP---SSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICR--PFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
I P CQ++ Y T MPN + + +Q EA +++ + LI +CS L FLCS+Y P+CD IS ++ PC+ C V+ CE M ++ PWP L+C + P + G MC+ S+ K + TM G + + + IN Q CV +C +++ F DDK A IWL + LC +SS+ TI+TF NT RF YPE+P++FL++CY YS + + +++ C P Q L G + T C I FL+ +FFS+AS +WWV+LTV W L+A W EAI S HL +W I +L ++ VL+L +DADEL G C VG + L+ F+++P +++LV G FL G ++++VR+ D ++LE LM +IG+FS+L++VP + ++ YEY+ +K P+IEV ML+IFM+ V+GITSG+W+W K
Sbjct: 51 ILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCD---PISNYLIGPCQPLCEEVRDSCERIM-RPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGPSV-----KSTENFQTM--------------------------CGGMKNPRLFIF-INRTQ----KCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQF-ILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVALVRVRRHVKN-----DGIKTEKLEILMVRIGLFSVLFLVPSS----------------TVLGCNFYEYANRDHWLKS-------------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIK 496
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503835|ref|NP_003499.1| (frizzled-9 precursor [Homo sapiens])

HSP 1 Score: 327.791 bits (839), Expect = 2.95969e-101
Identity = 200/523 (38.24%), Postives = 293/523 (56.02%), Query Frame = 2
Query:   98 CTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVK--FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLD--FLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
C + P+C+ + Y TRMPN +G SQ EA+ + ++ PL+ C ++L+ FLCS+Y P+C + +STP+ CR C + RC P M ++ WP+ LDC +LP+ P + ++ + K L DL AG S C + + SC RC V+ ++ DK FA +W+ WS LC S+ T++TF RF YPE+PI+FLS+CY YS L+ AV G ++V C D++ +++ G E T C + FL+LY+F AS+LWWVVLT+TWFL+A + WG+EAIE+ S H+ +WG+PALK+I +L L K+ DELTG CYV ++D AL GF+LVP YLV G +FL G+ ++ +RK + TN ++LEKLM KIGVFSILY VP TC I+ YV + ++ L+A + A G + + ++P++ V ML+IFM+LV+GITSG+W+W +K
Sbjct: 39 CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQ--VSTPI-PACRPMCEQARLRCAPIMEQ-FNFGWPDSLDCARLPTRND----PHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPG----DLGPGAG--GSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVAC---DQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRK-----IMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWR--LRATEQPCAAAAGPGG-----RRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 532
BLAST of frizzled-like vs. RefSeq Human
Match: gi|6005762|ref|NP_009128.1| (frizzled-10 precursor [Homo sapiens])

HSP 1 Score: 326.25 bits (835), Expect = 7.53801e-101
Identity = 198/530 (37.36%), Postives = 302/530 (56.98%), Query Frame = 2
Query:   95 QCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGK---MCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNI----SCVQRCDS--DVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPA-LPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
+C I P+C+D+ Y TRMPN +G +Q EA+ ++ ++ PL+ C +L+ FLCS+Y P+C + +STP+ CR C + +C P M ++ WP+ LDC KLP+ +C+ + D EP+ + L + + + +K G C N G+ ++ SC C DV ++ +DK FA +WL W++LC SS T++TF + RF YPE+PI+FLS+CY YS G L+ G ++ C QL +++ G E+T C + FL+LY+F AS+LWWVVLT+TWFL+A + WG+EAIE+ SS HL +W IPA+K+I +L++ ++ DELTG CYVG+ D AL GF+L+P YLV G +F+ G+ ++ +R+ V N +LEKLM +IG+FS+LY VP TC I Y + Y+ + L A ++ + T K +D + A +P++E+ M++IFM LV+GITSG+WIW +K
Sbjct: 33 KCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQ--VSTPI-PACRVMCEQARLKCSPIMEQ-FNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSD-----EPTRGSGLFPPLFRPQRPHSAQ-------EHPLKDGGPGRGGC----DNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRR-----VMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHKCKMNNQT---------KTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526
BLAST of frizzled-like vs. RefSeq Human
Match: gi|22547161|ref|NP_036325.2| (frizzled-4 precursor [Homo sapiens])

HSP 1 Score: 309.686 bits (792), Expect = 4.44546e-95
Identity = 200/571 (35.03%), Postives = 298/571 (52.19%), Query Frame = 2
Query:   92 KQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLP---SSGKMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQ----TPNISCVQRCDSDVK-FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNKKSFRYCGRNKKDIQQCEMRQI---EVLTPLNQTPFIKSGEGT 1771
++C I +CQ++ Y T+MPN +G Q +A ++ + PLI CS+ L+ FLCS+Y P+C + I+ P+ PC C VK RCEP + + WP L+C K P MC+ D+EV L K + +C N Q +++CV +C D ++ K F +IW+ W+ LC +S+ T++TF ++ RF YPE+PI+FLS+CY YS ++ +G+ + C + L+ G + T C I FL++YFF AS++WWV+LT+TWFL+A WG+EAIE SS H+ +W IPA+K+I +LI+ +DADELTG CYVGN + +AL GF++ P YLV G F+A G ++ K+R S LQ+ D T +LE+LM KIGVFS+LY VP TC I Y ++++ AL+ YSAD ++ V ML+IFM+L++GITSG+WIW K + Q+C R + +V ++K G+G+
Sbjct: 43 RRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEK--INIPI-GPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFPPQNDHNHMCMEGPG---DEEVP-------------------------------LPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR-SNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACY--------FYEISNWALFRYSAD---------------------DSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTW--------QKCSNRLVNSGKVKREKRGNGWVKPGKGS 533
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503825|ref|NP_003496.1| (frizzled-1 [Homo sapiens])

HSP 1 Score: 294.664 bits (753), Expect = 3.90057e-88
Identity = 183/543 (33.70%), Postives = 271/543 (49.91%), Query Frame = 2
Query:   77 SLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLP--SSGKMCL--------TPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCL--PYQINMGQTPNISCVQRCDSD-----VKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
S+ + C I+ P+C D+ Y T MPN +G +Q +A V +YPL+ +QCS LK FLCSMY P+C + + PCR C + CE M N + WP+ L CEK P +G++C+ TP L + P H + G ++ + L P +N C C+ + F ++ F+ W+ WS+LC S+L T++T+ + +RF YPE+PI+FLS CY + + G +L R V F E V G + C I F+MLYFFS AS++WWV+L++TWFL+A WG+EAIE+ S HL +W +PA+K+I +L L ++D D L+G C+VG ++ +AL GF+L P +YL G +FL G+ S+ ++R D T ++LEKLM +IGVFS+LY VP T I Y + ++ D ++ S + P P V M++ M L++GITSG WIW K
Sbjct: 109 SVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC----TVLEQALPPCRSLCERARQGCEALM-NKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGAS-------------ERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACY---FYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGK 625
BLAST of frizzled-like vs. RefSeq Human
Match: gi|4503827|ref|NP_001457.1| (frizzled-2 precursor [Homo sapiens])

HSP 1 Score: 288.886 bits (738), Expect = 6.87221e-87
Identity = 182/532 (34.21%), Postives = 267/532 (50.19%), Query Frame = 2
Query:   98 CTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSG--KMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKC-----LPYQINMGQTPNISCVQRC-----DSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPAL-PSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
C I+ P+C D+ Y T MPN +G +Q +A V +YPL+ +QCS L+ FLCSMY P+C + + PCR C + CE M N + WP L CE P G ++C+ E + T + A L C +P ++ C C D + F++++ FA +W+++WS+LC S+ T+ T+ + QRF YPE+PI+FLS CY S + G VL +R V F E V G + C I F+MLYFFS AS++WWV+L++TWFL+A WG+EAIE+ S HL +W +PA+K+I +L + +ID D L+G C+VG + + L GF+L P +YL G +FL G+ S+ ++R D T ++LE+LM +IGVFS+LY VP T I Y +++ + +E S K L+ C P + P V M++ M L++GITSG WIW K
Sbjct: 39 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC----TVLEQAIPPCRSICERARQGCEALM-NKFGFQWPERLRCEHFPRHGAEQICVG------QNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLERLMVRIGVFSVLYTVPATIVIACY--------FYEQAFREHWERSWVSQHCKSLA---IPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGK 543
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17864440|ref|NP_524812.1| (frizzled, isoform A [Drosophila melanogaster])

HSP 1 Score: 231.876 bits (590), Expect = 3.72063e-66
Identity = 168/556 (30.22%), Postives = 276/556 (49.64%), Query Frame = 2
Query:   32 GILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSG--KMCLTPDSFSLDKEV---EKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICR-PFD--------EQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSY-FDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
G+++S T + L + +C IT +C+++ Y T MPN IG Q EA V + PL+ + CS+ L+LFLCS+Y P+C I + PCR C + CE M TY+ WP L+C K P G +C+ ++ S + + V T K+ ++ + G Y++ +G C C + + F E +++ W+ SW+ +C+ S L T++TF ++ RF YPE+ IVFL++CY C + G G +V CR PF + + + +TT C + F+ LYF A+ WW L WFL+A WG+EAIE+ S + HLV+W +PAL++I VL L K++ D L+G C+VG D +L F+++P +YL G FL G+ S+ ++R V D +LE+LM +IG FS L+I+P + + +F Y FD + + ++ D + A+ + A P ++ M++ ++++G+TS +W++ +K
Sbjct: 35 GLMASSGT----ELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESARV-CEKLM-KTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMG---------YELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGD-SVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRT-----VMKTDGKRTDKLERLMLRIGFFSGLFILPA----VGLLGCLFYEYYNFD---EWMIQWHRDICKPFSIPCPAARAPGSPE-ARPIFQIFMVKYLCSMLVGVTSSVWLYSSK 556
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|442632294|ref|NP_001261836.1| (frizzled, isoform C [Drosophila melanogaster])

HSP 1 Score: 231.876 bits (590), Expect = 6.72633e-66
Identity = 164/552 (29.71%), Postives = 272/552 (49.28%), Query Frame = 2
Query:   32 GILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSG--KMCLTPDSFSLDKEVEKEPSHVDTMXXXXXXXXXXXXXXXXXXXRIDLLMKAGLYASAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICR-PFD--------EQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK 1654
G+++S T + L + +C IT +C+++ Y T MPN IG Q EA V + PL+ + CS+ L+LFLCS+Y P+C I + PCR C + CE M TY+ WP L+C K P G +C+ ++ + P+ + + +K L + Y++ +G C C + + F E +++ W+ SW+ +C+ S L T++TF ++ RF YPE+ IVFL++CY C + G G +V CR PF + + + +TT C + F+ LYF A+ WW L WFL+A WG+EAIE+ S + HLV+W +PAL++I VL L K++ D L+G C+VG D +L F+++P +YL G FL G+ S+ ++R V D +LE+LM +IG FS L+I+P + + + FD + + ++ D + A+ + A P ++ M++ ++++G+TS +W++ +K
Sbjct: 35 GLMASSGT----ELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESARV-CEKLM-KTYNFNWPENLECSKFPVHGGEDLCVA-ENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLG-----MGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGD-SVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRT-----VMKTDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYN---FD---EWMIQWHRDICKPFSIPCPAARAPGSPE-ARPIFQIFMVKYLCSMLVGVTSSVWLYSSK 556
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|17737633|ref|NP_524155.1| (frizzled 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 220.705 bits (561), Expect = 2.06724e-61
Identity = 148/382 (38.74%), Postives = 202/382 (52.88%), Query Frame = 2
Query:  647 NISCVQRCDSDVK---FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK--KSFRYCGR---NKKDIQQCEMRQIEVLTPLNQTPFIKSGEG 1768
I+ V C K F+ D+K FA +W+ WS LC S+L+T+ TF +T+RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWV+L+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G CYVGN + + L F+L P +YLV G TFL G+ S+ ++R QQ +LEKLM +IG+FS+LY VP T I Y ++ +YF+ +KAL + C VKG P V ML+ FM L +GITSG+WIW K +S+R R D I+ P+ P+ SG G
Sbjct: 293 RIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPH-PYAGSGMG 650

HSP 2 Score: 91.6633 bits (226), Expect = 8.39505e-19
Identity = 49/135 (36.30%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   83 DVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKE 487
D +C IT P+C+ + Y T PN + +Q+EA V ++PL+ ++CS LK FLCSMY PIC + PV CR C +S C P M Y WP + CE LP G PD+ +++ E
Sbjct: 59 DPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIM-QQYSFEWPERMACEHLPLHGD----PDNLCMEQPSYTE 185
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|24666637|ref|NP_730389.1| (frizzled 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 220.705 bits (561), Expect = 2.06724e-61
Identity = 148/382 (38.74%), Postives = 202/382 (52.88%), Query Frame = 2
Query:  647 NISCVQRCDSDVK---FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK--KSFRYCGR---NKKDIQQCEMRQIEVLTPLNQTPFIKSGEG 1768
I+ V C K F+ D+K FA +W+ WS LC S+L+T+ TF +T+RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWV+L+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G CYVGN + + L F+L P +YLV G TFL G+ S+ ++R QQ +LEKLM +IG+FS+LY VP T I Y ++ +YF+ +KAL + C VKG P V ML+ FM L +GITSG+WIW K +S+R R D I+ P+ P+ SG G
Sbjct: 293 RIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPH-PYAGSGMG 650

HSP 2 Score: 91.6633 bits (226), Expect = 8.39505e-19
Identity = 49/135 (36.30%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   83 DVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKE 487
D +C IT P+C+ + Y T PN + +Q+EA V ++PL+ ++CS LK FLCSMY PIC + PV CR C +S C P M Y WP + CE LP G PD+ +++ E
Sbjct: 59 DPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIM-QQYSFEWPERMACEHLPLHGD----PDNLCMEQPSYTE 185
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Match: gi|161084844|ref|NP_001097643.1| (frizzled 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 220.705 bits (561), Expect = 2.06724e-61
Identity = 148/382 (38.74%), Postives = 202/382 (52.88%), Query Frame = 2
Query:  647 NISCVQRCDSDVK---FNEDDKSFANXXXXXXXXXXXXXXXXXXXXFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVICRPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSASRHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNSDKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNLKRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSADCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGNK--KSFRYCGR---NKKDIQQCEMRQIEVLTPLNQTPFIKSGEG 1768
I+ V C K F+ D+K FA +W+ WS LC S+L+T+ TF +T+RF YPE+PIVFLS CYF + G L L + C D L G + C + FL+ YFF AS++WWV+L+ TWFL+A WG EAI S HL +W IP ++S+ VL+L +D D + G CYVGN + + L F+L P +YLV G TFL G+ S+ ++R QQ +LEKLM +IG+FS+LY VP T I Y ++ +YF+ +KAL + C VKG P V ML+ FM L +GITSG+WIW K +S+R R D I+ P+ P+ SG G
Sbjct: 293 RIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC---DGLLLRESSTGPHS--CTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCY---LYEAAYFEDWIKAL---ACPCAQVKGPG------------KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPH-PYAGSGMG 650

HSP 2 Score: 91.6633 bits (226), Expect = 8.39505e-19
Identity = 49/135 (36.30%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   83 DVYKQCTLITEPVCQDVRYTHTRMPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAISTPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTPDSFSLDKEVEKE 487
D +C IT P+C+ + Y T PN + +Q+EA V ++PL+ ++CS LK FLCSMY PIC + PV CR C +S C P M Y WP + CE LP G PD+ +++ E
Sbjct: 59 DPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPV---CRSVCERARSGCAPIM-QQYSFEWPERMACEHLPLHGD----PDNLCMEQPSYTE 185
The following BLAST results are available for this feature:
BLAST of frizzled-like vs. uniprot
Analysis Date: 2016-03-08 (Phagocata morgani BLASTX Swissprot Uniprot)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17433078|sp|Q9R216|FZD9_MOUSE2.489520e-10338.05RecName: Full=Frizzled-9; Short=Fz-9; Short=mFz3; ... [more]
gi|17432964|sp|O00144|FZD9_HUMAN7.842150e-10138.24RecName: Full=Frizzled-9; Short=Fz-9; Short=hFz9; ... [more]
gi|17433077|sp|Q9PWH2|FZD10_CHICK9.471020e-10137.04RecName: Full=Frizzled-10; Short=Fz-10; Short=cFz-... [more]
gi|17433043|sp|Q9DEB5|FZ10A_XENLA9.522440e-10137.07RecName: Full=Frizzled-10-A; Short=Fz-10A; Short=X... [more]
gi|17433091|sp|Q9ULW2|FZD10_HUMAN1.997310e-10037.36RecName: Full=Frizzled-10; Short=Fz-10; Short=hFz1... [more]
back to top
BLAST of frizzled-like vs. Smed Unigenes AA
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Schmidtea mediterranea)
Total hits: 5
Match NameE-valueIdentityDescription
SMU150297110.000000e+059.17SmedSxlregen_c141340_g1_i1|m.45153|m.4173[more]
SMU150053876.830200e-10635.47SmedAsxldir_c106380_g2_i1|m.75515|m.16659[more]
SMU150145341.413750e-8132.93SmedAsxldir_c94917_g1_i1|m.35515|m.3335[more]
SMU150361992.086040e-7933.45SmedSxlregen_c90692_g1_i1|m.42870|m.18187[more]
SMU150400871.959530e-7733.59dd_smedV4_7210_0_1|m.35691|m.13357[more]
back to top
BLAST of frizzled-like vs. RefSeq Human
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Human)
Total hits: 5
Match NameE-valueIdentityDescription
gi|4503835|ref|NP_003499.1|2.959690e-10138.24frizzled-9 precursor [Homo sapiens][more]
gi|6005762|ref|NP_009128.1|7.538010e-10137.36frizzled-10 precursor [Homo sapiens][more]
gi|22547161|ref|NP_036325.2|4.445460e-9535.03frizzled-4 precursor [Homo sapiens][more]
gi|4503825|ref|NP_003496.1|3.900570e-8833.70frizzled-1 [Homo sapiens][more]
gi|4503827|ref|NP_001457.1|6.872210e-8734.21frizzled-2 precursor [Homo sapiens][more]
back to top
BLAST of frizzled-like vs. RefSeq Drosophila melanogaster
Analysis Date: 2016-03-09 (Phagocata morgani BLASTX Drosophila melanogaster)
Total hits: 5
Match NameE-valueIdentityDescription
gi|17864440|ref|NP_524812.1|3.720630e-6630.22frizzled, isoform A [Drosophila melanogaster][more]
gi|442632294|ref|NP_001261836.1|6.726330e-6629.71frizzled, isoform C [Drosophila melanogaster][more]
gi|17737633|ref|NP_524155.1|2.067240e-6138.74frizzled 2, isoform A [Drosophila melanogaster][more]
gi|24666637|ref|NP_730389.1|2.067240e-6138.74frizzled 2, isoform B [Drosophila melanogaster][more]
gi|161084844|ref|NP_001097643.1|2.067240e-6138.74frizzled 2, isoform C [Drosophila melanogaster][more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Pmo_014048 ID=Pmo_014048|Name=frizzled-like|organism=Phagocata morgani|type=mRNA|length=2082bp
GAAATTGTCTGTTTTTTTGTTGTTGGTGGTCGGAATATTAAGTAGTCAAG
TAACTGCCAGACGAAATGACAAACCGTCTCTTGATGTGTATAAGCAATGT
ACTTTGATAACCGAGCCAGTTTGTCAAGATGTTAGATATACGCATACGAG
GATGCCGAATTTCATAGGAATTTATTCTCAGAACGAAGCCAGTAAACGTG
TACGAGACTATTACCCCCTCATCAATTTACAATGTAGCAATTATTTGAAA
TTATTTCTTTGCTCTATGTATTTCCCAATTTGTGATTCTGAAGCCGCTAT
TTCAACACCAGTCGTTCAACCGTGTCGACGATTCTGTAACCATGTTAAAT
CACGTTGCGAACCTTTTATGACTAATACGTACCACTCACCGTGGCCAAAT
GAACTGGACTGTGAAAAGCTCCCATCATCAGGCAAAATGTGCTTAACTCC
AGATTCTTTCAGCCTAGACAAAGAAGTGGAGAAGGAGCCGAGTCACGTAG
ATACGATGAAGAACCTGTTACAAAAACTGGAATTAAGTTTGAAACAGAGC
GACAAAGACAAATCGCGAATAGATTTGCTGATGAAGGCCGGTTTATACGC
CTCAGCGAAATGTCTGCCATATCAAATTAACATGGGCCAGACCCCGAATA
TTTCCTGCGTCCAAAGATGTGACTCTGATGTGAAATTCAACGAAGACGAT
AAATCGTTTGCCAACATTTGGCTCATTAGTTGGAGTCTTCTTTGTTTGGT
CTCATCTTTGCTTACGATCATCACTTTCTCCTGTAACACACAGCGGTTCA
TGTATCCCGAAAAGCCGATAGTTTTCCTTTCGATTTGTTACTTTTTCTAT
TCTTGCGGCAATCTGCTTGGGGCGGTGCTTGGTAAACGAAATGTTATTTG
TCGGCCATTCGATGAGCAGTTGGACTTTTTAGTGGGCAACGGCAACGAGA
CGACCTGGTGTAAGATTAATTTCTTGATGCTCTACTTTTTCAGTTCAGCC
AGCGCGTTGTGGTGGGTCGTTTTAACAGTCACGTGGTTTCTTTCGGCATC
TCGGCATTGGGGGTATGAGGCTATTGAATCAGTCAGCAGTATTTTGCATC
TAGTCAGTTGGGGAATTCCGGCGCTCAAGTCAATTTTCGTTCTCATCCTT
CACAAAATCGACGCCGATGAATTAACTGGACAATGTTACGTCGGCAACTC
AGATAAGGAAGCGCTGATTGGTTTCATTCTAGTCCCACAAGTTCTCTACT
TAGTGACCGGGGTCACGTTCCTAGCGTTGGGCTACTACTCCATCTTGAAG
GTGAGAAAGTCTTTCCTACAACAGGTGAGTTGTATTGACACCACGAATTT
GAAACGACTTGAAAAATTAATGGCGAAAATCGGCGTCTTTTCCATTTTAT
ATATTGTGCCAGTCACGTGTACAATTATAAGCTACGTTATCGACATCTTC
AGGACTTCCTATTTCGATTTAATGCTGAAGGCGTTGTATGAATATTCAGC
AGATTGTGTCACAGTAAAGGGTCTGTCGTGGTCGTTAGCGAAGTGCGTAG
ACATCATTCAACCGGCATTGCCGTCCATCGAAGTGAGGATGCTGCGTATT
TTTATGAATCTTGTCATCGGCATAACATCGGGAATTTGGATTTGGGGTAA
CAAAAAGTCGTTCCGATATTGTGGGCGAAATAAAAAAGACATTCAACAAT
GTGAAATGAGACAAATCGAAGTATTAACCCCCCTCAATCAGACTCCGTTT
ATTAAATCCGGTGAGGGCACTTTTCCCCATCACGGGTGGAGTTATGTGCC
GACCTTGGCCTCGGAACACGCGGTCGGGGGGCTCTCTCAGACCCCTGTGG
AAGGTATAATGGCCCCCAATAACTCATCAATAAGCGAAGTATCCAGTAAG
CATTAATGGGATCCATACAAACCGGTTTACTAACGTCAATTGCGCTGCAA
CAACATCGAAATTCAGAAAATATTCGATATCTTTTATTTTGACGAAACTT
TTGTGATACTAATTTTGAATTCGTTCAGTAAATGCTGTAGATTTAGACTC
GTGTGAATACATTTTCTTTTGTCGAAAAGCAA

Design Primers for frizzled-like

back to top

protein sequence

>Pmo_014048-protein ID=Pmo_014048-protein|Name=frizzled-like|organism=Phagocata morgani|type=polypeptide|length=635bp
KLSVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTR
MPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAI
STPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTP
DSFSLDKEVEKEPSHVDTMKNLLQKLELSLKQSDKDKSRIDLLMKAGLYA
SAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANIWLISWSLLCLV
SSLLTIITFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVIC
RPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSAS
RHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNS
DKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNL
KRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSA
DCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGN
KKSFRYCGRNKKDIQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGWSYVP
TLASEHAVGGLSQTPVEGIMAPNNSSISEVSSKH*
back to top

coding sequence

>Pmo_014048.2.1906 ID=Pmo_014048.2.1906|Name=Pmo_014048.2.1906|organism=Phagocata morgani|type=CDS|length=1905bp
AAATTGTCTGTTTTTTTGTTGTTGGTGGTCGGAATATTAAGTAGTCAAGT
AACTGCCAGACGAAATGACAAACCGTCTCTTGATGTGTATAAGCAATGTA
CTTTGATAACCGAGCCAGTTTGTCAAGATGTTAGATATACGCATACGAGG
ATGCCGAATTTCATAGGAATTTATTCTCAGAACGAAGCCAGTAAACGTGT
ACGAGACTATTACCCCCTCATCAATTTACAATGTAGCAATTATTTGAAAT
TATTTCTTTGCTCTATGTATTTCCCAATTTGTGATTCTGAAGCCGCTATT
TCAACACCAGTCGTTCAACCGTGTCGACGATTCTGTAACCATGTTAAATC
ACGTTGCGAACCTTTTATGACTAATACGTACCACTCACCGTGGCCAAATG
AACTGGACTGTGAAAAGCTCCCATCATCAGGCAAAATGTGCTTAACTCCA
GATTCTTTCAGCCTAGACAAAGAAGTGGAGAAGGAGCCGAGTCACGTAGA
TACGATGAAGAACCTGTTACAAAAACTGGAATTAAGTTTGAAACAGAGCG
ACAAAGACAAATCGCGAATAGATTTGCTGATGAAGGCCGGTTTATACGCC
TCAGCGAAATGTCTGCCATATCAAATTAACATGGGCCAGACCCCGAATAT
TTCCTGCGTCCAAAGATGTGACTCTGATGTGAAATTCAACGAAGACGATA
AATCGTTTGCCAACATTTGGCTCATTAGTTGGAGTCTTCTTTGTTTGGTC
TCATCTTTGCTTACGATCATCACTTTCTCCTGTAACACACAGCGGTTCAT
GTATCCCGAAAAGCCGATAGTTTTCCTTTCGATTTGTTACTTTTTCTATT
CTTGCGGCAATCTGCTTGGGGCGGTGCTTGGTAAACGAAATGTTATTTGT
CGGCCATTCGATGAGCAGTTGGACTTTTTAGTGGGCAACGGCAACGAGAC
GACCTGGTGTAAGATTAATTTCTTGATGCTCTACTTTTTCAGTTCAGCCA
GCGCGTTGTGGTGGGTCGTTTTAACAGTCACGTGGTTTCTTTCGGCATCT
CGGCATTGGGGGTATGAGGCTATTGAATCAGTCAGCAGTATTTTGCATCT
AGTCAGTTGGGGAATTCCGGCGCTCAAGTCAATTTTCGTTCTCATCCTTC
ACAAAATCGACGCCGATGAATTAACTGGACAATGTTACGTCGGCAACTCA
GATAAGGAAGCGCTGATTGGTTTCATTCTAGTCCCACAAGTTCTCTACTT
AGTGACCGGGGTCACGTTCCTAGCGTTGGGCTACTACTCCATCTTGAAGG
TGAGAAAGTCTTTCCTACAACAGGTGAGTTGTATTGACACCACGAATTTG
AAACGACTTGAAAAATTAATGGCGAAAATCGGCGTCTTTTCCATTTTATA
TATTGTGCCAGTCACGTGTACAATTATAAGCTACGTTATCGACATCTTCA
GGACTTCCTATTTCGATTTAATGCTGAAGGCGTTGTATGAATATTCAGCA
GATTGTGTCACAGTAAAGGGTCTGTCGTGGTCGTTAGCGAAGTGCGTAGA
CATCATTCAACCGGCATTGCCGTCCATCGAAGTGAGGATGCTGCGTATTT
TTATGAATCTTGTCATCGGCATAACATCGGGAATTTGGATTTGGGGTAAC
AAAAAGTCGTTCCGATATTGTGGGCGAAATAAAAAAGACATTCAACAATG
TGAAATGAGACAAATCGAAGTATTAACCCCCCTCAATCAGACTCCGTTTA
TTAAATCCGGTGAGGGCACTTTTCCCCATCACGGGTGGAGTTATGTGCCG
ACCTTGGCCTCGGAACACGCGGTCGGGGGGCTCTCTCAGACCCCTGTGGA
AGGTATAATGGCCCCCAATAACTCATCAATAAGCGAAGTATCCAGTAAGC
ATTAA
back to top
Gene Groups
frizzled-like is similar in sequence to the genes of this group: GG4852
Gene NameGene ID
SMU15029711SMU15029711
frizzled-likeDdo_014376
frizzled-likeGsp_021429
Pgr_015739Pgr_015739
frizzled-likePgr_020264
frizzled-likePmo_014048

Gene Group Protein Sequences

>SMU15029711

MCINLYLYIYKTIIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQC
VPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLK
LFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSE
ELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGN
RIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHD
KVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFY
ASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSA
SALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILIL
HKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLK
VRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAY
KMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRI
FMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTI
QNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIVPPPNN
SSISDDSSRH*
>Ddo_014376 frizzled-like
GVLQTQKRFSVFIFTKYFFGYYFFAVTIIMKSIILIVIGINLLFGFVSAK
LSVDIYKQCSPITEPVCQDIRYTQTRMPNLIGIYSQTEASKRIRDFFPLI
NIRCSNYLKLFLCSVYFPMCDSESVMNSQIIKPCKRLCTHVKQRCEPFMK
ESLQLTWPEELDCEKLPEKGKICLTPDSFDLDEQTGKTKSKAENIKELYN
QLETLMQGNKINKTKLDIFQKAGWLMGSKCLPSQINIGQPANVSCAQICS
ANVQFSGSDKAFANIWLMGWSVICFFSCLLTIIVFSCNTNRFLYPEKPIV
FLSICYFFYACGNLLGAILGRKNVACRSFNEQLDFMVDNGRETTWCKINF
LMVYFFGSSSALWWVVLTITWFLSASRHWGYEAIESISSMLHLLSWALPA
LKSIFILILHKIDADELTGQCFVGNSNTNALWIFVIVPHIIYLVTGVVFL
SLGYVSLLKVRRSFLQRPDCNDTNNLKRLEKLMAKIGVFSILYIIPVVCT
VVSHITDAYKMNYFDVAVRALYQFSPNCLTMKGVAWSMSRCVDILQPMLP
SVELRMLRIFMNLVIGITSGIWIWGNTKTVRSCINGIKCWRLNKEIQLSQ
INQCDSVTTPNNFPLSQVNHKESLLPYPDWKFNSPYPNIEFALPSISVPS
EVVFPPPNNSSISDASSKH*
>Gsp_021429 frizzled-like
MMKIIVIMIFSKLFIDFVDCRVNVDIYKQCVPIKEPECHDIPYTKTRMPN
SVGINSQSDASQRLRDYNALINIRCSNYLKLYLCSIYFPMCETDTSMNSQ
IVKPCKHLCKHVKQKCEPFMKESLQMPWPEELNCEKLPEKGKICFTPESF
SLDDLDQQNQSQGDDVQQLYRQFENVMQGHKINQSKIEIFKKIGGMIGSQ
CLPSEINIGQLPNISCAQICSANVQFNSHDKTFANIWLMGWSVLCFFSCF
LTIIVFSCNTNRFLYPEKPIVFLSICFFFYASGNLLGSVLGRKVVACRSY
DDQNDFVIGQGRETTWCKINFLMVYFFGSSSALWWVVLTITWFLSASRHW
GYEAIESISSMLHLLCWAVPALKSIFILILHKIDADELTGQCYVGNNNQN
VLWGFVIIPQMIYLLTGVIFLTLGYISLLKVRKSFLQRPDCIDTNNLKRL
EKLMAKIGVFSILYIVPVICTIASYMVDAFKMTYFDVALRALFRFSPNCV
TKNGVNWSSIKCIEILQPMLPSVEMRMLRIFMNLVIGITSGIWIWGNSKT
LKYCIKTIRFWKRTKELEIQPDNHCDSSTTPNNFPVAHAQSKQNETLLPY
NNWKLNSSYPANEFGLATVSVPSEIIPPPNNSSISDLSSKH*
>Pgr_015739 Pgr_015739
MKYAFLLCFGTFLWQTTARNVDGTSMDVYNQCTVISEPVCQDIRYTHTRM
PNLIGINSQNEASKRIRDYYPLINLQCSHYLKLFLCSMYFPICDAESQTS
PPVVRPCQRLCLHVKARCEPFMKDKYRILWPDELDCDKLPIAGKMCLAPE
SFVLDKETSTESTHPNIMKELQQQLQSLVRPGGRNGASLDIAKIERSLSE
TKCLPSQLNLGLHTNLSCVHRCDADIKFNGGDKAFANVWLIGWSLLCLLS
SLFTIVTFSCNTNRFLYPEKPIVFLSICYFFQSCGNLLGAVLGRRNIICR
PYNDQYDFLVSNGNEMTWCKIIFLMLYYFSTASALWWVVLTVTWFLSASR
HWGFEAIESLSSVFHLICWGTPSLKSICILILHKVDPDELTGLCFVGNNH
LPSLLGFVLVPQIVYLMAGITFLSLGYISILKVRKSFLRQPSCIDTNNLK
RLEKLMAKIGIFSILYIVPVTCSIASYVVDALKSWHFELALKILYKYSPD
CVIARGLSWSLAKCVNLIQPALPSAEMRMLRIFMNLVIGITSGIWIWGNK
KTFRQCCCFFKNFNSGKGIQMIEMKETESQKAGNNTFYLKPADGNLQSQN
WTYCPSVLSEPTVCGIVNEPCEGIVAPNNSSKSETSSRH*
>Pgr_020264 frizzled-like
KVGIKMRQMFFLWSGILIMQIAALPSEKGSNDVYKQCTVITEPVCQDVRY
THTRMPNQMGIYSQNEASKRVRDYYPLINLQCSHYLKLFLCSMYFPICDA
EAATSTPSVQPCQRFCQHVKSRCEPFMTSTYNVPWPNELDCEKLPGTGKM
CLTPDSFSQDKEVTKEPNNSETMKELFQQLDKARKKNDKNMHQMELLKKA
GSFASTTCLPSQINMGQLPNTTCMHRCDADIRFNLDDKTFASIWLIGWSL
LCLISSLFTIITFSCNTNRFMYPEKPIVFLSMCYFFHSCGSLLGAILGRR
NVICRPFDEQLDYLVGYGNETTWCKINFLMLYFFSSASALWWVILTVTWF
LSASRHWGYEAIESISSVLHLISWGIPALKSIFVLILHKIDADELTGQCF
VGNNDKDALIGFILVPQIVYLLIGVTFLGLGYYSILKVRKSFLRQPSCID
PSNLKRLEKLMAKIGVFSILYIVPVTCTIVSYVIDVFKTPYFDVMLKALY
EYSSDCVTFKGLSWSLAKCVDIIQPALPSVEMRMLRIFMNLVIGITSGIW
IWGNKKSFQNCGRGAKKDGQQQCEMKQIEVVNPITNNYSYLKHSDCSSPT
QGWNYAPVSESQSTRGVTSQTPIEGIVAPHNSSISEASSRH*
>Pmo_014048 frizzled-like
KLSVFLLLVVGILSSQVTARRNDKPSLDVYKQCTLITEPVCQDVRYTHTR
MPNFIGIYSQNEASKRVRDYYPLINLQCSNYLKLFLCSMYFPICDSEAAI
STPVVQPCRRFCNHVKSRCEPFMTNTYHSPWPNELDCEKLPSSGKMCLTP
DSFSLDKEVEKEPSHVDTMKNLLQKLELSLKQSDKDKSRIDLLMKAGLYA
SAKCLPYQINMGQTPNISCVQRCDSDVKFNEDDKSFANIWLISWSLLCLV
SSLLTIITFSCNTQRFMYPEKPIVFLSICYFFYSCGNLLGAVLGKRNVIC
RPFDEQLDFLVGNGNETTWCKINFLMLYFFSSASALWWVVLTVTWFLSAS
RHWGYEAIESVSSILHLVSWGIPALKSIFVLILHKIDADELTGQCYVGNS
DKEALIGFILVPQVLYLVTGVTFLALGYYSILKVRKSFLQQVSCIDTTNL
KRLEKLMAKIGVFSILYIVPVTCTIISYVIDIFRTSYFDLMLKALYEYSA
DCVTVKGLSWSLAKCVDIIQPALPSIEVRMLRIFMNLVIGITSGIWIWGN
KKSFRYCGRNKKDIQQCEMRQIEVLTPLNQTPFIKSGEGTFPHHGWSYVP
TLASEHAVGGLSQTPVEGIMAPNNSSISEVSSKH*

Created by

Powered By

Admin Log In

Education - This is a contributing Drupal Theme
Design by WeebPal.